Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|709
Gene name
LocationContig_113:51392..52454
Strand+
Gene length (bp)1062
Transcript length (bp)999
Coding sequence length (bp)999
Protein length (aa) 333

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 2.9E-19 29 158
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 1.4E-12 38 178
PF08659 KR KR domain 6.6E-08 30 152

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 16 283 1.0E-39
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 26 249 5.0E-29
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 25 249 1.0E-27
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 25 294 2.0E-26
sp|P59837|RDH12_BOVIN Retinol dehydrogenase 12 OS=Bos taurus GN=RDH12 PE=2 SV=1 25 294 9.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 16 283 1.0E-39
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 26 249 5.0E-29
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 25 249 1.0E-27
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 25 294 2.0E-26
sp|P59837|RDH12_BOVIN Retinol dehydrogenase 12 OS=Bos taurus GN=RDH12 PE=2 SV=1 25 294 9.0E-26
sp|Q8BYK4|RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1 28 252 9.0E-25
sp|Q8NBN7|RDH13_HUMAN Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2 24 248 7.0E-22
sp|A2RVM0|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana GN=TIC32 PE=2 SV=1 20 278 5.0E-21
sp|Q9HBH5|RDH14_HUMAN Retinol dehydrogenase 14 OS=Homo sapiens GN=RDH14 PE=1 SV=1 26 277 3.0E-20
sp|Q9ERI6|RDH14_MOUSE Retinol dehydrogenase 14 OS=Mus musculus GN=Rdh14 PE=1 SV=1 26 277 2.0E-19
sp|Q8CEE7|RDH13_MOUSE Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 PE=1 SV=1 24 248 4.0E-19
sp|Q6RVV4|TIC32_PEA Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1 20 277 4.0E-18
sp|Q08651|ENV9_YEAST Probable oxidoreductase ENV9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENV9 PE=1 SV=1 29 283 1.0E-17
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 25 332 1.0E-14
sp|Q17QU7|DHR13_BOVIN Dehydrogenase/reductase SDR family member 13 OS=Bos taurus GN=DHRS13 PE=2 SV=1 23 242 1.0E-14
sp|A0PJE2|DHR12_HUMAN Dehydrogenase/reductase SDR family member 12 OS=Homo sapiens GN=DHRS12 PE=2 SV=2 16 181 2.0E-14
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 25 238 2.0E-14
sp|Q6UX07|DHR13_HUMAN Dehydrogenase/reductase SDR family member 13 OS=Homo sapiens GN=DHRS13 PE=2 SV=1 23 242 4.0E-14
sp|Q9VLU5|WWOX_DROME WW domain-containing oxidoreductase OS=Drosophila melanogaster GN=Wwox PE=2 SV=1 20 257 6.0E-14
sp|Q5SS80|DHR13_MOUSE Dehydrogenase/reductase SDR family member 13 OS=Mus musculus GN=Dhrs13 PE=1 SV=1 23 242 3.0E-13
sp|Q5R9W5|WWOX_PONAB WW domain-containing oxidoreductase OS=Pongo abelii GN=WWOX PE=2 SV=1 25 277 5.0E-13
sp|Q8N5I4|DHRSX_HUMAN Dehydrogenase/reductase SDR family member on chromosome X OS=Homo sapiens GN=DHRSX PE=2 SV=2 12 277 7.0E-13
sp|A6QP05|DHR12_BOVIN Dehydrogenase/reductase SDR family member 12 OS=Bos taurus GN=DHRS12 PE=2 SV=1 28 214 1.0E-12
sp|Q9NZC7|WWOX_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens GN=WWOX PE=1 SV=1 25 238 2.0E-12
sp|Q7Q732|DHRS7_ANOGA Dehydrogenase/reductase SDR family protein 7-like OS=Anopheles gambiae GN=AGAP005532 PE=3 SV=3 26 243 3.0E-12
sp|P35320|OXIR_STRLI Probable oxidoreductase OS=Streptomyces lividans PE=3 SV=1 25 244 3.0E-12
sp|Q8K354|CBR3_MOUSE Carbonyl reductase [NADPH] 3 OS=Mus musculus GN=Cbr3 PE=1 SV=1 29 247 1.0E-11
sp|Q9ZUH5|SDR2B_ARATH Short-chain dehydrogenase/reductase 2b OS=Arabidopsis thaliana GN=SDR2b PE=2 SV=1 23 249 2.0E-11
sp|Q9M2E2|SDR1_ARATH (+)-neomenthol dehydrogenase OS=Arabidopsis thaliana GN=SDR1 PE=1 SV=1 23 121 6.0E-11
sp|Q9RPT1|RHLG_PSEAE Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlG PE=1 SV=1 16 168 1.0E-10
sp|P47727|CBR1_RAT Carbonyl reductase [NADPH] 1 OS=Rattus norvegicus GN=Cbr1 PE=1 SV=2 30 243 1.0E-10
sp|Q803A8|WWOX_DANRE WW domain-containing oxidoreductase OS=Danio rerio GN=wwox PE=2 SV=1 11 277 1.0E-10
sp|Q03326|OXIR_STRAT Probable oxidoreductase OS=Streptomyces antibioticus PE=3 SV=1 25 244 1.0E-10
sp|P46331|YXBG_BACSU Uncharacterized oxidoreductase YxbG OS=Bacillus subtilis (strain 168) GN=yxbG PE=3 SV=2 26 242 2.0E-10
sp|Q9Y140|DHRS7_DROME Dehydrogenase/reductase SDR family protein 7-like OS=Drosophila melanogaster GN=CG7601 PE=2 SV=1 2 243 3.0E-10
sp|P55575|Y4MP_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4mP OS=Rhizobium sp. (strain NGR234) GN=NGR_a02430 PE=3 SV=1 26 246 4.0E-10
sp|Q8VBZ0|DHRSX_MOUSE Dehydrogenase/reductase SDR family member on chromosome X homolog OS=Mus musculus GN=Dhrsx PE=1 SV=2 12 277 5.0E-10
sp|Q92247|BLI4_NEUCR Putative oxidoreductase bli-4, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bli-4 PE=1 SV=1 18 175 7.0E-10
sp|Q8MI29|CBR1_MACFA Carbonyl reductase [NADPH] 1 OS=Macaca fascicularis GN=CBR1 PE=2 SV=1 29 243 8.0E-10
sp|P40288|DHG_BACME Glucose 1-dehydrogenase OS=Bacillus megaterium PE=1 SV=1 25 240 9.0E-10
sp|P07999|DHGB_BACME Glucose 1-dehydrogenase B OS=Bacillus megaterium GN=gdhB PE=1 SV=2 25 240 1.0E-09
sp|Q9WYG0|Y325_THEMA Uncharacterized oxidoreductase TM_0325 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0325 PE=3 SV=1 25 255 1.0E-09
sp|P16152|CBR1_HUMAN Carbonyl reductase [NADPH] 1 OS=Homo sapiens GN=CBR1 PE=1 SV=3 30 243 2.0E-09
sp|P39482|DHG1_BACME Glucose 1-dehydrogenase 1 OS=Bacillus megaterium GN=gdhI PE=2 SV=1 25 240 2.0E-09
sp|Q9WVK3|PECR_RAT Peroxisomal trans-2-enoyl-CoA reductase OS=Rattus norvegicus GN=Pecr PE=2 SV=1 26 150 2.0E-09
sp|P80869|DHG2_BACSU Glucose 1-dehydrogenase 2 OS=Bacillus subtilis (strain 168) GN=ycdF PE=1 SV=2 25 245 2.0E-09
sp|Q5RCU5|CBR1_PONAB Carbonyl reductase [NADPH] 1 OS=Pongo abelii GN=CBR1 PE=2 SV=3 30 243 2.0E-09
sp|Q42536|PORA_ARATH Protochlorophyllide reductase A, chloroplastic OS=Arabidopsis thaliana GN=PORA PE=1 SV=2 13 159 4.0E-09
sp|Q0VFE7|DRS7B_XENTR Dehydrogenase/reductase SDR family member 7B OS=Xenopus tropicalis GN=dhrs7b PE=2 SV=1 24 243 7.0E-09
sp|Q0IH28|DRS7B_XENLA Dehydrogenase/reductase SDR family member 7B OS=Xenopus laevis GN=dhrs7b PE=2 SV=1 24 243 1.0E-08
sp|Q6WAU1|IPIPR_MENPI (-)-isopiperitenone reductase OS=Mentha piperita PE=1 SV=1 32 121 1.0E-08
sp|H9BFQ1|TPRL2_ERYCB Tropinone reductase-like 2 OS=Erythroxylum coca PE=2 SV=1 26 161 3.0E-08
sp|Q8K3P0|DR9C7_MOUSE Short-chain dehydrogenase/reductase family 9C member 7 OS=Mus musculus GN=Sdr9c7 PE=2 SV=1 23 252 5.0E-08
sp|O80333|POR_MARPA Protochlorophyllide reductase, chloroplastic OS=Marchantia paleacea GN=PORA PE=2 SV=1 32 152 5.0E-08
sp|B2X050|MNR1_CAPAN (+)-neomenthol dehydrogenase OS=Capsicum annuum GN=MNR1 PE=1 SV=1 27 125 5.0E-08
sp|H9BFQ0|TPRL1_ERYCB Tropinone reductase-like 1 OS=Erythroxylum coca PE=2 SV=1 26 161 6.0E-08
sp|Q566S6|DRS7B_DANRE Dehydrogenase/reductase SDR family member 7B OS=Danio rerio GN=dhrs7b PE=2 SV=1 25 243 6.0E-08
sp|O75828|CBR3_HUMAN Carbonyl reductase [NADPH] 3 OS=Homo sapiens GN=CBR3 PE=1 SV=3 29 242 6.0E-08
sp|A4IFM3|DR9C7_BOVIN Short-chain dehydrogenase/reductase family 9C member 7 OS=Bos taurus GN=SDR9C7 PE=2 SV=1 23 248 7.0E-08
sp|Q39617|POR_CHLRE Protochlorophyllide reductase, chloroplastic OS=Chlamydomonas reinhardtii GN=PORA PE=3 SV=1 15 164 8.0E-08
sp|Q28960|CBR1_PIG Carbonyl reductase [NADPH] 1 OS=Sus scrofa GN=CBR1 PE=1 SV=3 29 243 2.0E-07
sp|Q3SZD7|CBR1_BOVIN Carbonyl reductase [NADPH] 1 OS=Bos taurus GN=CBR1 PE=2 SV=1 27 243 2.0E-07
sp|Q49117|Y182_METEA Uncharacterized oxidoreductase MexAM1_META1p0182 OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=MexAM1_META1p0182 PE=3 SV=2 26 168 2.0E-07
sp|Q42850|PORB_HORVU Protochlorophyllide reductase B, chloroplastic OS=Hordeum vulgare GN=PORB PE=2 SV=1 32 152 2.0E-07
sp|Q8W3D9|PORB_ORYSJ Protochlorophyllide reductase B, chloroplastic OS=Oryza sativa subsp. japonica GN=PORB PE=2 SV=1 32 159 2.0E-07
sp|Q01289|POR_PEA Protochlorophyllide reductase, chloroplastic OS=Pisum sativum GN=3PCR PE=1 SV=1 32 144 2.0E-07
sp|Q9STY8|HSD2_ARATH 11-beta-hydroxysteroid dehydrogenase-like 2 OS=Arabidopsis thaliana GN=HSD2 PE=2 SV=1 22 162 3.0E-07
sp|P50162|TRN1_DATST Tropinone reductase 1 OS=Datura stramonium GN=TR1 PE=1 SV=1 26 176 3.0E-07
sp|Q08632|SDR1_PICAB Short-chain type dehydrogenase/reductase OS=Picea abies PE=2 SV=1 26 150 3.0E-07
sp|P0A2D1|UCPA_SALTY Oxidoreductase UcpA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ucpA PE=3 SV=1 26 243 3.0E-07
sp|P0A2D2|UCPA_SALTI Oxidoreductase UcpA OS=Salmonella typhi GN=ucpA PE=3 SV=1 26 243 3.0E-07
sp|Q9BY49|PECR_HUMAN Peroxisomal trans-2-enoyl-CoA reductase OS=Homo sapiens GN=PECR PE=1 SV=2 26 150 3.0E-07
sp|P12310|DHG_BACSU Glucose 1-dehydrogenase OS=Bacillus subtilis (strain 168) GN=gdh PE=2 SV=2 25 246 4.0E-07
sp|Q1DNC5|MKAR_COCIM Very-long-chain 3-oxoacyl-CoA reductase OS=Coccidioides immitis (strain RS) GN=CIMG_08188 PE=3 SV=2 32 161 5.0E-07
sp|P50165|TRNH_DATST Tropinone reductase homolog OS=Datura stramonium PE=2 SV=1 21 156 5.0E-07
sp|O31680|YKVO_BACSU Uncharacterized oxidoreductase YkvO OS=Bacillus subtilis (strain 168) GN=ykvO PE=3 SV=1 26 150 5.0E-07
sp|Q94KL7|SILD_FORIN Secoisolariciresinol dehydrogenase (Fragment) OS=Forsythia intermedia PE=1 SV=1 26 156 6.0E-07
sp|P25145|Y432_LISMO Uncharacterized oxidoreductase Lmo0432 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0432 PE=3 SV=2 26 124 1.0E-06
sp|Q9STY7|HSD3_ARATH 11-beta-hydroxysteroid dehydrogenase-like 3 OS=Arabidopsis thaliana GN=HSD3 PE=3 SV=1 22 162 1.0E-06
sp|Q92EK7|Y452_LISIN Uncharacterized oxidoreductase Lin0452 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin0452 PE=3 SV=1 26 124 1.0E-06
sp|P50197|LINC_SPHPI 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase OS=Sphingomonas paucimobilis GN=linC PE=2 SV=1 23 162 1.0E-06
sp|Q7FAE1|MOMAS_ORYSJ Momilactone A synthase OS=Oryza sativa subsp. japonica GN=Os04g0179200 PE=2 SV=1 26 156 1.0E-06
sp|Q6F7B8|ACR1_ACIAD Fatty acyl-CoA reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=acr1 PE=1 SV=2 25 178 1.0E-06
sp|Q6CHP1|MKAR_YARLI Very-long-chain 3-oxoacyl-CoA reductase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0A06787g PE=3 SV=1 32 223 1.0E-06
sp|P0DKC6|HSD1B_ARATH 11-beta-hydroxysteroid dehydrogenase 1B OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 18 175 2.0E-06
sp|P0DKC5|HSD1A_ARATH 11-beta-hydroxysteroid dehydrogenase 1A OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 18 175 2.0E-06
sp|Q9C826|ABA2_ARATH Xanthoxin dehydrogenase OS=Arabidopsis thaliana GN=ABA2 PE=1 SV=1 26 147 2.0E-06
sp|Q937L4|CPNA_COMTE Cyclopentanol dehydrogenase OS=Comamonas testosteroni GN=cpnA PE=3 SV=1 26 150 2.0E-06
sp|Q8GAV9|CPNA_COMS9 Cyclopentanol dehydrogenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnA PE=1 SV=1 26 150 2.0E-06
sp|F4J300|SDR5_ARATH Short-chain dehydrogenase reductase 5 OS=Arabidopsis thaliana GN=SDR5 PE=3 SV=1 26 144 2.0E-06
sp|Q8NEX9|DR9C7_HUMAN Short-chain dehydrogenase/reductase family 9C member 7 OS=Homo sapiens GN=SDR9C7 PE=1 SV=1 23 252 3.0E-06
sp|P50941|FABG_RICPR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia prowazekii (strain Madrid E) GN=fabG PE=1 SV=2 25 242 3.0E-06
sp|A6ZLA1|MKAR_YEAS7 Very-long-chain 3-oxoacyl-CoA reductase OS=Saccharomyces cerevisiae (strain YJM789) GN=SCY_0371 PE=3 SV=1 4 177 3.0E-06
sp|B3LN00|MKAR_YEAS1 Very-long-chain 3-oxoacyl-CoA reductase OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SCRG_02811 PE=3 SV=1 4 177 3.0E-06
sp|A4UHT7|SALR_PAPBR Salutaridine reductase OS=Papaver bracteatum GN=SALR PE=1 SV=1 29 121 4.0E-06
sp|Q7RYE5|MKAR_NEUCR Very-long-chain 3-oxoacyl-CoA reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU11297 PE=3 SV=1 32 161 4.0E-06
sp|O66148|POR_LEPBY Light-dependent protochlorophyllide reductase OS=Leptolyngbya boryana GN=por PE=3 SV=2 32 144 4.0E-06
sp|P0AEK3|FABG_SHIFL 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Shigella flexneri GN=fabG PE=3 SV=1 25 119 6.0E-06
sp|P0AEK2|FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) GN=fabG PE=1 SV=1 25 119 6.0E-06
sp|O80713|SDR3A_ARATH Short-chain dehydrogenase reductase 3a OS=Arabidopsis thaliana GN=SDR3a PE=2 SV=1 26 162 6.0E-06
sp|Q071N0|SALR_PAPSO Salutaridine reductase OS=Papaver somniferum GN=SALR PE=1 SV=1 29 121 6.0E-06
sp|Q8SPU8|DHRS4_BOVIN Dehydrogenase/reductase SDR family member 4 OS=Bos taurus GN=DHRS4 PE=2 SV=2 26 244 7.0E-06
sp|Q9Z8P2|FABG_CHLPN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia pneumoniae GN=fabG PE=3 SV=1 26 119 7.0E-06
sp|Q9SDT1|POR_DAUCA Protochlorophyllide reductase, chloroplastic OS=Daucus carota GN=POR1 PE=2 SV=1 32 144 7.0E-06
sp|Q8CHS7|DRS7C_MOUSE Dehydrogenase/reductase SDR family member 7C OS=Mus musculus GN=Dhrs7c PE=1 SV=3 26 154 8.0E-06
sp|Q99RF5|Y2478_STAAM Uncharacterized oxidoreductase SAV2478 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2478 PE=3 SV=1 26 217 8.0E-06
sp|Q7A3L9|Y2266_STAAN Uncharacterized oxidoreductase SA2266 OS=Staphylococcus aureus (strain N315) GN=SA2266 PE=1 SV=1 26 217 8.0E-06
sp|Q41578|PORA_WHEAT Protochlorophyllide reductase A, chloroplastic OS=Triticum aestivum GN=PORA PE=3 SV=1 81 171 9.0E-06
sp|P13653|PORA_HORVU Protochlorophyllide reductase A, chloroplastic OS=Hordeum vulgare GN=PORA PE=1 SV=1 81 171 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|709
MVALSTFWTHFFPPKPHFTVDHVADLSGKVYLVTGSNTGLGKELAQMLYSRNAKVYIAARSEDKAARAIEDMKSA
APTSTGSLVFIHLDLSDLHKVRSAAQHFLAQESKLNVLFNNAGVMGSPLEPAPKTAQGYDLALGVNCLGTLLLTQ
LLTPVLTETAKKEPPSSVRVVWLSSFGMELQAQPRIGISTDNLDYQIPKPVEDRYSISKTGVWALAVEYARRHKT
DGIVSVPLNPGNLRTELARDQGVMLRLVAALVCYPAIHGACAQLFAAFSPEVAIDTANWSTTWVGPFGRLIPLRT
DLVEATVPEEEGGTGGTAKFWEWSEKQIAEAL*
Coding >OphauB2|709
ATGGTTGCTCTATCTACTTTTTGGACTCACTTCTTTCCGCCAAAGCCGCACTTTACCGTTGACCATGTGGCCGAC
TTGAGCGGCAAAGTCTATCTAGTGACAGGGTCCAATACTGGTCTCGGCAAAGAGCTGGCCCAGATGCTCTATAGC
CGCAATGCCAAAGTCTATATCGCTGCACGTTCTGAAGACAAGGCTGCCAGGGCCATTGAGGACATGAAAAGCGCC
GCCCCAACGTCGACTGGGTCTTTGGTCTTTATACACCTCGATCTGAGCGACCTGCACAAGGTGAGAAGCGCTGCT
CAGCACTTCCTCGCCCAGGAGTCGAAGCTCAATGTTCTCTTCAACAACGCCGGTGTCATGGGCAGCCCCCTAGAG
CCTGCTCCCAAGACGGCTCAGGGCTACGACCTCGCCCTGGGCGTCAACTGTCTCGGCACTCTTCTCCTCACGCAG
CTGCTCACCCCAGTCCTGACTGAGACGGCAAAGAAAGAGCCGCCTAGCTCCGTGCGCGTAGTTTGGCTCTCATCC
TTTGGCATGGAGCTGCAGGCTCAGCCGCGAATTGGCATCTCGACGGACAACCTCGACTACCAAATCCCCAAGCCG
GTCGAGGATCGCTACAGCATTAGCAAGACTGGCGTATGGGCCTTGGCCGTTGAGTATGCTCGGCGCCACAAGACG
GATGGAATCGTCAGCGTGCCCCTCAACCCAGGTAACCTGCGCACCGAGCTGGCGCGAGATCAGGGCGTCATGTTG
AGACTTGTTGCCGCACTCGTCTGTTATCCCGCTATCCACGGCGCGTGTGCGCAGCTCTTTGCCGCATTCTCTCCA
GAGGTCGCCATAGACACGGCCAATTGGTCTACAACATGGGTTGGCCCCTTTGGCCGGCTTATCCCCCTCAGGACG
GACTTGGTGGAAGCCACGGTGCCCGAGGAGGAGGGCGGTACGGGAGGAACGGCCAAGTTTTGGGAGTGGAGCGAG
AAGCAGATTGCCGAGGCACTTTGA
Transcript >OphauB2|709
ATGGTTGCTCTATCTACTTTTTGGACTCACTTCTTTCCGCCAAAGCCGCACTTTACCGTTGACCATGTGGCCGAC
TTGAGCGGCAAAGTCTATCTAGTGACAGGGTCCAATACTGGTCTCGGCAAAGAGCTGGCCCAGATGCTCTATAGC
CGCAATGCCAAAGTCTATATCGCTGCACGTTCTGAAGACAAGGCTGCCAGGGCCATTGAGGACATGAAAAGCGCC
GCCCCAACGTCGACTGGGTCTTTGGTCTTTATACACCTCGATCTGAGCGACCTGCACAAGGTGAGAAGCGCTGCT
CAGCACTTCCTCGCCCAGGAGTCGAAGCTCAATGTTCTCTTCAACAACGCCGGTGTCATGGGCAGCCCCCTAGAG
CCTGCTCCCAAGACGGCTCAGGGCTACGACCTCGCCCTGGGCGTCAACTGTCTCGGCACTCTTCTCCTCACGCAG
CTGCTCACCCCAGTCCTGACTGAGACGGCAAAGAAAGAGCCGCCTAGCTCCGTGCGCGTAGTTTGGCTCTCATCC
TTTGGCATGGAGCTGCAGGCTCAGCCGCGAATTGGCATCTCGACGGACAACCTCGACTACCAAATCCCCAAGCCG
GTCGAGGATCGCTACAGCATTAGCAAGACTGGCGTATGGGCCTTGGCCGTTGAGTATGCTCGGCGCCACAAGACG
GATGGAATCGTCAGCGTGCCCCTCAACCCAGGTAACCTGCGCACCGAGCTGGCGCGAGATCAGGGCGTCATGTTG
AGACTTGTTGCCGCACTCGTCTGTTATCCCGCTATCCACGGCGCGTGTGCGCAGCTCTTTGCCGCATTCTCTCCA
GAGGTCGCCATAGACACGGCCAATTGGTCTACAACATGGGTTGGCCCCTTTGGCCGGCTTATCCCCCTCAGGACG
GACTTGGTGGAAGCCACGGTGCCCGAGGAGGAGGGCGGTACGGGAGGAACGGCCAAGTTTTGGGAGTGGAGCGAG
AAGCAGATTGCCGAGGCACTTTGA
Gene >OphauB2|709
ATGGTTGCTCTATCTACTTTTTGGACTCACTTCTTTCCGCCAAAGCCGCACTTTACCGTTGACCATGTGGCCGAC
TTGAGCGGCAAAGTCTATCTAGTGACAGGGTCCAATACTGGTCTCGGCAAAGAGCTGGCCCAGATGCTCTATAGC
CGCAATGCCAAAGTCTATATCGCTGCACGTTCTGAAGACAAGGCTGCCAGGGCCATTGAGGACATGAAAAGCGCC
GCCCCAACGTCGACTGGGTCTTTGGTCTTTATACACCTCGATCTGAGCGACCTGCACAAGGTGAGAAGCGCTGCT
CAGCACTTCCTCGCCCAGGAGTCGAAGCTCAATGTTCTCTTCAACAACGCCGGTGTCATGGGCAGCCCCCTAGAG
CCTGCTCCCAAGACGGCTCAGGGCTACGACCTCGCCCTGGGCGTCAACTGTCTCGGCACTCTTCTCCTCACGCAG
CTGCTCACCCCAGTCCTGACTGAGACGGCAAAGAAAGAGCCGCCTAGCTCCGTGCGCGTAGTTTGGCTCTCATCC
TTTGGCATGGAGCTGCAGGCTCAGCCGCGAATTGGCATCTCGACGGACAACCTCGACTACCAAATCCCCAAGCCG
GTCGAGGATCGCTACAGCATTAGCAAGACTGGCGTATGGGCCTTGGCCGTTGAGTATGCTCGGCGCCACAAGACG
GATGGAATCGTCAGCGTGCCCCTCAACCCAGGTAACCTGCGCACCGAGCTGGCGCGAGATCAGGGCGTCATGTTG
AGACTTGTTGCCGCACTCGTCTGTTATCCCGCTATCCACGGCGCGTGTGCGCAGCTCTTTGCCGCATTCTCTCCA
GAGGTCGCCATAGACACGGCCAATTGGTCTACAACATGGGGTATGTCTTCTCACCTCGTCCCATTTCCTACCTCT
AGAATGACTGCTTAACTAGTCCGTCTAGTTGGCCCCTTTGGCCGGCTTATCCCCCTCAGGACGGACTTGGTGGAA
GCCACGGTGCCCGAGGAGGAGGGCGGTACGGGAGGAACGGCCAAGTTTTGGGAGTGGAGCGAGAAGCAGATTGCC
GAGGCACTTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail