Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7083
Gene name
LocationContig_70:59149..60655
Strand-
Gene length (bp)1506
Transcript length (bp)1443
Coding sequence length (bp)1443
Protein length (aa) 481

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00155 Aminotran_1_2 Aminotransferase class I and II 6.5E-40 92 462

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P52892|ALAT_YEAST Probable alanine aminotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALT2 PE=1 SV=1 2 480 3.0E-168
sp|P52893|ALAM_YEAST Probable alanine aminotransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALT1 PE=1 SV=1 2 480 4.0E-167
sp|Q54MJ7|ALAM_DICDI Probable alanine aminotransferase, mitochondrial OS=Dictyostelium discoideum GN=gpt PE=3 SV=1 3 480 1.0E-161
sp|Q10334|ALAT_SCHPO Putative alanine aminotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC582.08 PE=3 SV=1 6 479 6.0E-151
sp|P52894|ALA2_HORVU Alanine aminotransferase 2 OS=Hordeum vulgare PE=1 SV=1 6 480 3.0E-148
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P52892|ALAT_YEAST Probable alanine aminotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALT2 PE=1 SV=1 2 480 3.0E-168
sp|P52893|ALAM_YEAST Probable alanine aminotransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALT1 PE=1 SV=1 2 480 4.0E-167
sp|Q54MJ7|ALAM_DICDI Probable alanine aminotransferase, mitochondrial OS=Dictyostelium discoideum GN=gpt PE=3 SV=1 3 480 1.0E-161
sp|Q10334|ALAT_SCHPO Putative alanine aminotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC582.08 PE=3 SV=1 6 479 6.0E-151
sp|P52894|ALA2_HORVU Alanine aminotransferase 2 OS=Hordeum vulgare PE=1 SV=1 6 480 3.0E-148
sp|Q6GM82|ALAT2_XENLA Alanine aminotransferase 2 OS=Xenopus laevis GN=gpt2 PE=2 SV=1 3 479 3.0E-146
sp|Q8BGT5|ALAT2_MOUSE Alanine aminotransferase 2 OS=Mus musculus GN=Gpt2 PE=1 SV=1 3 479 2.0E-143
sp|Q9LR30|GGT1_ARATH Glutamate--glyoxylate aminotransferase 1 OS=Arabidopsis thaliana GN=GGAT1 PE=1 SV=1 3 479 3.0E-143
sp|Q9S7E9|GGT2_ARATH Glutamate--glyoxylate aminotransferase 2 OS=Arabidopsis thaliana GN=GGAT2 PE=1 SV=1 3 479 3.0E-143
sp|Q9LDV4|ALAT2_ARATH Alanine aminotransferase 2, mitochondrial OS=Arabidopsis thaliana GN=ALAAT2 PE=2 SV=1 6 480 6.0E-143
sp|Q28DB5|ALAT2_XENTR Alanine aminotransferase 2 OS=Xenopus tropicalis GN=gpt2 PE=2 SV=1 3 479 5.0E-142
sp|Q8TD30|ALAT2_HUMAN Alanine aminotransferase 2 OS=Homo sapiens GN=GPT2 PE=1 SV=1 3 479 2.0E-140
sp|Q6NYL5|ALAT2_DANRE Alanine aminotransferase 2-like OS=Danio rerio GN=gpt2l PE=2 SV=2 3 479 5.0E-139
sp|F4I7I0|ALAT1_ARATH Alanine aminotransferase 1, mitochondrial OS=Arabidopsis thaliana GN=ALAAT1 PE=1 SV=1 6 480 9.0E-138
sp|P24298|ALAT1_HUMAN Alanine aminotransferase 1 OS=Homo sapiens GN=GPT PE=1 SV=3 3 479 3.0E-137
sp|P34106|ALA2_PANMI Alanine aminotransferase 2 OS=Panicum miliaceum PE=1 SV=1 6 480 4.0E-136
sp|Q8QZR5|ALAT1_MOUSE Alanine aminotransferase 1 OS=Mus musculus GN=Gpt PE=1 SV=3 3 479 2.0E-135
sp|A4IFH5|ALAT1_BOVIN Alanine aminotransferase 1 OS=Bos taurus GN=GPT PE=2 SV=1 3 479 1.0E-134
sp|P25409|ALAT1_RAT Alanine aminotransferase 1 OS=Rattus norvegicus GN=Gpt PE=1 SV=2 3 479 2.0E-134
sp|P71348|ALAA_HAEIN Glutamate-pyruvate aminotransferase AlaA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=alaA PE=3 SV=1 102 480 5.0E-31
sp|P9WQ91|AAT_MYCTU Probable aspartate aminotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=aspC PE=1 SV=1 93 480 9.0E-26
sp|P9WQ90|AAT_MYCTO Probable aspartate aminotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=aspC PE=3 SV=1 93 480 9.0E-26
sp|P63499|AAT_MYCBO Probable aspartate aminotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=aspC PE=3 SV=1 93 480 9.0E-26
sp|P0A961|ALAA_SHIFL Glutamate-pyruvate aminotransferase AlaA OS=Shigella flexneri GN=alaA PE=3 SV=1 102 479 9.0E-23
sp|P0A959|ALAA_ECOLI Glutamate-pyruvate aminotransferase AlaA OS=Escherichia coli (strain K12) GN=alaA PE=1 SV=1 102 479 9.0E-23
sp|P0A960|ALAA_ECOL6 Glutamate-pyruvate aminotransferase AlaA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=alaA PE=3 SV=1 102 479 9.0E-23
sp|P14909|AAT_SULSO Aspartate aminotransferase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=aspC PE=1 SV=2 112 457 1.0E-21
sp|Q55128|AAT_SYNY3 Aspartate aminotransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=aspC PE=3 SV=1 92 445 2.0E-19
sp|Q795M6|YUGH_BACSU Putative aminotransferase YugH OS=Bacillus subtilis (strain 168) GN=yugH PE=3 SV=1 98 478 2.0E-19
sp|P53001|AAT1_BACSU Aspartate aminotransferase OS=Bacillus subtilis (strain 168) GN=aspB PE=3 SV=1 112 472 5.0E-19
sp|Q58874|Y1479_METJA Uncharacterized aminotransferase MJ1479 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1479 PE=3 SV=1 111 479 5.0E-18
sp|P16524|PATA_BACSU Putative N-acetyl-LL-diaminopimelate aminotransferase OS=Bacillus subtilis (strain 168) GN=patA PE=1 SV=3 80 457 5.0E-18
sp|P31531|1A1C_SOYBN 1-aminocyclopropane-1-carboxylate synthase OS=Glycine max GN=ACS1 PE=2 SV=1 108 444 5.0E-18
sp|O58489|AAT_PYRHO Aspartate aminotransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=aspC PE=3 SV=1 92 473 8.0E-18
sp|Q59228|AAT_GEOSE Aspartate aminotransferase OS=Geobacillus stearothermophilus GN=aspC PE=3 SV=1 112 445 1.0E-17
sp|Q9LQ10|1A110_ARATH Probable aminotransferase ACS10 OS=Arabidopsis thaliana GN=ACS10 PE=1 SV=1 73 442 1.0E-17
sp|O67781|AAT_AQUAE Aspartate aminotransferase OS=Aquifex aeolicus (strain VF5) GN=aspC PE=3 SV=1 112 445 2.0E-17
sp|Q9STR4|1A17_ARATH 1-aminocyclopropane-1-carboxylate synthase 7 OS=Arabidopsis thaliana GN=ACS7 PE=1 SV=1 117 266 3.0E-17
sp|Q10DK7|1A11_ORYSJ 1-aminocyclopropane-1-carboxylate synthase 1 OS=Oryza sativa subsp. japonica GN=ACC1 PE=2 SV=1 117 312 3.0E-17
sp|A2XLL2|1A11_ORYSI 1-aminocyclopropane-1-carboxylate synthase 1 OS=Oryza sativa subsp. indica GN=ACC1 PE=2 SV=2 117 312 3.0E-17
sp|Q9ST03|NAATB_HORVU Nicotianamine aminotransferase B OS=Hordeum vulgare GN=naat-B PE=1 SV=2 105 457 5.0E-17
sp|Q01912|1A1C_VIGRR 1-aminocyclopropane-1-carboxylate synthase (Fragment) OS=Vigna radiata var. radiata GN=ACS5 PE=2 SV=1 108 312 2.0E-16
sp|H3ZPU1|ARAT2_THELN Aromatic-amino-acid aminotransferase 2 OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=OCC_04737 PE=1 SV=1 92 447 4.0E-16
sp|Q9MB95|1A11_PRUMU 1-aminocyclopropane-1-carboxylate synthase 1 OS=Prunus mume GN=ACS1 PE=2 SV=1 108 281 4.0E-16
sp|Q9V0L2|AAT_PYRAB Aspartate aminotransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=aspC PE=3 SV=1 112 457 5.0E-16
sp|Q9ST02|NAATA_HORVU Nicotianamine aminotransferase A OS=Hordeum vulgare GN=naat-A PE=1 SV=2 105 474 5.0E-16
sp|P58350|AATB_RHIME Aspartate aminotransferase B OS=Rhizobium meliloti (strain 1021) GN=aatB PE=3 SV=1 112 445 5.0E-16
sp|Q06191|AATB_RHIML Aspartate aminotransferase B OS=Rhizobium meliloti GN=aatB PE=3 SV=1 112 457 6.0E-16
sp|P18485|1A12_SOLLC 1-aminocyclopropane-1-carboxylate synthase 2 OS=Solanum lycopersicum GN=ACS2 PE=1 SV=2 108 457 2.0E-15
sp|P23034|AAT_BACY2 Aspartate aminotransferase OS=Bacillus sp. (strain YM-2) PE=1 SV=1 112 445 2.0E-15
sp|Q9LVY1|TAT_ARATH Tyrosine aminotransferase OS=Arabidopsis thaliana GN=TAT PE=2 SV=1 112 457 2.0E-15
sp|P29535|1A14_SOLLC 1-aminocyclopropane-1-carboxylate synthase 4 OS=Solanum lycopersicum GN=ACS4 PE=2 SV=1 109 479 3.0E-15
sp|Q9FN30|TAT2_ARATH Probable aminotransferase TAT2 OS=Arabidopsis thaliana GN=At5g53970 PE=2 SV=1 112 462 4.0E-15
sp|Q9SUR6|CORI3_ARATH Cystine lyase CORI3 OS=Arabidopsis thaliana GN=CORI3 PE=1 SV=1 107 452 5.0E-15
sp|Q07262|1A1C_TOBAC 1-aminocyclopropane-1-carboxylate synthase OS=Nicotiana tabacum GN=ACS1 PE=2 SV=1 108 312 7.0E-15
sp|Q9S9U6|1A111_ARATH 1-aminocyclopropane-1-carboxylate synthase 11 OS=Arabidopsis thaliana GN=ACS11 PE=1 SV=1 93 442 1.0E-14
sp|Q9T065|1A18_ARATH 1-aminocyclopropane-1-carboxylate synthase 8 OS=Arabidopsis thaliana GN=ACS8 PE=1 SV=1 117 312 2.0E-14
sp|Q4J8X2|AAT_SULAC Aspartate aminotransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=aspC PE=3 SV=1 107 457 4.0E-14
sp|Q9SAR0|1A16_ARATH 1-aminocyclopropane-1-carboxylate synthase 6 OS=Arabidopsis thaliana GN=ACS6 PE=1 SV=2 103 303 4.0E-14
sp|P27486|1A1C_DIACA 1-aminocyclopropane-1-carboxylate synthase OS=Dianthus caryophyllus GN=ACS2 PE=2 SV=1 103 444 4.0E-14
sp|P37821|1A1C_MALDO 1-aminocyclopropane-1-carboxylate synthase OS=Malus domestica GN=ACS-1 PE=1 SV=2 117 281 2.0E-13
sp|Q58097|MFNC_METJA (5-formylfuran-3-yl)methyl phosphate transaminase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=mfnC PE=1 SV=2 112 478 2.0E-13
sp|Q00257|1A12_CUCMA 1-aminocyclopropane-1-carboxylate synthase CMA101 OS=Cucurbita maxima GN=ACS2 PE=2 SV=1 117 266 2.0E-13
sp|Q67Y55|TAT1_ARATH Probable aminotransferase TAT1 OS=Arabidopsis thaliana GN=At4g28420 PE=2 SV=1 107 445 4.0E-13
sp|Q9SIV0|SUR1_ARATH S-alkyl-thiohydroximate lyase SUR1 OS=Arabidopsis thaliana GN=SUR1 PE=1 SV=1 105 445 5.0E-13
sp|Q02635|AATA_RHIME Aspartate aminotransferase A OS=Rhizobium meliloti (strain 1021) GN=aatA PE=3 SV=1 112 445 6.0E-13
sp|Q8VYP2|TAT4_ARATH Probable aminotransferase TAT4 OS=Arabidopsis thaliana GN=At4g23590 PE=2 SV=1 107 452 7.0E-13
sp|P23279|1A11_CUCPE 1-aminocyclopropane-1-carboxylate synthase 1 OS=Cucurbita pepo GN=ACC1A PE=1 SV=1 34 312 8.0E-13
sp|Q43309|1A14_ARATH 1-aminocyclopropane-1-carboxylate synthase 4 OS=Arabidopsis thaliana GN=ACS4 PE=1 SV=1 117 284 8.0E-13
sp|P17735|ATTY_HUMAN Tyrosine aminotransferase OS=Homo sapiens GN=TAT PE=1 SV=1 13 266 9.0E-13
sp|P23599|1A11_CUCMA 1-aminocyclopropane-1-carboxylate synthase CMW33 OS=Cucurbita maxima GN=ACS1 PE=2 SV=1 37 312 1.0E-12
sp|Q60013|AAT_STRVG Aspartate aminotransferase OS=Streptomyces virginiae GN=aspC PE=3 SV=1 112 273 2.0E-12
sp|A5FRC5|DAPAT_DEHMB LL-diaminopimelate aminotransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=dapL PE=3 SV=1 112 471 2.0E-12
sp|Q00379|1A12_CUCPE 1-aminocyclopropane-1-carboxylate synthase 2 OS=Cucurbita pepo GN=ACS2 PE=2 SV=1 103 312 3.0E-12
sp|Q8QZR1|ATTY_MOUSE Tyrosine aminotransferase OS=Mus musculus GN=Tat PE=1 SV=1 66 444 3.0E-12
sp|Q54K95|ATTY_DICDI Tyrosine aminotransferase OS=Dictyostelium discoideum GN=tat PE=3 SV=1 5 471 3.0E-12
sp|Q9SK47|TAT3_ARATH Probable aminotransferase TAT3 OS=Arabidopsis thaliana GN=TAT3 PE=2 SV=1 105 445 3.0E-12
sp|P04694|ATTY_RAT Tyrosine aminotransferase OS=Rattus norvegicus GN=Tat PE=1 SV=1 66 266 3.0E-12
sp|Q60317|AAT_METJA Probable aspartate aminotransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0001 PE=3 SV=1 92 457 4.0E-12
sp|Q3ZXC8|DAPAT_DEHMC LL-diaminopimelate aminotransferase OS=Dehalococcoides mccartyi (strain CBDB1) GN=dapL PE=3 SV=1 112 471 5.0E-12
sp|Q9M2Y8|1A19_ARATH 1-aminocyclopropane-1-carboxylate synthase 9 OS=Arabidopsis thaliana GN=ACS9 PE=1 SV=1 117 281 1.0E-11
sp|Q06402|1A12_ARATH 1-aminocyclopropane-1-carboxylate synthase 2 OS=Arabidopsis thaliana GN=ACS2 PE=1 SV=1 103 312 1.0E-11
sp|Q1RGV0|AAT_RICBR Aspartate aminotransferase OS=Rickettsia bellii (strain RML369-C) GN=aatA PE=3 SV=1 112 457 2.0E-11
sp|Q72BI1|DAPAT_DESVH LL-diaminopimelate aminotransferase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=dapL PE=3 SV=1 112 457 3.0E-11
sp|Q3Z8H5|DAPAT_DEHM1 LL-diaminopimelate aminotransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=dapL PE=3 SV=1 112 471 3.0E-11
sp|Q37001|1A15_ARATH 1-aminocyclopropane-1-carboxylate synthase 5 OS=Arabidopsis thaliana GN=ACS5 PE=1 SV=1 117 312 3.0E-11
sp|Q972A2|AAT_SULTO Aspartate aminotransferase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=aspC PE=3 SV=1 112 477 3.0E-11
sp|A1VDD3|DAPAT_DESVV LL-diaminopimelate aminotransferase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=dapL PE=3 SV=1 112 457 3.0E-11
sp|Q8GYY0|1A112_ARATH Probable aminotransferase ACS12 OS=Arabidopsis thaliana GN=ACS12 PE=2 SV=2 106 303 3.0E-11
sp|O66630|DAPAT_AQUAE LL-diaminopimelate aminotransferase OS=Aquifex aeolicus (strain VF5) GN=dapL PE=3 SV=1 47 460 4.0E-11
sp|Q42881|1A13_SOLLC 1-aminocyclopropane-1-carboxylate synthase 3 OS=Solanum lycopersicum GN=ACS3 PE=1 SV=1 117 266 6.0E-11
sp|E9L7A5|PAT_PETHY Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase OS=Petunia hybrida PE=1 SV=1 112 445 9.0E-11
sp|Q5E9H2|1A1L1_BOVIN 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Bos taurus GN=ACCS PE=2 SV=1 121 266 9.0E-11
sp|C6BUK3|DAPAT_DESAD LL-diaminopimelate aminotransferase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=dapL PE=3 SV=1 112 457 1.0E-10
sp|Q58CZ9|ATTY_BOVIN Tyrosine aminotransferase OS=Bos taurus GN=TAT PE=2 SV=1 66 266 2.0E-10
sp|P33447|ATTY_TRYCR Tyrosine aminotransferase OS=Trypanosoma cruzi PE=1 SV=2 112 407 2.0E-10
sp|Q96QU6|1A1L1_HUMAN 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Homo sapiens GN=ACCS PE=1 SV=1 108 277 2.0E-10
sp|Q9SIE1|PAT_ARATH Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase OS=Arabidopsis thaliana GN=PAT PE=1 SV=2 112 445 3.0E-10
sp|P36692|AAT_STRGR Probable aspartate aminotransferase (Fragment) OS=Streptomyces griseus GN=aspC PE=3 SV=2 119 260 4.0E-10
sp|Q06429|1A11_ARATH 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Arabidopsis thaliana GN=ACS1 PE=1 SV=2 103 444 5.0E-10
sp|Q4AC99|1A1L2_HUMAN Probable inactive 1-aminocyclopropane-1-carboxylate synthase-like protein 2 OS=Homo sapiens GN=ACCSL PE=2 SV=3 112 276 6.0E-10
sp|A2AIG8|1A1L1_MOUSE 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Mus musculus GN=Accs PE=2 SV=1 108 277 6.0E-10
sp|Q9HUI9|ARUH_PSEAE Arginine--pyruvate transaminase AruH OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aruH PE=1 SV=1 112 445 6.0E-10
sp|Q4UND3|AAT_RICFE Aspartate aminotransferase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=aatA PE=3 SV=1 93 457 9.0E-10
sp|Q9W698|1A1L1_TAKRU 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Takifugu rubripes GN=accs PE=3 SV=1 112 277 2.0E-09
sp|Q92JE7|AAT_RICCN Aspartate aminotransferase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=aatA PE=3 SV=1 112 473 2.0E-09
sp|B8CX89|DAPAT_HALOH LL-diaminopimelate aminotransferase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=dapL PE=3 SV=1 108 446 3.0E-09
sp|O93744|AAT_THEKO Aspartate aminotransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=aspC PE=3 SV=1 94 445 4.0E-09
sp|B1I544|DAPAT_DESAP LL-diaminopimelate aminotransferase OS=Desulforudis audaxviator (strain MP104C) GN=dapL PE=3 SV=1 92 268 2.0E-08
sp|Q3UX83|1A1L2_MOUSE Probable inactive 1-aminocyclopropane-1-carboxylate synthase-like protein 2 OS=Mus musculus GN=Accsl PE=2 SV=1 112 276 4.0E-08
sp|O14209|YDT4_SCHPO Uncharacterized aminotransferase C6B12.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6B12.04c PE=3 SV=1 92 444 5.0E-08
sp|C6DF75|HIS8_PECCP Histidinol-phosphate aminotransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=hisC PE=3 SV=1 141 282 2.0E-07
sp|B2A250|DAPAT_NATTJ LL-diaminopimelate aminotransferase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=dapL PE=3 SV=1 92 454 4.0E-07
sp|B1LP20|HIS8_ECOSM Histidinol-phosphate aminotransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=hisC PE=3 SV=1 139 261 4.0E-07
sp|O33822|AAT_THEAQ Aspartate aminotransferase OS=Thermus aquaticus GN=aspC PE=3 SV=1 112 445 5.0E-07
sp|Q9ZHE5|HIS8_BUCAP Histidinol-phosphate aminotransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=hisC PE=3 SV=1 140 282 8.0E-07
sp|A1ACN3|HIS8_ECOK1 Histidinol-phosphate aminotransferase OS=Escherichia coli O1:K1 / APEC GN=hisC PE=3 SV=1 141 261 9.0E-07
sp|Q11VM5|HIS8_CYTH3 Histidinol-phosphate aminotransferase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=hisC PE=3 SV=1 139 285 1.0E-06
sp|B1IZ53|HIS8_ECOLC Histidinol-phosphate aminotransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=hisC PE=3 SV=1 141 261 1.0E-06
sp|B6I848|HIS8_ECOSE Histidinol-phosphate aminotransferase OS=Escherichia coli (strain SE11) GN=hisC PE=3 SV=1 141 261 1.0E-06
sp|P06986|HIS8_ECOLI Histidinol-phosphate aminotransferase OS=Escherichia coli (strain K12) GN=hisC PE=1 SV=2 141 261 1.0E-06
sp|B1X6V8|HIS8_ECODH Histidinol-phosphate aminotransferase OS=Escherichia coli (strain K12 / DH10B) GN=hisC PE=3 SV=1 141 261 1.0E-06
sp|C4ZSB0|HIS8_ECOBW Histidinol-phosphate aminotransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=hisC PE=3 SV=1 141 261 1.0E-06
sp|B7M400|HIS8_ECO8A Histidinol-phosphate aminotransferase OS=Escherichia coli O8 (strain IAI1) GN=hisC PE=3 SV=1 141 261 1.0E-06
sp|A7ZNJ3|HIS8_ECO24 Histidinol-phosphate aminotransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=hisC PE=3 SV=1 141 261 1.0E-06
sp|A8A1P5|HIS8_ECOHS Histidinol-phosphate aminotransferase OS=Escherichia coli O9:H4 (strain HS) GN=hisC PE=3 SV=1 141 261 1.0E-06
sp|B7UT58|HIS8_ECO27 Histidinol-phosphate aminotransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=hisC PE=3 SV=1 141 261 2.0E-06
sp|B2TYF9|HIS8_SHIB3 Histidinol-phosphate aminotransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=hisC PE=3 SV=1 141 261 2.0E-06
sp|Q1RA52|HIS8_ECOUT Histidinol-phosphate aminotransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=hisC PE=3 SV=1 141 261 2.0E-06
sp|Q8FG51|HIS8_ECOL6 Histidinol-phosphate aminotransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hisC PE=3 SV=1 141 261 2.0E-06
sp|Q0TG66|HIS8_ECOL5 Histidinol-phosphate aminotransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=hisC PE=3 SV=1 141 261 2.0E-06
sp|B7NQG9|HIS8_ECO7I Histidinol-phosphate aminotransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=hisC PE=3 SV=1 141 261 2.0E-06
sp|A1JTV9|HIS8_YERE8 Histidinol-phosphate aminotransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=hisC PE=3 SV=1 129 261 2.0E-06
sp|B7MDH5|HIS8_ECO45 Histidinol-phosphate aminotransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=hisC PE=3 SV=1 141 282 2.0E-06
sp|Q6D410|HIS8_PECAS Histidinol-phosphate aminotransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=hisC PE=3 SV=1 141 282 2.0E-06
sp|B5XPE6|HIS8_KLEP3 Histidinol-phosphate aminotransferase OS=Klebsiella pneumoniae (strain 342) GN=hisC PE=3 SV=1 120 261 3.0E-06
sp|B7NC61|HIS8_ECOLU Histidinol-phosphate aminotransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=hisC PE=3 SV=1 141 261 3.0E-06
sp|O52815|HPGT_AMYOR (S)-3,5-dihydroxyphenylglycine transaminase OS=Amycolatopsis orientalis GN=hpgT PE=1 SV=1 112 261 3.0E-06
sp|Q3Z0G4|HIS8_SHISS Histidinol-phosphate aminotransferase OS=Shigella sonnei (strain Ss046) GN=hisC PE=3 SV=1 141 261 4.0E-06
sp|B7L9P8|HIS8_ECO55 Histidinol-phosphate aminotransferase OS=Escherichia coli (strain 55989 / EAEC) GN=hisC PE=3 SV=1 141 261 4.0E-06
sp|B5YU77|HIS8_ECO5E Histidinol-phosphate aminotransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=hisC PE=3 SV=1 141 261 4.0E-06
sp|Q9S5G6|HIS8_ECO57 Histidinol-phosphate aminotransferase OS=Escherichia coli O157:H7 GN=hisC PE=3 SV=1 141 261 4.0E-06
sp|Q83KJ6|HIS8_SHIFL Histidinol-phosphate aminotransferase OS=Shigella flexneri GN=hisC PE=3 SV=1 141 261 4.0E-06
sp|Q0T3A6|HIS8_SHIF8 Histidinol-phosphate aminotransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=hisC PE=3 SV=1 141 261 4.0E-06
sp|B7MWU0|HIS8_ECO81 Histidinol-phosphate aminotransferase OS=Escherichia coli O81 (strain ED1a) GN=hisC PE=3 SV=1 141 261 4.0E-06
sp|B7LUF2|HIS8_ESCF3 Histidinol-phosphate aminotransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=hisC PE=3 SV=1 141 261 5.0E-06
sp|B3QP11|HIS8_CHLP8 Histidinol-phosphate aminotransferase OS=Chlorobaculum parvum (strain NCIB 8327) GN=hisC PE=3 SV=1 134 282 5.0E-06
sp|Q5QWQ9|HIS82_IDILO Histidinol-phosphate aminotransferase 2 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=hisC2 PE=3 SV=1 138 314 6.0E-06
sp|C4Z4Y1|DAPAT_EUBE2 LL-diaminopimelate aminotransferase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=dapL PE=3 SV=1 94 305 7.0E-06
sp|B8I5V1|HIS8_CLOCE Histidinol-phosphate aminotransferase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=hisC PE=3 SV=1 135 285 8.0E-06
sp|B1XKF6|DAPAT_SYNP2 LL-diaminopimelate aminotransferase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=dapL PE=3 SV=1 112 305 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0030170 pyridoxal phosphate binding Yes
GO:0070279 vitamin B6 binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0008152 metabolic process No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:1901363 heterocyclic compound binding No
GO:0019842 vitamin binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7083
MRLSKDNINQRVRRAEYAVRGELAVKSEEFRARLARGHGSGLPFKHVISANIGNPQQLDQKPLTFFRQVASLLEN
PDLLQHPHVLVNSLGYPPDVLERAKWLLSKVGSVGAYSASSGVPAIKESIAKFLERRDGFPADASHIYLSAGASS
GVNTLLNVICADKKSGIMIPIPQYPLYSASLALLDATPVPYNLDESKAWGTDLDTICHAYQKAKADGVDVRCIVI
INPGNPTGASLSEADIRAVIDFASRENLVVMADEVYQTNVFVGKFHSFKSVLRTMQKETGGKYDALELASLHSIS
KGMVGECGHRGGYFELVGFDPQVEANIYKFVSIMLCAPVIGQCLVQVMVNPPEPGDPSYELYNREYTAVYEGLRE
RATAIHDAFSHMEGVECNQPQGSMYLFPTIRLPQRAIDAAAAEGRSPDEFYCMRLLEQTGVCVVPGSGFGQAQGT
LHFRTTFLAPGTEWVGSIVKFHKEFMDKYR*
Coding >OphauB2|7083
ATGAGGCTCTCCAAGGACAACATCAACCAGAGGGTGCGTCGTGCCGAGTATGCGGTGCGAGGCGAGCTCGCTGTC
AAGTCGGAAGAGTTCCGAGCTCGTCTGGCCAGGGGCCATGGCTCAGGCCTGCCCTTCAAGCATGTTATTTCAGCA
AACATCGGCAATCCCCAGCAGCTGGACCAGAAGCCATTGACCTTTTTCCGCCAGGTGGCCAGCTTGCTGGAGAAC
CCAGACTTGCTCCAGCACCCGCATGTCTTGGTCAACAGCCTGGGCTACCCGCCCGACGTGCTGGAGCGTGCAAAG
TGGCTGCTCTCCAAGGTTGGCTCCGTTGGTGCCTACAGTGCCAGCAGTGGCGTGCCAGCAATCAAGGAGAGCATT
GCCAAGTTTCTTGAGCGACGTGATGGCTTTCCCGCCGACGCCTCCCACATCTACCTGTCGGCCGGCGCCTCGTCG
GGCGTCAATACTCTGCTCAACGTCATCTGCGCCGACAAGAAGTCGGGCATCATGATTCCTATTCCGCAGTATCCG
CTCTACAGCGCTAGTCTTGCCCTCCTCGACGCCACCCCCGTGCCCTACAACCTCGACGAGTCCAAGGCATGGGGC
ACCGACCTCGACACCATTTGCCACGCGTATCAAAAGGCCAAGGCGGACGGCGTCGACGTCAGATGCATCGTCATT
ATCAACCCAGGCAACCCCACGGGCGCCTCACTGTCCGAGGCCGACATTCGCGCCGTCATCGACTTTGCCAGCCGC
GAAAACCTTGTCGTCATGGCCGATGAGGTCTACCAAACAAATGTCTTTGTCGGCAAGTTCCACAGCTTCAAGTCT
GTCTTGCGCACCATGCAGAAGGAGACTGGCGGCAAATACGACGCACTCGAGCTCGCCTCGCTGCATTCCATCTCC
AAGGGCATGGTGGGCGAGTGCGGCCATCGTGGCGGCTACTTTGAACTCGTCGGCTTCGACCCCCAAGTCGAAGCA
AACATTTACAAATTTGTCTCCATTATGCTGTGTGCACCCGTCATTGGCCAATGCCTCGTCCAAGTCATGGTCAAC
CCCCCCGAGCCCGGTGACCCTTCTTATGAATTATACAATCGCGAGTACACAGCCGTATATGAGGGTCTTCGCGAG
CGCGCAACCGCCATACACGATGCTTTTTCTCACATGGAGGGCGTCGAGTGCAACCAGCCCCAGGGTTCAATGTAT
CTTTTCCCTACCATTCGCCTGCCCCAGCGCGCCATTGATGCCGCAGCTGCAGAGGGCCGCTCGCCAGACGAGTTT
TACTGCATGCGTCTCCTTGAGCAGACTGGCGTCTGTGTCGTGCCTGGCTCCGGCTTTGGCCAGGCTCAAGGTACG
CTGCACTTTCGCACCACCTTTTTGGCTCCTGGTACCGAGTGGGTTGGCAGCATTGTCAAGTTTCACAAGGAATTC
ATGGACAAGTATCGGTAG
Transcript >OphauB2|7083
ATGAGGCTCTCCAAGGACAACATCAACCAGAGGGTGCGTCGTGCCGAGTATGCGGTGCGAGGCGAGCTCGCTGTC
AAGTCGGAAGAGTTCCGAGCTCGTCTGGCCAGGGGCCATGGCTCAGGCCTGCCCTTCAAGCATGTTATTTCAGCA
AACATCGGCAATCCCCAGCAGCTGGACCAGAAGCCATTGACCTTTTTCCGCCAGGTGGCCAGCTTGCTGGAGAAC
CCAGACTTGCTCCAGCACCCGCATGTCTTGGTCAACAGCCTGGGCTACCCGCCCGACGTGCTGGAGCGTGCAAAG
TGGCTGCTCTCCAAGGTTGGCTCCGTTGGTGCCTACAGTGCCAGCAGTGGCGTGCCAGCAATCAAGGAGAGCATT
GCCAAGTTTCTTGAGCGACGTGATGGCTTTCCCGCCGACGCCTCCCACATCTACCTGTCGGCCGGCGCCTCGTCG
GGCGTCAATACTCTGCTCAACGTCATCTGCGCCGACAAGAAGTCGGGCATCATGATTCCTATTCCGCAGTATCCG
CTCTACAGCGCTAGTCTTGCCCTCCTCGACGCCACCCCCGTGCCCTACAACCTCGACGAGTCCAAGGCATGGGGC
ACCGACCTCGACACCATTTGCCACGCGTATCAAAAGGCCAAGGCGGACGGCGTCGACGTCAGATGCATCGTCATT
ATCAACCCAGGCAACCCCACGGGCGCCTCACTGTCCGAGGCCGACATTCGCGCCGTCATCGACTTTGCCAGCCGC
GAAAACCTTGTCGTCATGGCCGATGAGGTCTACCAAACAAATGTCTTTGTCGGCAAGTTCCACAGCTTCAAGTCT
GTCTTGCGCACCATGCAGAAGGAGACTGGCGGCAAATACGACGCACTCGAGCTCGCCTCGCTGCATTCCATCTCC
AAGGGCATGGTGGGCGAGTGCGGCCATCGTGGCGGCTACTTTGAACTCGTCGGCTTCGACCCCCAAGTCGAAGCA
AACATTTACAAATTTGTCTCCATTATGCTGTGTGCACCCGTCATTGGCCAATGCCTCGTCCAAGTCATGGTCAAC
CCCCCCGAGCCCGGTGACCCTTCTTATGAATTATACAATCGCGAGTACACAGCCGTATATGAGGGTCTTCGCGAG
CGCGCAACCGCCATACACGATGCTTTTTCTCACATGGAGGGCGTCGAGTGCAACCAGCCCCAGGGTTCAATGTAT
CTTTTCCCTACCATTCGCCTGCCCCAGCGCGCCATTGATGCCGCAGCTGCAGAGGGCCGCTCGCCAGACGAGTTT
TACTGCATGCGTCTCCTTGAGCAGACTGGCGTCTGTGTCGTGCCTGGCTCCGGCTTTGGCCAGGCTCAAGGTACG
CTGCACTTTCGCACCACCTTTTTGGCTCCTGGTACCGAGTGGGTTGGCAGCATTGTCAAGTTTCACAAGGAATTC
ATGGACAAGTATCGGTAG
Gene >OphauB2|7083
ATGAGGCTCTCCAAGGACAACATCAACCAGAGGGTGCGTCGTGCCGAGTATGCGGTGCGAGGCGAGCTCGCTGTC
AAGTCGGAAGAGTTCCGAGCTCGTCTGGCCAGGGGCCATGGCTCAGGCCTGCCCTTCAAGCATGTTATTTCAGCA
AACATCGGCAATCCCCAGCAGCTGGACCAGAAGCCATTGACCTTTTTCCGCCAGGTGGCCAGCTTGCTGGAGAAC
CCAGACTTGCTCCAGCACCCGCATGTCTTGGTCAACAGCCTGGGCTACCCGCCCGACGTGCTGGAGCGTGCAAAG
TGGCTGCTCTCCAAGGTTGGCTCCGTTGGTGCCTACAGTGCCAGCAGTGGCGTGCCAGCAATCAAGGAGAGCATT
GCCAAGTTTCTTGAGCGTGAGTTGATGCAATTTGCCCGCTGCTCTGGCCACCATCTGACCATTGAGCCTCTTGTC
ACAGGACGTGATGGCTTTCCCGCCGACGCCTCCCACATCTACCTGTCGGCCGGCGCCTCGTCGGGCGTCAATACT
CTGCTCAACGTCATCTGCGCCGACAAGAAGTCGGGCATCATGATTCCTATTCCGCAGTATCCGCTCTACAGCGCT
AGTCTTGCCCTCCTCGACGCCACCCCCGTGCCCTACAACCTCGACGAGTCCAAGGCATGGGGCACCGACCTCGAC
ACCATTTGCCACGCGTATCAAAAGGCCAAGGCGGACGGCGTCGACGTCAGATGCATCGTCATTATCAACCCAGGC
AACCCCACGGGCGCCTCACTGTCCGAGGCCGACATTCGCGCCGTCATCGACTTTGCCAGCCGCGAAAACCTTGTC
GTCATGGCCGATGAGGTCTACCAAACAAATGTCTTTGTCGGCAAGTTCCACAGCTTCAAGTCTGTCTTGCGCACC
ATGCAGAAGGAGACTGGCGGCAAATACGACGCACTCGAGCTCGCCTCGCTGCATTCCATCTCCAAGGGCATGGTG
GGCGAGTGCGGCCATCGTGGCGGCTACTTTGAACTCGTCGGCTTCGACCCCCAAGTCGAAGCAAACATTTACAAA
TTTGTCTCCATTATGCTGTGTGCACCCGTCATTGGCCAATGCCTCGTCCAAGTCATGGTCAACCCCCCCGAGCCC
GGTGACCCTTCTTATGAATTATACAATCGCGAGTACACAGCCGTATATGAGGGTCTTCGCGAGCGCGCAACCGCC
ATACACGATGCTTTTTCTCACATGGAGGGCGTCGAGTGCAACCAGCCCCAGGGTTCAATGTATCTTTTCCCTACC
ATTCGCCTGCCCCAGCGCGCCATTGATGCCGCAGCTGCAGAGGGCCGCTCGCCAGACGAGTTTTACTGCATGCGT
CTCCTTGAGCAGACTGGCGTCTGTGTCGTGCCTGGCTCCGGCTTTGGCCAGGCTCAAGGTACGCTGCACTTTCGC
ACCACCTTTTTGGCTCCTGGTACCGAGTGGGTTGGCAGCATTGTCAAGTTTCACAAGGAATTCATGGACAAGTAT
CGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail