Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7082
Gene name
LocationContig_70:56911..58539
Strand+
Gene length (bp)1628
Transcript length (bp)1494
Coding sequence length (bp)1494
Protein length (aa) 498

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10602 RPN7 26S proteasome subunit RPN7 2.5E-55 105 278
PF01399 PCI PCI domain 4.1E-14 358 453

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10335|RPN7_SCHPO Probable 26S proteasome regulatory subunit rpn7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn7 PE=2 SV=1 13 494 3.0E-91
sp|Q06103|RPN7_YEAST 26S proteasome regulatory subunit RPN7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN7 PE=1 SV=3 4 496 4.0E-86
sp|Q93Y35|PSMD6_ARATH 26S proteasome non-ATPase regulatory subunit 6 homolog OS=Arabidopsis thaliana GN=RPN7 PE=1 SV=1 102 491 7.0E-79
sp|Q99JI4|PSMD6_MOUSE 26S proteasome non-ATPase regulatory subunit 6 OS=Mus musculus GN=Psmd6 PE=1 SV=1 87 491 5.0E-78
sp|Q15008|PSMD6_HUMAN 26S proteasome non-ATPase regulatory subunit 6 OS=Homo sapiens GN=PSMD6 PE=1 SV=1 101 491 1.0E-77
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10335|RPN7_SCHPO Probable 26S proteasome regulatory subunit rpn7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn7 PE=2 SV=1 13 494 3.0E-91
sp|Q06103|RPN7_YEAST 26S proteasome regulatory subunit RPN7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN7 PE=1 SV=3 4 496 4.0E-86
sp|Q93Y35|PSMD6_ARATH 26S proteasome non-ATPase regulatory subunit 6 homolog OS=Arabidopsis thaliana GN=RPN7 PE=1 SV=1 102 491 7.0E-79
sp|Q99JI4|PSMD6_MOUSE 26S proteasome non-ATPase regulatory subunit 6 OS=Mus musculus GN=Psmd6 PE=1 SV=1 87 491 5.0E-78
sp|Q15008|PSMD6_HUMAN 26S proteasome non-ATPase regulatory subunit 6 OS=Homo sapiens GN=PSMD6 PE=1 SV=1 101 491 1.0E-77
sp|Q3T0B2|PSMD6_BOVIN 26S proteasome non-ATPase regulatory subunit 6 OS=Bos taurus GN=PSMD6 PE=2 SV=1 101 491 1.0E-76
sp|Q20585|PSMD6_CAEEL 26S proteasome non-ATPase regulatory subunit 6 OS=Caenorhabditis elegans GN=rpn-7 PE=3 SV=1 8 489 1.0E-72
sp|Q8W425|PSMD6_ORYSJ 26S proteasome non-ATPase regulatory subunit 6 OS=Oryza sativa subsp. japonica GN=RPN7 PE=2 SV=1 55 491 6.0E-69
sp|Q55C75|PSMD6_DICDI 26S proteasome non-ATPase regulatory subunit 6 OS=Dictyostelium discoideum GN=psmD6 PE=1 SV=1 102 291 2.0E-44
sp|Q9V3G7|PSMD6_DROME 26S proteasome non-ATPase regulatory subunit 6 OS=Drosophila melanogaster GN=Rpn7 PE=2 SV=1 9 289 5.0E-42
sp|Q55C75|PSMD6_DICDI 26S proteasome non-ATPase regulatory subunit 6 OS=Dictyostelium discoideum GN=psmD6 PE=1 SV=1 342 491 5.0E-36
sp|Q9V3G7|PSMD6_DROME 26S proteasome non-ATPase regulatory subunit 6 OS=Drosophila melanogaster GN=Rpn7 PE=2 SV=1 358 491 2.0E-35
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7082
MGSDPLYAKWPLLPLSQHVFTLTNAYASRTAQQAAVKTLQDAITSDKMAPFYRYLAHPVDGILNVAGEASSSATC
SSTAASAKPLSRKSSLVVGRSASGISLPWDEELYVRLKKDNDSQLAGFQKEEEEAVEQAGDTEIMAAKGKRAEFW
ARVGDKDKAIASYEDVFEKTGILGTKIDLVLAIIRMALFYGDRALVKKHVERAKTLVDSGGDWDRRNRLKAYEGL
HLLTVRSYNLAAPLLLDSLSTFTSYELCSYSNLVVYAVLAGSVSLRRVDFKSKVVDAPEIKAIMGDGEDKLLALS
GALSAGPGVDDEPSSSSQVSSQTPAAAVKPAVNLTIIGSSTEQPEAEMSIDFSPLALLVSSLYNGNYQAFFKALA
DVEEQFLNQDRCLHEHKSWFIREMRLAAYQQLLQSYRVVGLESMANDFGVTVDFLDRDLARFIAAGRIPCTIDRV
SGKGVIETNRPDDKNKQYQDVVRQGDQLITKLQKYGQAVRLRGSERA*
Coding >OphauB2|7082
ATGGGGTCTGATCCGCTCTACGCCAAATGGCCTCTGCTGCCTCTCTCGCAGCACGTCTTCACCCTGACAAACGCC
TACGCCTCGCGCACCGCCCAGCAGGCCGCCGTCAAGACGCTGCAGGATGCCATCACCTCAGACAAGATGGCTCCC
TTTTATCGCTACCTGGCCCACCCTGTAGATGGCATTCTCAATGTTGCCGGTGAAGCTTCGTCGTCGGCCACTTGC
TCCTCCACTGCCGCCTCTGCAAAGCCGCTGAGTAGAAAGTCGAGCCTGGTTGTGGGCCGGTCCGCCTCGGGAATC
AGCCTGCCTTGGGACGAGGAACTCTATGTCCGCCTCAAAAAGGACAACGATAGCCAGCTGGCTGGCTTTCAAAAG
GAGGAGGAGGAGGCGGTCGAACAGGCGGGCGATACTGAAATCATGGCGGCAAAGGGCAAGCGCGCAGAATTCTGG
GCCCGCGTCGGAGACAAGGACAAGGCCATCGCTTCCTACGAGGACGTGTTTGAAAAGACAGGCATCCTGGGCACC
AAAATCGACCTCGTCTTGGCCATAATACGCATGGCGCTCTTCTATGGCGACCGCGCCCTCGTCAAGAAGCATGTG
GAGCGCGCCAAGACGCTCGTTGACTCTGGCGGTGACTGGGACCGCCGCAACCGTCTCAAGGCCTATGAAGGCTTG
CACCTCCTCACAGTCCGCTCCTACAACCTTGCCGCGCCGCTTCTGCTCGACTCTCTCTCCACCTTTACCAGCTAC
GAGCTCTGCTCATACTCCAACCTGGTAGTCTATGCTGTCCTTGCCGGCTCTGTCTCTCTCCGCCGCGTCGACTTC
AAATCAAAAGTGGTTGACGCCCCCGAGATCAAGGCCATTATGGGCGATGGAGAGGACAAGCTGCTGGCCCTGAGC
GGCGCCCTCAGCGCTGGGCCTGGGGTTGATGACGAGCCAAGTTCGAGCTCCCAAGTGTCGTCGCAAACCCCCGCC
GCCGCCGTTAAGCCTGCCGTCAACCTGACCATCATTGGCTCCAGCACGGAGCAGCCAGAGGCTGAAATGTCCATT
GACTTTAGCCCTTTGGCCCTGCTGGTCAGTAGTCTGTACAATGGAAACTACCAGGCCTTCTTCAAGGCCTTGGCC
GATGTGGAGGAGCAGTTCCTCAACCAGGACCGCTGCCTACACGAGCACAAGAGCTGGTTCATTCGCGAGATGCGT
CTTGCCGCCTATCAGCAACTGTTGCAGAGCTATCGTGTTGTTGGCCTGGAGAGCATGGCCAACGATTTCGGCGTC
ACTGTTGACTTTCTCGATCGCGACCTCGCGCGCTTTATTGCTGCCGGTCGCATTCCCTGCACCATTGACCGTGTC
TCTGGCAAAGGTGTCATTGAGACAAACCGGCCCGACGACAAAAACAAGCAGTACCAGGACGTGGTTCGCCAGGGC
GACCAGCTCATCACCAAGCTGCAGAAATACGGCCAGGCCGTCAGACTTAGAGGCAGTGAGCGGGCATAG
Transcript >OphauB2|7082
ATGGGGTCTGATCCGCTCTACGCCAAATGGCCTCTGCTGCCTCTCTCGCAGCACGTCTTCACCCTGACAAACGCC
TACGCCTCGCGCACCGCCCAGCAGGCCGCCGTCAAGACGCTGCAGGATGCCATCACCTCAGACAAGATGGCTCCC
TTTTATCGCTACCTGGCCCACCCTGTAGATGGCATTCTCAATGTTGCCGGTGAAGCTTCGTCGTCGGCCACTTGC
TCCTCCACTGCCGCCTCTGCAAAGCCGCTGAGTAGAAAGTCGAGCCTGGTTGTGGGCCGGTCCGCCTCGGGAATC
AGCCTGCCTTGGGACGAGGAACTCTATGTCCGCCTCAAAAAGGACAACGATAGCCAGCTGGCTGGCTTTCAAAAG
GAGGAGGAGGAGGCGGTCGAACAGGCGGGCGATACTGAAATCATGGCGGCAAAGGGCAAGCGCGCAGAATTCTGG
GCCCGCGTCGGAGACAAGGACAAGGCCATCGCTTCCTACGAGGACGTGTTTGAAAAGACAGGCATCCTGGGCACC
AAAATCGACCTCGTCTTGGCCATAATACGCATGGCGCTCTTCTATGGCGACCGCGCCCTCGTCAAGAAGCATGTG
GAGCGCGCCAAGACGCTCGTTGACTCTGGCGGTGACTGGGACCGCCGCAACCGTCTCAAGGCCTATGAAGGCTTG
CACCTCCTCACAGTCCGCTCCTACAACCTTGCCGCGCCGCTTCTGCTCGACTCTCTCTCCACCTTTACCAGCTAC
GAGCTCTGCTCATACTCCAACCTGGTAGTCTATGCTGTCCTTGCCGGCTCTGTCTCTCTCCGCCGCGTCGACTTC
AAATCAAAAGTGGTTGACGCCCCCGAGATCAAGGCCATTATGGGCGATGGAGAGGACAAGCTGCTGGCCCTGAGC
GGCGCCCTCAGCGCTGGGCCTGGGGTTGATGACGAGCCAAGTTCGAGCTCCCAAGTGTCGTCGCAAACCCCCGCC
GCCGCCGTTAAGCCTGCCGTCAACCTGACCATCATTGGCTCCAGCACGGAGCAGCCAGAGGCTGAAATGTCCATT
GACTTTAGCCCTTTGGCCCTGCTGGTCAGTAGTCTGTACAATGGAAACTACCAGGCCTTCTTCAAGGCCTTGGCC
GATGTGGAGGAGCAGTTCCTCAACCAGGACCGCTGCCTACACGAGCACAAGAGCTGGTTCATTCGCGAGATGCGT
CTTGCCGCCTATCAGCAACTGTTGCAGAGCTATCGTGTTGTTGGCCTGGAGAGCATGGCCAACGATTTCGGCGTC
ACTGTTGACTTTCTCGATCGCGACCTCGCGCGCTTTATTGCTGCCGGTCGCATTCCCTGCACCATTGACCGTGTC
TCTGGCAAAGGTGTCATTGAGACAAACCGGCCCGACGACAAAAACAAGCAGTACCAGGACGTGGTTCGCCAGGGC
GACCAGCTCATCACCAAGCTGCAGAAATACGGCCAGGCCGTCAGACTTAGAGGCAGTGAGCGGGCATAG
Gene >OphauB2|7082
ATGGGGTCTGATCCGCTCTACGCCAAATGGCCTCTGCTGCCTCTCTCGCAGCACGTCTTCACCCTGACAAACGCC
TACGCCTCGCGCACCGCCCAGCAGGCCGCCGTCAAGACGCTGCAGGATGCCATCACCTCAGACAAGATGGCTCCC
TTTTATCGCTACCTGGCCCACCCTGTAGATGGCATTCTCAATGTTGCCGGTGAAGCTTCGTCGTCGGCCACTTGC
TCCTCCACTGCCGCCTCTGCAAAGCCGCTGAGTAGAAAGTCGAGCCTGGTTGTGGGCCGGTCCGCCTCGGGAATC
AGCCTGCCTTGGGACGAGGAACTCTATGTCCGCCTCAAAAAGGACAACGATAGCCAGCTGGCTGGCTTTCAAAAG
GAGGAGGAGGAGGCGGTCGAACAGGCGGGCGATACTGAAATCATGGCGGCAAAGGGCAAGCGCGCAGAATTCTGG
GCCCGCGTCGGAGACAAGGTTGGCCGGCTGCCTCGCCCTTTCCCTTCACTCGTGCATCTTGCTGACTCGAGTCGT
GGCGCAGGACAAGGCCATCGCTTCCTACGAGGACGTGTTTGAAAAGACAGGCATCCTGGGCACCAAAATCGACCT
CGTCTTGGCCATAATACGCATGGCGCTCTTCTATGGCGACCGCGCCCTCGTCAAGAAGCATGTGGAGCGCGCCAA
GACGCTCGTTGACTCTGGCGGTGACTGGGACCGCCGCAACCGTCTCAAGGCCTATGAAGGCTTGCACCTCCTCAC
AGTCCGCTCCTACAACCTTGCCGCGCCGCTTCTGCTCGACTCTCTCTCCACCTTTACCAGCTACGAGCTCTGCTC
ATACTCCAACCTGGTAGTCTATGCTGTCCTTGCCGGCTCTGTCTCTCTCCGCCGCGTCGACTTCAAATCAAAAGT
GGTTGACGCCCCCGAGATCAAGGCCATTATGGGCGATGGAGAGGACAAGCTGCTGGCCCTGAGCGGCGCCCTCAG
CGCTGGGCCTGGGGTTGATGACGAGCCAAGTTCGAGCTCCCAAGTGTCGTCGCAAACCCCCGCCGCCGCCGTTAA
GCCTGCCGTCAACCTGACCATCATTGGCTCCAGCACGGAGCAGCCAGAGGCTGAAATGTCCATTGACTTTAGCCC
TTTGGCCCTGCTGGTCAGTAGTCTGTACAATGGAAACTACCAGGCCTTCTTCAAGGCCTTGGCCGATGTGGAGGA
GCAGTTCCTCAACCAGGACCGCTGCCTACACGAGCACAAGAGCTGGTTCATTCGCGAGATGCGTCTTGCCGCCTA
TCAGCAACTGTTGCAGAGCTATCGTGTTGTTGGCCTGGAGAGCATGGCCAACGATTTCGGCGTCACTGTTGACTT
TCTCGATCGGTAAGCACCTCCAGGCCATTGCGTGGCCTCAACTCTTGTTTGCCCGATTTCTGACCTGTAATATTT
GCAGCGACCTCGCGCGCTTTATTGCTGCCGGTCGCATTCCCTGCACCATTGACCGTGTCTCTGGCAAAGGTGTCA
TTGAGACAAACCGGCCCGACGACAAAAACAAGCAGTACCAGGACGTGGTTCGCCAGGGCGACCAGCTCATCACCA
AGCTGCAGAAATACGGCCAGGCCGTCAGACTTAGAGGCAGTGAGCGGGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail