Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7080
Gene name
LocationContig_70:52004..53950
Strand+
Gene length (bp)1946
Transcript length (bp)1887
Coding sequence length (bp)1887
Protein length (aa) 629

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08356 EF_assoc_2 EF hand associated 3.6E-34 220 306
PF08355 EF_assoc_1 EF hand associated 2.3E-30 344 416
PF00071 Ras Ras family 9.0E-16 6 167
PF00071 Ras Ras family 1.9E-05 427 544
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 1.9E-08 5 117

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59781|GEM1_SCHPO Mitochondrial Rho GTPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gem1 PE=3 SV=1 1 621 0.0E+00
sp|Q4I2W2|GEM1_GIBZE Mitochondrial Rho GTPase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GEM1 PE=3 SV=1 1 626 0.0E+00
sp|Q6FIR8|GEM1_CANGA Mitochondrial Rho GTPase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GEM1 PE=3 SV=1 3 590 0.0E+00
sp|Q758X6|GEM1_ASHGO Mitochondrial Rho GTPase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GEM1 PE=3 SV=1 4 620 0.0E+00
sp|Q5ABR2|GEM1_CANAL Mitochondrial Rho GTPase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GEM1 PE=3 SV=2 54 620 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59781|GEM1_SCHPO Mitochondrial Rho GTPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gem1 PE=3 SV=1 1 621 0.0E+00
sp|Q4I2W2|GEM1_GIBZE Mitochondrial Rho GTPase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GEM1 PE=3 SV=1 1 626 0.0E+00
sp|Q6FIR8|GEM1_CANGA Mitochondrial Rho GTPase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GEM1 PE=3 SV=1 3 590 0.0E+00
sp|Q758X6|GEM1_ASHGO Mitochondrial Rho GTPase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GEM1 PE=3 SV=1 4 620 0.0E+00
sp|Q5ABR2|GEM1_CANAL Mitochondrial Rho GTPase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GEM1 PE=3 SV=2 54 620 0.0E+00
sp|P39722|GEM1_YEAST Mitochondrial Rho GTPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEM1 PE=1 SV=1 3 610 0.0E+00
sp|Q6CY37|GEM1_KLULA Mitochondrial Rho GTPase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GEM1 PE=3 SV=1 4 585 0.0E+00
sp|Q6C2J1|GEM1_YARLI Mitochondrial Rho GTPase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GEM1 PE=3 SV=1 3 620 0.0E+00
sp|Q5B5L3|GEM1_EMENI Mitochondrial Rho GTPase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=gem1 PE=3 SV=1 1 627 0.0E+00
sp|Q2UM43|GEM1_ASPOR Mitochondrial Rho GTPase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gem1 PE=3 SV=1 1 628 0.0E+00
sp|Q4WN24|GEM1_ASPFU Mitochondrial Rho GTPase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gem1 PE=3 SV=1 1 627 0.0E+00
sp|Q7RZA2|GEM1_NEUCR Mitochondrial Rho GTPase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gem-1 PE=3 SV=1 4 628 0.0E+00
sp|P0CO78|GEM1_CRYNJ Mitochondrial Rho GTPase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GEM1 PE=3 SV=1 4 622 4.0E-175
sp|P0CO79|GEM1_CRYNB Mitochondrial Rho GTPase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GEM1 PE=3 SV=1 4 622 4.0E-175
sp|Q4PB75|GEM1_USTMA Mitochondrial Rho GTPase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=GEM1 PE=3 SV=1 4 585 3.0E-164
sp|Q5ZM83|MIRO2_CHICK Mitochondrial Rho GTPase 2 OS=Gallus gallus GN=RHOT2 PE=2 SV=1 4 618 4.0E-117
sp|Q5E9M9|MIRO2_BOVIN Mitochondrial Rho GTPase 2 OS=Bos taurus GN=RHOT2 PE=2 SV=1 4 618 4.0E-112
sp|Q8IXI1|MIRO2_HUMAN Mitochondrial Rho GTPase 2 OS=Homo sapiens GN=RHOT2 PE=1 SV=2 4 587 8.0E-112
sp|Q6DIS1|MIRO2_XENTR Mitochondrial Rho GTPase 2 OS=Xenopus tropicalis GN=rhot2 PE=2 SV=1 4 618 1.0E-111
sp|F4J0W4|MIRO2_ARATH Mitochondrial Rho GTPase 2 OS=Arabidopsis thaliana GN=MIRO2 PE=2 SV=1 3 626 7.0E-111
sp|Q298L5|MIRO_DROPS Mitochondrial Rho GTPase OS=Drosophila pseudoobscura pseudoobscura GN=Miro PE=3 SV=1 4 587 2.0E-109
sp|Q8RXF8|MIRO1_ARATH Mitochondrial Rho GTPase 1 OS=Arabidopsis thaliana GN=MIRO1 PE=1 SV=1 3 593 4.0E-109
sp|Q8IMX7|MIRO_DROME Mitochondrial Rho GTPase OS=Drosophila melanogaster GN=Miro PE=1 SV=1 3 628 1.0E-108
sp|Q8JZN7|MIRO2_MOUSE Mitochondrial Rho GTPase 2 OS=Mus musculus GN=Rhot2 PE=1 SV=1 4 587 2.0E-108
sp|Q6NVC5|MIRO1_DANRE Mitochondrial Rho GTPase 1-A OS=Danio rerio GN=rhot1a PE=2 SV=1 4 618 3.0E-106
sp|Q94263|MIRO1_CAEEL Mitochondrial Rho GTPase 1 OS=Caenorhabditis elegans GN=miro-1 PE=3 SV=1 1 587 5.0E-105
sp|Q8BG51|MIRO1_MOUSE Mitochondrial Rho GTPase 1 OS=Mus musculus GN=Rhot1 PE=1 SV=1 4 618 6.0E-105
sp|Q8IXI2|MIRO1_HUMAN Mitochondrial Rho GTPase 1 OS=Homo sapiens GN=RHOT1 PE=1 SV=2 4 618 1.0E-103
sp|Q623S8|MIRO1_CAEBR Mitochondrial Rho GTPase 1 OS=Caenorhabditis briggsae GN=miro-1 PE=3 SV=3 1 587 2.0E-103
sp|Q7TSA0|MIRO2_RAT Mitochondrial Rho GTPase 2 OS=Rattus norvegicus GN=Rhot2 PE=2 SV=1 4 588 2.0E-103
sp|Q5ZM73|MIRO1_CHICK Mitochondrial Rho GTPase 1 OS=Gallus gallus GN=RHOT1 PE=2 SV=1 4 618 2.0E-103
sp|Q2HJF8|MIRO1_BOVIN Mitochondrial Rho GTPase 1 OS=Bos taurus GN=RHOT1 PE=2 SV=1 4 618 5.0E-103
sp|Q32LU1|MIRO2_DANRE Mitochondrial Rho GTPase 2 OS=Danio rerio GN=rhot2 PE=2 SV=1 4 618 1.0E-101
sp|Q9MA88|MIRO3_ARATH Mitochondrial Rho GTPase 3 OS=Arabidopsis thaliana GN=MIRO3 PE=2 SV=1 4 620 2.0E-94
sp|Q864R5|MIRO2_PIG Mitochondrial Rho GTPase 2 OS=Sus scrofa GN=RHOT2 PE=2 SV=1 4 587 4.0E-94
sp|Q55G45|GEMA_DICDI Probable mitochondrial Rho GTPase gemA OS=Dictyostelium discoideum GN=gemA PE=3 SV=1 4 535 4.0E-76
sp|Q55CB7|RASY_DICDI Ras-like protein rasY OS=Dictyostelium discoideum GN=rasY PE=3 SV=1 4 160 1.0E-06
sp|Q55CB8|RASX_DICDI Ras-like protein rasX OS=Dictyostelium discoideum GN=rasX PE=3 SV=1 4 160 1.0E-06
sp|Q1ZXE7|RABZ_DICDI Ras-related protein RabZ OS=Dictyostelium discoideum GN=rabZ PE=3 SV=2 6 176 1.0E-06
sp|Q9HBH0|RHOF_HUMAN Rho-related GTP-binding protein RhoF OS=Homo sapiens GN=RHOF PE=1 SV=1 4 160 3.0E-06
sp|Q55CA9|RASZ_DICDI Ras-like protein rasZ OS=Dictyostelium discoideum GN=rasZ PE=3 SV=1 4 160 4.0E-06
sp|Q8BYP3|RHOF_MOUSE Rho-related GTP-binding protein RhoF OS=Mus musculus GN=Rhof PE=1 SV=1 4 160 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0017111 nucleoside-triphosphatase activity No
GO:0005488 binding No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0019001 guanyl nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0016462 pyrophosphatase activity No
GO:0032561 guanyl ribonucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7080
MATVRVCVCGDESTGKSSLIASLVKDQFMSHKIQPVLPQITIPPSIGTPENVTTTIVDTSARPQDRTTLRKEIRK
CNVILLVYADHYSYERVALFWMPYFRSLGVNVPVVLCANKSDLSGQSQTSQVVEEEMLPVMAEFREIDSCIRTSA
REHQNVNEVFFLCQKAVTHPIAPLFDYKEGHLKPACVAALKRVFFLCDKDQDGYLNDDEMRDFQARCFDKPLTSD
DLDNIKLSISKTLPNVNLNSGIDQHGFLQLNKIYAEKGRHETIWIILRKYHYTDSLSLEDKFLHPKLDVPEYSSA
ELSPAGYRFFVDLFLLFDKDNDGGLNDGELEALLLPTPGLPASWADSAFPSSTVRNEAGHITLQGWLAQWSMTTF
LEPKTTIEYLAYLGFEPQNPKDSITAAIKITKPRKRRRRPGRIERNVVLCYLVGGSGAGKSSLLDTFLNRPFEVL
YHPTIKPRRAVNSVELPGGKQVYLILEELGELEPAILENRAKLDSCDVICYAYDSSDPDSFSHIVETRARHPQLD
ELPSVYTALKADMDKTTQRSELQPDQYTSMLSVNTPLHVSVTWSGIGELFVALAETATNPSLGFPKTEEEAPDRT
SLYLALGATACAAVAAVMIWRRSTNAAS*
Coding >OphauB2|7080
ATGGCCACGGTGCGCGTCTGTGTCTGCGGCGACGAAAGCACCGGCAAGTCGAGCCTCATCGCCTCGCTGGTCAAA
GACCAGTTTATGAGCCACAAGATCCAGCCTGTCCTGCCCCAAATCACGATTCCTCCCAGCATCGGCACGCCAGAA
AATGTTACCACTACTATTGTTGACACGTCTGCCCGGCCGCAGGACCGCACGACGCTCCGCAAGGAGATCCGCAAA
TGCAATGTTATTCTACTCGTCTATGCCGATCATTACAGTTACGAGCGAGTAGCTCTGTTTTGGATGCCATATTTC
CGATCCCTGGGCGTCAATGTCCCCGTCGTCCTGTGCGCAAATAAGTCGGATTTGTCTGGCCAATCTCAGACTTCA
CAGGTCGTCGAAGAGGAGATGCTTCCTGTCATGGCTGAGTTCCGCGAAATCGACTCGTGCATACGCACCAGTGCC
CGCGAGCATCAAAATGTCAACGAAGTCTTCTTTCTGTGCCAGAAAGCCGTCACACATCCCATTGCGCCCTTGTTC
GACTACAAGGAGGGCCATCTCAAGCCCGCCTGCGTCGCCGCTCTCAAGCGCGTCTTTTTTCTGTGCGACAAGGAC
CAGGACGGCTACCTCAATGACGACGAGATGCGTGACTTTCAGGCCCGCTGCTTCGACAAGCCCTTGACAAGCGAC
GACCTCGATAACATCAAGTTGTCCATTTCCAAAACGTTGCCCAACGTCAATCTCAACAGCGGTATCGATCAGCAT
GGCTTTCTCCAGCTCAACAAGATATACGCCGAAAAGGGCAGACACGAGACTATCTGGATCATTCTGCGAAAATAC
CATTATACTGACAGCCTGAGCCTCGAGGACAAGTTCCTCCATCCCAAACTCGACGTGCCCGAGTACTCGTCGGCC
GAGCTGAGTCCTGCCGGATACCGCTTCTTTGTCGATCTCTTCCTCCTCTTCGACAAGGACAACGACGGCGGCCTC
AATGATGGAGAGCTCGAGGCTCTCTTGTTGCCCACTCCAGGTCTGCCCGCATCGTGGGCCGACTCGGCCTTTCCC
TCATCCACGGTGCGCAACGAGGCGGGCCACATCACCTTACAGGGCTGGCTTGCGCAGTGGAGCATGACGACTTTT
CTCGAGCCCAAGACAACGATAGAGTACCTTGCCTATCTCGGATTCGAGCCGCAAAACCCAAAGGACTCCATCACG
GCGGCCATCAAGATTACCAAACCTCGCAAACGCCGCCGACGTCCTGGTCGCATCGAGAGAAACGTTGTCCTCTGT
TACCTTGTAGGAGGCTCTGGAGCCGGCAAATCTTCGCTGCTCGATACCTTTTTGAACCGTCCTTTCGAGGTGCTC
TACCATCCCACCATTAAGCCGCGTCGCGCCGTCAACAGTGTGGAGCTGCCTGGTGGCAAGCAGGTCTATCTCATC
CTCGAGGAGCTCGGCGAGTTGGAGCCAGCCATTTTGGAGAACAGAGCCAAGCTAGACTCGTGCGACGTCATTTGC
TACGCATACGACTCGTCGGATCCAGACTCTTTTTCACACATCGTCGAGACGCGTGCACGGCATCCACAGCTCGAC
GAGCTGCCTTCGGTCTACACTGCTCTCAAGGCCGACATGGACAAGACGACACAGCGCAGCGAGTTGCAGCCCGAC
CAGTACACGTCAATGCTTAGCGTCAACACGCCCCTCCATGTCAGCGTCACTTGGAGTGGCATCGGCGAGCTCTTT
GTCGCTCTCGCAGAGACTGCCACCAACCCAAGCCTCGGCTTTCCCAAGACGGAGGAGGAAGCGCCAGACAGGACA
AGTTTGTATTTGGCCCTTGGAGCGACTGCTTGCGCTGCCGTGGCGGCTGTTATGATTTGGCGCCGGTCGACAAAT
GCTGCTTCTTGA
Transcript >OphauB2|7080
ATGGCCACGGTGCGCGTCTGTGTCTGCGGCGACGAAAGCACCGGCAAGTCGAGCCTCATCGCCTCGCTGGTCAAA
GACCAGTTTATGAGCCACAAGATCCAGCCTGTCCTGCCCCAAATCACGATTCCTCCCAGCATCGGCACGCCAGAA
AATGTTACCACTACTATTGTTGACACGTCTGCCCGGCCGCAGGACCGCACGACGCTCCGCAAGGAGATCCGCAAA
TGCAATGTTATTCTACTCGTCTATGCCGATCATTACAGTTACGAGCGAGTAGCTCTGTTTTGGATGCCATATTTC
CGATCCCTGGGCGTCAATGTCCCCGTCGTCCTGTGCGCAAATAAGTCGGATTTGTCTGGCCAATCTCAGACTTCA
CAGGTCGTCGAAGAGGAGATGCTTCCTGTCATGGCTGAGTTCCGCGAAATCGACTCGTGCATACGCACCAGTGCC
CGCGAGCATCAAAATGTCAACGAAGTCTTCTTTCTGTGCCAGAAAGCCGTCACACATCCCATTGCGCCCTTGTTC
GACTACAAGGAGGGCCATCTCAAGCCCGCCTGCGTCGCCGCTCTCAAGCGCGTCTTTTTTCTGTGCGACAAGGAC
CAGGACGGCTACCTCAATGACGACGAGATGCGTGACTTTCAGGCCCGCTGCTTCGACAAGCCCTTGACAAGCGAC
GACCTCGATAACATCAAGTTGTCCATTTCCAAAACGTTGCCCAACGTCAATCTCAACAGCGGTATCGATCAGCAT
GGCTTTCTCCAGCTCAACAAGATATACGCCGAAAAGGGCAGACACGAGACTATCTGGATCATTCTGCGAAAATAC
CATTATACTGACAGCCTGAGCCTCGAGGACAAGTTCCTCCATCCCAAACTCGACGTGCCCGAGTACTCGTCGGCC
GAGCTGAGTCCTGCCGGATACCGCTTCTTTGTCGATCTCTTCCTCCTCTTCGACAAGGACAACGACGGCGGCCTC
AATGATGGAGAGCTCGAGGCTCTCTTGTTGCCCACTCCAGGTCTGCCCGCATCGTGGGCCGACTCGGCCTTTCCC
TCATCCACGGTGCGCAACGAGGCGGGCCACATCACCTTACAGGGCTGGCTTGCGCAGTGGAGCATGACGACTTTT
CTCGAGCCCAAGACAACGATAGAGTACCTTGCCTATCTCGGATTCGAGCCGCAAAACCCAAAGGACTCCATCACG
GCGGCCATCAAGATTACCAAACCTCGCAAACGCCGCCGACGTCCTGGTCGCATCGAGAGAAACGTTGTCCTCTGT
TACCTTGTAGGAGGCTCTGGAGCCGGCAAATCTTCGCTGCTCGATACCTTTTTGAACCGTCCTTTCGAGGTGCTC
TACCATCCCACCATTAAGCCGCGTCGCGCCGTCAACAGTGTGGAGCTGCCTGGTGGCAAGCAGGTCTATCTCATC
CTCGAGGAGCTCGGCGAGTTGGAGCCAGCCATTTTGGAGAACAGAGCCAAGCTAGACTCGTGCGACGTCATTTGC
TACGCATACGACTCGTCGGATCCAGACTCTTTTTCACACATCGTCGAGACGCGTGCACGGCATCCACAGCTCGAC
GAGCTGCCTTCGGTCTACACTGCTCTCAAGGCCGACATGGACAAGACGACACAGCGCAGCGAGTTGCAGCCCGAC
CAGTACACGTCAATGCTTAGCGTCAACACGCCCCTCCATGTCAGCGTCACTTGGAGTGGCATCGGCGAGCTCTTT
GTCGCTCTCGCAGAGACTGCCACCAACCCAAGCCTCGGCTTTCCCAAGACGGAGGAGGAAGCGCCAGACAGGACA
AGTTTGTATTTGGCCCTTGGAGCGACTGCTTGCGCTGCCGTGGCGGCTGTTATGATTTGGCGCCGGTCGACAAAT
GCTGCTTCTTGA
Gene >OphauB2|7080
ATGGCCACGGGTACGCGCCCACAACACTGCACTAGGCGACGCGTTGACTAACACAAGCAATGGGACCAGTGCGCG
TCTGTGTCTGCGGCGACGAAAGCACCGGCAAGTCGAGCCTCATCGCCTCGCTGGTCAAAGACCAGTTTATGAGCC
ACAAGATCCAGCCTGTCCTGCCCCAAATCACGATTCCTCCCAGCATCGGCACGCCAGAAAATGTTACCACTACTA
TTGTTGACACGTCTGCCCGGCCGCAGGACCGCACGACGCTCCGCAAGGAGATCCGCAAATGCAATGTTATTCTAC
TCGTCTATGCCGATCATTACAGTTACGAGCGAGTAGCTCTGTTTTGGATGCCATATTTCCGATCCCTGGGCGTCA
ATGTCCCCGTCGTCCTGTGCGCAAATAAGTCGGATTTGTCTGGCCAATCTCAGACTTCACAGGTCGTCGAAGAGG
AGATGCTTCCTGTCATGGCTGAGTTCCGCGAAATCGACTCGTGCATACGCACCAGTGCCCGCGAGCATCAAAATG
TCAACGAAGTCTTCTTTCTGTGCCAGAAAGCCGTCACACATCCCATTGCGCCCTTGTTCGACTACAAGGAGGGCC
ATCTCAAGCCCGCCTGCGTCGCCGCTCTCAAGCGCGTCTTTTTTCTGTGCGACAAGGACCAGGACGGCTACCTCA
ATGACGACGAGATGCGTGACTTTCAGGCCCGCTGCTTCGACAAGCCCTTGACAAGCGACGACCTCGATAACATCA
AGTTGTCCATTTCCAAAACGTTGCCCAACGTCAATCTCAACAGCGGTATCGATCAGCATGGCTTTCTCCAGCTCA
ACAAGATATACGCCGAAAAGGGCAGACACGAGACTATCTGGATCATTCTGCGAAAATACCATTATACTGACAGCC
TGAGCCTCGAGGACAAGTTCCTCCATCCCAAACTCGACGTGCCCGAGTACTCGTCGGCCGAGCTGAGTCCTGCCG
GATACCGCTTCTTTGTCGATCTCTTCCTCCTCTTCGACAAGGACAACGACGGCGGCCTCAATGATGGAGAGCTCG
AGGCTCTCTTGTTGCCCACTCCAGGTCTGCCCGCATCGTGGGCCGACTCGGCCTTTCCCTCATCCACGGTGCGCA
ACGAGGCGGGCCACATCACCTTACAGGGCTGGCTTGCGCAGTGGAGCATGACGACTTTTCTCGAGCCCAAGACAA
CGATAGAGTACCTTGCCTATCTCGGATTCGAGCCGCAAAACCCAAAGGACTCCATCACGGCGGCCATCAAGATTA
CCAAACCTCGCAAACGCCGCCGACGTCCTGGTCGCATCGAGAGAAACGTTGTCCTCTGTTACCTTGTAGGAGGCT
CTGGAGCCGGCAAATCTTCGCTGCTCGATACCTTTTTGAACCGTCCTTTCGAGGTGCTCTACCATCCCACCATTA
AGCCGCGTCGCGCCGTCAACAGTGTGGAGCTGCCTGGTGGCAAGCAGGTCTATCTCATCCTCGAGGAGCTCGGCG
AGTTGGAGCCAGCCATTTTGGAGAACAGAGCCAAGCTAGACTCGTGCGACGTCATTTGCTACGCATACGACTCGT
CGGATCCAGACTCTTTTTCACACATCGTCGAGACGCGTGCACGGCATCCACAGCTCGACGAGCTGCCTTCGGTCT
ACACTGCTCTCAAGGCCGACATGGACAAGACGACACAGCGCAGCGAGTTGCAGCCCGACCAGTACACGTCAATGC
TTAGCGTCAACACGCCCCTCCATGTCAGCGTCACTTGGAGTGGCATCGGCGAGCTCTTTGTCGCTCTCGCAGAGA
CTGCCACCAACCCAAGCCTCGGCTTTCCCAAGACGGAGGAGGAAGCGCCAGACAGGACAAGTTTGTATTTGGCCC
TTGGAGCGACTGCTTGCGCTGCCGTGGCGGCTGTTATGATTTGGCGCCGGTCGACAAATGCTGCTTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail