Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7072
Gene name
LocationContig_70:29645..30515
Strand+
Gene length (bp)870
Transcript length (bp)870
Coding sequence length (bp)870
Protein length (aa) 290

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 1.5E-19 90 251
PF08241 Methyltransf_11 Methyltransferase domain 3.6E-19 95 201
PF08242 Methyltransf_12 Methyltransferase domain 7.3E-16 95 199
PF13649 Methyltransf_25 Methyltransferase domain 2.2E-15 95 197
PF13847 Methyltransf_31 Methyltransferase domain 2.6E-15 90 221
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 9.4E-07 86 210
PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) 1.2E-05 77 206

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O93995|COQ3_CANAX Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Candida albicans GN=COQ3 PE=3 SV=1 19 284 6.0E-57
sp|O74421|COQ3_SCHPO Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=coq3 PE=3 SV=2 3 284 9.0E-55
sp|P27680|COQ3_YEAST Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COQ3 PE=1 SV=2 5 284 1.0E-48
sp|Q0AA73|UBIG_ALKEH Ubiquinone biosynthesis O-methyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=ubiG PE=3 SV=1 39 270 8.0E-45
sp|Q482G8|UBIG_COLP3 Ubiquinone biosynthesis O-methyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=ubiG PE=3 SV=1 39 284 7.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O93995|COQ3_CANAX Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Candida albicans GN=COQ3 PE=3 SV=1 19 284 6.0E-57
sp|O74421|COQ3_SCHPO Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=coq3 PE=3 SV=2 3 284 9.0E-55
sp|P27680|COQ3_YEAST Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COQ3 PE=1 SV=2 5 284 1.0E-48
sp|Q0AA73|UBIG_ALKEH Ubiquinone biosynthesis O-methyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=ubiG PE=3 SV=1 39 270 8.0E-45
sp|Q482G8|UBIG_COLP3 Ubiquinone biosynthesis O-methyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=ubiG PE=3 SV=1 39 284 7.0E-44
sp|A8HVC4|UBIG_AZOC5 Ubiquinone biosynthesis O-methyltransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=ubiG PE=3 SV=1 35 280 8.0E-44
sp|Q21BZ6|UBIG_RHOPB Ubiquinone biosynthesis O-methyltransferase OS=Rhodopseudomonas palustris (strain BisB18) GN=ubiG PE=3 SV=1 27 262 6.0E-43
sp|Q7VKW2|UBIG_HAEDU Ubiquinone biosynthesis O-methyltransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=ubiG PE=3 SV=1 39 269 2.0E-42
sp|A8LQ43|UBIG_DINSH Ubiquinone biosynthesis O-methyltransferase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=ubiG PE=3 SV=1 35 262 2.0E-42
sp|B0V5X4|UBIG_ACIBY Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain AYE) GN=ubiG PE=3 SV=1 36 262 3.0E-42
sp|B7IBN2|UBIG_ACIB5 Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain AB0057) GN=ubiG PE=3 SV=1 36 262 3.0E-42
sp|B7H2Y9|UBIG_ACIB3 Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain AB307-0294) GN=ubiG PE=3 SV=1 36 262 3.0E-42
sp|B0VMN8|UBIG_ACIBS Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain SDF) GN=ubiG PE=3 SV=1 36 262 3.0E-42
sp|Q9A9X1|UBIG_CAUCR Ubiquinone biosynthesis O-methyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=ubiG PE=3 SV=1 28 284 4.0E-42
sp|B8H209|UBIG_CAUCN Ubiquinone biosynthesis O-methyltransferase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=ubiG PE=3 SV=1 28 284 4.0E-42
sp|A4YKT6|UBIG_BRASO Ubiquinone biosynthesis O-methyltransferase OS=Bradyrhizobium sp. (strain ORS278) GN=ubiG PE=3 SV=1 29 262 4.0E-42
sp|B2I023|UBIG_ACIBC Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain ACICU) GN=ubiG PE=3 SV=1 36 262 4.0E-42
sp|B0SW81|UBIG_CAUSK Ubiquinone biosynthesis O-methyltransferase OS=Caulobacter sp. (strain K31) GN=ubiG PE=3 SV=1 28 284 5.0E-42
sp|Q8BMS4|COQ3_MOUSE Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Mus musculus GN=Coq3 PE=1 SV=1 17 266 1.0E-41
sp|B8F4B1|UBIG_HAEPS Ubiquinone biosynthesis O-methyltransferase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=ubiG PE=3 SV=1 38 285 2.0E-41
sp|Q3IYM5|UBIG_RHOS4 Ubiquinone biosynthesis O-methyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ubiG PE=3 SV=1 35 262 2.0E-41
sp|Q6FFY1|UBIG_ACIAD Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ubiG PE=3 SV=1 36 262 2.0E-41
sp|A4WW91|UBIG_RHOS5 Ubiquinone biosynthesis O-methyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=ubiG PE=3 SV=1 35 262 4.0E-41
sp|Q2NSL7|UBIG_SODGM Ubiquinone biosynthesis O-methyltransferase OS=Sodalis glossinidius (strain morsitans) GN=ubiG PE=3 SV=1 24 286 7.0E-41
sp|Q63159|COQ3_RAT Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Rattus norvegicus GN=Coq3 PE=2 SV=2 10 266 7.0E-41
sp|A3MZ07|UBIG_ACTP2 Ubiquinone biosynthesis O-methyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ubiG PE=3 SV=1 38 277 8.0E-41
sp|B9KPP7|UBIG_RHOSK Ubiquinone biosynthesis O-methyltransferase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=ubiG PE=3 SV=1 35 262 8.0E-41
sp|A3PNM3|UBIG_RHOS1 Ubiquinone biosynthesis O-methyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ubiG PE=3 SV=1 35 262 9.0E-41
sp|Q3SVP3|UBIG_NITWN Ubiquinone biosynthesis O-methyltransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=ubiG PE=3 SV=1 38 283 1.0E-40
sp|Q5LWM6|UBIG_RUEPO Ubiquinone biosynthesis O-methyltransferase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ubiG PE=3 SV=1 38 262 3.0E-40
sp|A9IQF4|UBIG_BART1 Ubiquinone biosynthesis O-methyltransferase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=ubiG PE=3 SV=1 38 285 7.0E-40
sp|B8IUB0|UBIG_METNO Ubiquinone biosynthesis O-methyltransferase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=ubiG PE=3 SV=1 33 284 8.0E-40
sp|Q54XD0|COQ3_DICDI Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Dictyostelium discoideum GN=coq3 PE=3 SV=1 43 262 8.0E-40
sp|B0UAV0|UBIG_METS4 Ubiquinone biosynthesis O-methyltransferase OS=Methylobacterium sp. (strain 4-46) GN=ubiG PE=3 SV=1 39 286 9.0E-40
sp|A1U3K1|UBIG_MARHV Ubiquinone biosynthesis O-methyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=ubiG PE=3 SV=1 38 262 1.0E-39
sp|Q31GD8|UBIG_THICR Ubiquinone biosynthesis O-methyltransferase OS=Thiomicrospira crunogena (strain XCL-2) GN=ubiG PE=3 SV=1 30 286 1.0E-39
sp|B3H0C8|UBIG_ACTP7 Ubiquinone biosynthesis O-methyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=ubiG PE=3 SV=1 38 269 1.0E-39
sp|O49354|COQ3_ARATH Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Arabidopsis thaliana GN=COQ3 PE=2 SV=2 40 279 2.0E-39
sp|B7NN47|UBIG_ECO7I Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ubiG PE=3 SV=1 30 285 3.0E-39
sp|Q1GCH8|UBIG_RUEST Ubiquinone biosynthesis O-methyltransferase OS=Ruegeria sp. (strain TM1040) GN=ubiG PE=3 SV=1 35 285 3.0E-39
sp|B0UUV6|UBIG_HISS2 Ubiquinone biosynthesis O-methyltransferase OS=Histophilus somni (strain 2336) GN=ubiG PE=3 SV=1 38 241 3.0E-39
sp|B1LLI3|UBIG_ECOSM Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ubiG PE=3 SV=1 30 285 4.0E-39
sp|C3LLV3|UBIG_VIBCM Ubiquinone biosynthesis O-methyltransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=ubiG PE=3 SV=1 30 262 4.0E-39
sp|Q9KSJ9|UBIG_VIBCH Ubiquinone biosynthesis O-methyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ubiG PE=3 SV=1 30 262 4.0E-39
sp|A5F1U0|UBIG_VIBC3 Ubiquinone biosynthesis O-methyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=ubiG PE=3 SV=1 30 262 4.0E-39
sp|Q6G5K3|UBIG_BARHE Ubiquinone biosynthesis O-methyltransferase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ubiG PE=3 SV=1 38 262 5.0E-39
sp|A1URT5|UBIG_BARBK Ubiquinone biosynthesis O-methyltransferase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ubiG PE=3 SV=1 38 284 5.0E-39
sp|Q13EZ9|UBIG_RHOPS Ubiquinone biosynthesis O-methyltransferase OS=Rhodopseudomonas palustris (strain BisB5) GN=ubiG PE=3 SV=1 29 262 5.0E-39
sp|A1S6C9|UBIG_SHEAM Ubiquinone biosynthesis O-methyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=ubiG PE=3 SV=1 39 284 6.0E-39
sp|Q1R9I4|UBIG_ECOUT Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=ubiG PE=3 SV=1 39 285 7.0E-39
sp|B7MFZ8|UBIG_ECO45 Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ubiG PE=3 SV=1 39 285 7.0E-39
sp|Q28VP7|UBIG_JANSC Ubiquinone biosynthesis O-methyltransferase OS=Jannaschia sp. (strain CCS1) GN=ubiG PE=3 SV=1 28 264 7.0E-39
sp|A8H499|UBIG_SHEPA Ubiquinone biosynthesis O-methyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=ubiG PE=3 SV=1 35 262 7.0E-39
sp|Q2J419|UBIG_RHOP2 Ubiquinone biosynthesis O-methyltransferase OS=Rhodopseudomonas palustris (strain HaA2) GN=ubiG PE=3 SV=1 39 262 8.0E-39
sp|B7LM95|UBIG_ESCF3 Ubiquinone biosynthesis O-methyltransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ubiG PE=3 SV=1 39 285 9.0E-39
sp|A1RJD1|UBIG_SHESW Ubiquinone biosynthesis O-methyltransferase OS=Shewanella sp. (strain W3-18-1) GN=ubiG PE=3 SV=1 38 284 1.0E-38
sp|B7MXR3|UBIG_ECO81 Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O81 (strain ED1a) GN=ubiG PE=3 SV=1 39 285 1.0E-38
sp|A4Y759|UBIG_SHEPC Ubiquinone biosynthesis O-methyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=ubiG PE=3 SV=1 38 284 1.0E-38
sp|Q07VB6|UBIG_RHOP5 Ubiquinone biosynthesis O-methyltransferase OS=Rhodopseudomonas palustris (strain BisA53) GN=ubiG PE=3 SV=1 38 262 2.0E-38
sp|B7UFP4|UBIG_ECO27 Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ubiG PE=3 SV=1 39 285 2.0E-38
sp|Q16D32|UBIG_ROSDO Ubiquinone biosynthesis O-methyltransferase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ubiG PE=3 SV=1 38 286 2.0E-38
sp|Q8FFP0|UBIG_ECOL6 Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ubiG PE=3 SV=1 39 285 2.0E-38
sp|Q0I3Y4|UBIG_HAES1 Ubiquinone biosynthesis O-methyltransferase OS=Haemophilus somnus (strain 129Pt) GN=ubiG PE=3 SV=1 38 241 3.0E-38
sp|B3QCF3|UBIG_RHOPT Ubiquinone biosynthesis O-methyltransferase OS=Rhodopseudomonas palustris (strain TIE-1) GN=ubiG PE=3 SV=1 38 262 3.0E-38
sp|Q6NC69|UBIG_RHOPA Ubiquinone biosynthesis O-methyltransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ubiG PE=3 SV=2 38 262 3.0E-38
sp|Q0TFL0|UBIG_ECOL5 Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ubiG PE=3 SV=1 39 285 3.0E-38
sp|Q3YZX6|UBIG_SHISS Ubiquinone biosynthesis O-methyltransferase OS=Shigella sonnei (strain Ss046) GN=ubiG PE=3 SV=1 39 285 3.0E-38
sp|Q820C5|UBIG_SHIFL Ubiquinone biosynthesis O-methyltransferase OS=Shigella flexneri GN=ubiG PE=3 SV=1 39 285 3.0E-38
sp|Q0T2P9|UBIG_SHIF8 Ubiquinone biosynthesis O-methyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=ubiG PE=3 SV=1 39 285 3.0E-38
sp|Q9CMI6|UBIG_PASMU Ubiquinone biosynthesis O-methyltransferase OS=Pasteurella multocida (strain Pm70) GN=ubiG PE=3 SV=1 38 272 3.0E-38
sp|Q87ND5|UBIG_VIBPA Ubiquinone biosynthesis O-methyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=ubiG PE=3 SV=1 38 284 3.0E-38
sp|A4SM99|UBIG_AERS4 Ubiquinone biosynthesis O-methyltransferase OS=Aeromonas salmonicida (strain A449) GN=ubiG PE=3 SV=1 35 262 3.0E-38
sp|Q3J8U2|UBIG_NITOC Ubiquinone biosynthesis O-methyltransferase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=ubiG PE=3 SV=1 39 279 4.0E-38
sp|A8A296|UBIG_ECOHS Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=ubiG PE=3 SV=1 39 285 4.0E-38
sp|Q6G0I1|UBIG_BARQU Ubiquinone biosynthesis O-methyltransferase OS=Bartonella quintana (strain Toulouse) GN=ubiG PE=3 SV=1 38 284 4.0E-38
sp|A1JLA0|UBIG_YERE8 Ubiquinone biosynthesis O-methyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ubiG PE=3 SV=1 35 285 4.0E-38
sp|Q3SK91|UBIG_THIDA Ubiquinone biosynthesis O-methyltransferase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=ubiG PE=3 SV=1 38 286 5.0E-38
sp|Q11E01|UBIG_CHESB Ubiquinone biosynthesis O-methyltransferase OS=Chelativorans sp. (strain BNC1) GN=ubiG PE=3 SV=1 38 262 5.0E-38
sp|B1JS96|UBIG_YERPY Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=ubiG PE=3 SV=1 31 287 6.0E-38
sp|Q66CZ4|UBIG_YERPS Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ubiG PE=3 SV=1 31 287 6.0E-38
sp|A4TNI8|UBIG_YERPP Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pestis (strain Pestoides F) GN=ubiG PE=3 SV=1 31 287 6.0E-38
sp|Q1CFZ1|UBIG_YERPN Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ubiG PE=3 SV=1 31 287 6.0E-38
sp|A9R284|UBIG_YERPG Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=ubiG PE=3 SV=1 31 287 6.0E-38
sp|Q8ZGR6|UBIG_YERPE Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pestis GN=ubiG PE=3 SV=1 31 287 6.0E-38
sp|B2K9A4|UBIG_YERPB Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=ubiG PE=3 SV=1 31 287 6.0E-38
sp|Q1C9H5|UBIG_YERPA Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ubiG PE=3 SV=1 31 287 6.0E-38
sp|A7FKF4|UBIG_YERP3 Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ubiG PE=3 SV=1 31 287 6.0E-38
sp|Q609G2|UBIG_METCA Ubiquinone biosynthesis O-methyltransferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=ubiG PE=3 SV=1 39 286 7.0E-38
sp|B5YX17|UBIG_ECO5E Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ubiG PE=3 SV=1 39 285 7.0E-38
sp|Q8XE29|UBIG_ECO57 Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O157:H7 GN=ubiG PE=3 SV=1 39 285 7.0E-38
sp|B1IXV6|UBIG_ECOLC Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ubiG PE=3 SV=1 39 285 7.0E-38
sp|Q8FYK0|UBIG_BRUSU Ubiquinone biosynthesis O-methyltransferase OS=Brucella suis biovar 1 (strain 1330) GN=ubiG PE=3 SV=1 35 286 8.0E-38
sp|B0CIC6|UBIG_BRUSI Ubiquinone biosynthesis O-methyltransferase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=ubiG PE=3 SV=1 35 286 8.0E-38
sp|A5VSK3|UBIG_BRUO2 Ubiquinone biosynthesis O-methyltransferase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=ubiG PE=3 SV=1 35 286 8.0E-38
sp|A9M8K8|UBIG_BRUC2 Ubiquinone biosynthesis O-methyltransferase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=ubiG PE=3 SV=1 35 286 8.0E-38
sp|Q2YLN5|UBIG_BRUA2 Ubiquinone biosynthesis O-methyltransferase OS=Brucella abortus (strain 2308) GN=ubiG PE=3 SV=1 35 286 8.0E-38
sp|B2S828|UBIG_BRUA1 Ubiquinone biosynthesis O-methyltransferase OS=Brucella abortus (strain S19) GN=ubiG PE=3 SV=1 35 286 8.0E-38
sp|Q32DV8|UBIG_SHIDS Ubiquinone biosynthesis O-methyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ubiG PE=3 SV=1 39 285 8.0E-38
sp|B7N5J4|UBIG_ECOLU Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ubiG PE=3 SV=1 39 285 8.0E-38
sp|P17993|UBIG_ECOLI Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain K12) GN=ubiG PE=1 SV=1 39 285 8.0E-38
sp|B1X8C6|UBIG_ECODH Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=ubiG PE=3 SV=1 39 285 8.0E-38
sp|C4ZU73|UBIG_ECOBW Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ubiG PE=3 SV=1 39 285 8.0E-38
sp|A7ZP50|UBIG_ECO24 Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ubiG PE=3 SV=1 39 285 8.0E-38
sp|B0TT38|UBIG_SHEHH Ubiquinone biosynthesis O-methyltransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=ubiG PE=3 SV=1 35 262 9.0E-38
sp|Q8YJ98|UBIG_BRUME Ubiquinone biosynthesis O-methyltransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ubiG PE=3 SV=1 35 286 9.0E-38
sp|C0RFB8|UBIG_BRUMB Ubiquinone biosynthesis O-methyltransferase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=ubiG PE=3 SV=1 35 286 9.0E-38
sp|Q5P7U3|UBIG_AROAE Ubiquinone biosynthesis O-methyltransferase OS=Aromatoleum aromaticum (strain EbN1) GN=ubiG PE=3 SV=1 39 262 1.0E-37
sp|Q0HIX5|UBIG_SHESM Ubiquinone biosynthesis O-methyltransferase OS=Shewanella sp. (strain MR-4) GN=ubiG PE=3 SV=1 38 284 1.0E-37
sp|Q31Z65|UBIG_SHIBS Ubiquinone biosynthesis O-methyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=ubiG PE=3 SV=1 39 285 1.0E-37
sp|B2TW20|UBIG_SHIB3 Ubiquinone biosynthesis O-methyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ubiG PE=3 SV=1 39 285 1.0E-37
sp|B6I7I7|UBIG_ECOSE Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain SE11) GN=ubiG PE=3 SV=1 39 285 1.0E-37
sp|B7M5R7|UBIG_ECO8A Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O8 (strain IAI1) GN=ubiG PE=3 SV=1 39 285 1.0E-37
sp|B7LAP9|UBIG_ECO55 Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=ubiG PE=3 SV=1 39 285 1.0E-37
sp|Q8EEG9|UBIG_SHEON Ubiquinone biosynthesis O-methyltransferase OS=Shewanella oneidensis (strain MR-1) GN=ubiG PE=3 SV=1 38 284 2.0E-37
sp|Q9NZJ6|COQ3_HUMAN Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Homo sapiens GN=COQ3 PE=1 SV=3 35 266 2.0E-37
sp|Q89XU2|UBIG_BRADU Ubiquinone biosynthesis O-methyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ubiG PE=3 SV=1 27 262 2.0E-37
sp|Q0HV07|UBIG_SHESR Ubiquinone biosynthesis O-methyltransferase OS=Shewanella sp. (strain MR-7) GN=ubiG PE=3 SV=1 38 284 2.0E-37
sp|Q7WGT9|UBIG_BORBR Ubiquinone biosynthesis O-methyltransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ubiG PE=3 SV=2 30 262 3.0E-37
sp|A7MPA9|UBIG_CROS8 Ubiquinone biosynthesis O-methyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ubiG PE=3 SV=1 39 262 3.0E-37
sp|A8GGX8|UBIG_SERP5 Ubiquinone biosynthesis O-methyltransferase OS=Serratia proteamaculans (strain 568) GN=ubiG PE=3 SV=1 30 286 4.0E-37
sp|Q7VZG7|UBIG_BORPE Ubiquinone biosynthesis O-methyltransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ubiG PE=3 SV=1 30 262 4.0E-37
sp|B7V9J5|UBIG_PSEA8 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=ubiG PE=3 SV=1 38 286 4.0E-37
sp|Q8PK00|UBIG_XANAC Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ubiG PE=3 SV=1 30 267 5.0E-37
sp|Q7MM27|UBIG_VIBVY Ubiquinone biosynthesis O-methyltransferase OS=Vibrio vulnificus (strain YJ016) GN=ubiG PE=3 SV=1 38 262 6.0E-37
sp|Q8D8E0|UBIG_VIBVU Ubiquinone biosynthesis O-methyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=ubiG PE=3 SV=1 38 262 6.0E-37
sp|Q02PX7|UBIG_PSEAB Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ubiG PE=3 SV=1 38 286 7.0E-37
sp|B8EI29|UBIG_METSB Ubiquinone biosynthesis O-methyltransferase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=ubiG PE=3 SV=1 38 284 7.0E-37
sp|B5ZRR7|UBIG_RHILW Ubiquinone biosynthesis O-methyltransferase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=ubiG PE=3 SV=1 38 286 7.0E-37
sp|Q5QZ53|UBIG_IDILO Ubiquinone biosynthesis O-methyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=ubiG PE=3 SV=1 29 284 9.0E-37
sp|A6V2Q4|UBIG_PSEA7 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=ubiG PE=3 SV=1 38 286 1.0E-36
sp|Q9HZ63|UBIG_PSEAE Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ubiG PE=3 SV=1 38 286 2.0E-36
sp|B5FDT8|UBIG_VIBFM Ubiquinone biosynthesis O-methyltransferase OS=Vibrio fischeri (strain MJ11) GN=ubiG PE=3 SV=1 39 262 2.0E-36
sp|Q3BSF8|UBIG_XANC5 Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=ubiG PE=3 SV=1 30 267 2.0E-36
sp|A7MU79|UBIG_VIBCB Ubiquinone biosynthesis O-methyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=ubiG PE=3 SV=1 38 276 2.0E-36
sp|Q9PAM5|UBIG_XYLFA Ubiquinone biosynthesis O-methyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=ubiG PE=3 SV=1 31 267 2.0E-36
sp|Q87BG5|UBIG_XYLFT Ubiquinone biosynthesis O-methyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=ubiG PE=3 SV=1 35 267 2.0E-36
sp|B2I705|UBIG_XYLF2 Ubiquinone biosynthesis O-methyltransferase OS=Xylella fastidiosa (strain M23) GN=ubiG PE=3 SV=1 35 267 2.0E-36
sp|Q21UL3|UBIG_RHOFT Ubiquinone biosynthesis O-methyltransferase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=ubiG PE=3 SV=1 38 285 2.0E-36
sp|A0KWN3|UBIG_SHESA Ubiquinone biosynthesis O-methyltransferase OS=Shewanella sp. (strain ANA-3) GN=ubiG PE=3 SV=1 38 284 3.0E-36
sp|A8ADY5|UBIG_CITK8 Ubiquinone biosynthesis O-methyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ubiG PE=3 SV=1 39 276 3.0E-36
sp|Q3T131|COQ3_BOVIN Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Bos taurus GN=COQ3 PE=2 SV=1 35 266 3.0E-36
sp|Q5E5J8|UBIG_VIBF1 Ubiquinone biosynthesis O-methyltransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=ubiG PE=3 SV=1 39 262 3.0E-36
sp|Q820B5|UBIG_COXBU Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=ubiG PE=3 SV=1 36 272 3.0E-36
sp|A9NBI0|UBIG_COXBR Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=ubiG PE=3 SV=1 36 272 3.0E-36
sp|B6J1W2|UBIG_COXB2 Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain CbuG_Q212) GN=ubiG PE=3 SV=1 36 272 3.0E-36
sp|C0Q093|UBIG_SALPC Ubiquinone biosynthesis O-methyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=ubiG PE=3 SV=1 39 276 3.0E-36
sp|B5RCA1|UBIG_SALG2 Ubiquinone biosynthesis O-methyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=ubiG PE=3 SV=1 39 276 3.0E-36
sp|B5R249|UBIG_SALEP Ubiquinone biosynthesis O-methyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=ubiG PE=3 SV=1 39 276 3.0E-36
sp|Q57M77|UBIG_SALCH Ubiquinone biosynthesis O-methyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=ubiG PE=3 SV=2 39 276 3.0E-36
sp|A9KGL7|UBIG_COXBN Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=ubiG PE=3 SV=1 36 272 3.0E-36
sp|B0U3W1|UBIG_XYLFM Ubiquinone biosynthesis O-methyltransferase OS=Xylella fastidiosa (strain M12) GN=ubiG PE=3 SV=1 35 267 3.0E-36
sp|Q4FVG3|UBIG_PSYA2 Ubiquinone biosynthesis O-methyltransferase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=ubiG PE=3 SV=2 35 284 3.0E-36
sp|A9L2Y4|UBIG_SHEB9 Ubiquinone biosynthesis O-methyltransferase OS=Shewanella baltica (strain OS195) GN=ubiG PE=3 SV=1 38 265 3.0E-36
sp|A6WNN7|UBIG_SHEB8 Ubiquinone biosynthesis O-methyltransferase OS=Shewanella baltica (strain OS185) GN=ubiG PE=3 SV=1 38 265 3.0E-36
sp|A3D499|UBIG_SHEB5 Ubiquinone biosynthesis O-methyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ubiG PE=3 SV=1 38 265 3.0E-36
sp|B8EA88|UBIG_SHEB2 Ubiquinone biosynthesis O-methyltransferase OS=Shewanella baltica (strain OS223) GN=ubiG PE=3 SV=1 38 265 3.0E-36
sp|A9MJY3|UBIG_SALAR Ubiquinone biosynthesis O-methyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=ubiG PE=3 SV=1 39 276 4.0E-36
sp|B6J5Y2|UBIG_COXB1 Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain CbuK_Q154) GN=ubiG PE=3 SV=1 36 272 4.0E-36
sp|Q8Z560|UBIG_SALTI Ubiquinone biosynthesis O-methyltransferase OS=Salmonella typhi GN=ubiG PE=3 SV=1 39 276 5.0E-36
sp|A7HTX8|UBIG_PARL1 Ubiquinone biosynthesis O-methyltransferase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=ubiG PE=3 SV=1 35 287 5.0E-36
sp|Q2L2T5|UBIG_BORA1 Ubiquinone biosynthesis O-methyltransferase OS=Bordetella avium (strain 197N) GN=ubiG PE=3 SV=1 30 284 6.0E-36
sp|P37431|UBIG_SALTY Ubiquinone biosynthesis O-methyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ubiG PE=3 SV=2 39 276 6.0E-36
sp|B4TPG0|UBIG_SALSV Ubiquinone biosynthesis O-methyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=ubiG PE=3 SV=1 39 276 6.0E-36
sp|B4SYU8|UBIG_SALNS Ubiquinone biosynthesis O-methyltransferase OS=Salmonella newport (strain SL254) GN=ubiG PE=3 SV=1 39 276 6.0E-36
sp|B4TBE3|UBIG_SALHS Ubiquinone biosynthesis O-methyltransferase OS=Salmonella heidelberg (strain SL476) GN=ubiG PE=3 SV=1 39 276 6.0E-36
sp|B5FNR7|UBIG_SALDC Ubiquinone biosynthesis O-methyltransferase OS=Salmonella dublin (strain CT_02021853) GN=ubiG PE=3 SV=1 39 276 6.0E-36
sp|B5EYW1|UBIG_SALA4 Ubiquinone biosynthesis O-methyltransferase OS=Salmonella agona (strain SL483) GN=ubiG PE=3 SV=1 39 276 6.0E-36
sp|Q1QEI9|UBIG_PSYCK Ubiquinone biosynthesis O-methyltransferase OS=Psychrobacter cryohalolentis (strain K5) GN=ubiG PE=3 SV=2 36 284 7.0E-36
sp|B2VIL6|UBIG_ERWT9 Ubiquinone biosynthesis O-methyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ubiG PE=3 SV=1 39 262 8.0E-36
sp|Q7W5Z6|UBIG_BORPA Ubiquinone biosynthesis O-methyltransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ubiG PE=3 SV=2 30 262 8.0E-36
sp|B4EZ30|UBIG_PROMH Ubiquinone biosynthesis O-methyltransferase OS=Proteus mirabilis (strain HI4320) GN=ubiG PE=3 SV=1 30 262 9.0E-36
sp|Q7NZ91|UBIG_CHRVO Ubiquinone biosynthesis O-methyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ubiG PE=3 SV=1 38 285 1.0E-35
sp|Q6D7X5|UBIG_PECAS Ubiquinone biosynthesis O-methyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ubiG PE=3 SV=1 39 245 1.0E-35
sp|Q8UA66|UBIG_AGRFC Ubiquinone biosynthesis O-methyltransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ubiG PE=3 SV=1 33 260 1.0E-35
sp|Q2Y6Z3|UBIG_NITMU Ubiquinone biosynthesis O-methyltransferase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=ubiG PE=3 SV=1 38 262 1.0E-35
sp|A8EY40|UBIG_RICCK Ubiquinone biosynthesis O-methyltransferase OS=Rickettsia canadensis (strain McKiel) GN=ubiG PE=3 SV=1 38 285 2.0E-35
sp|Q98G87|UBIG_RHILO Ubiquinone biosynthesis O-methyltransferase OS=Rhizobium loti (strain MAFF303099) GN=ubiG PE=3 SV=1 38 286 3.0E-35
sp|Q2RWE9|UBIG_RHORT Ubiquinone biosynthesis O-methyltransferase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=ubiG PE=3 SV=1 33 286 3.0E-35
sp|A6TBT7|UBIG_KLEP7 Ubiquinone biosynthesis O-methyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ubiG PE=3 SV=1 30 269 3.0E-35
sp|Q2K3S8|UBIG_RHIEC Ubiquinone biosynthesis O-methyltransferase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ubiG PE=3 SV=1 38 286 4.0E-35
sp|Q81ZZ2|UBIG_NITEU Ubiquinone biosynthesis O-methyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=ubiG PE=3 SV=1 40 262 5.0E-35
sp|B7VGS0|UBIG_VIBTL Ubiquinone biosynthesis O-methyltransferase OS=Vibrio tasmaniensis (strain LGP32) GN=ubiG PE=3 SV=1 38 284 5.0E-35
sp|A4WCN5|UBIG_ENT38 Ubiquinone biosynthesis O-methyltransferase OS=Enterobacter sp. (strain 638) GN=ubiG PE=3 SV=1 39 269 6.0E-35
sp|Q21IR9|UBIG_SACD2 Ubiquinone biosynthesis O-methyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=ubiG PE=3 SV=1 39 284 6.0E-35
sp|B5XNZ3|UBIG_KLEP3 Ubiquinone biosynthesis O-methyltransferase OS=Klebsiella pneumoniae (strain 342) GN=ubiG PE=3 SV=1 30 262 7.0E-35
sp|C1DRQ3|UBIG_AZOVD Ubiquinone biosynthesis O-methyltransferase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ubiG PE=3 SV=1 38 285 1.0E-34
sp|Q3ILA5|UBIG_PSEHT Ubiquinone biosynthesis O-methyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=ubiG PE=3 SV=1 35 286 1.0E-34
sp|Q4FNA2|UBIG_PELUB Ubiquinone biosynthesis O-methyltransferase OS=Pelagibacter ubique (strain HTCC1062) GN=ubiG PE=3 SV=1 38 241 1.0E-34
sp|Q92MK1|UBIG_RHIME Ubiquinone biosynthesis O-methyltransferase OS=Rhizobium meliloti (strain 1021) GN=ubiG PE=3 SV=1 33 262 1.0E-34
sp|Q5GZB5|UBIG_XANOR Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=ubiG PE=3 SV=1 30 267 2.0E-34
sp|B2SHS9|UBIG_XANOP Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=ubiG PE=3 SV=1 30 267 2.0E-34
sp|Q2P2C4|UBIG_XANOM Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=ubiG PE=3 SV=1 30 267 2.0E-34
sp|A6UCF6|UBIG_SINMW Ubiquinone biosynthesis O-methyltransferase OS=Sinorhizobium medicae (strain WSM419) GN=ubiG PE=3 SV=1 33 262 2.0E-34
sp|Q1RJC7|UBIG_RICBR Ubiquinone biosynthesis O-methyltransferase OS=Rickettsia bellii (strain RML369-C) GN=ubiG PE=3 SV=1 38 286 2.0E-34
sp|A8GX11|UBIG_RICB8 Ubiquinone biosynthesis O-methyltransferase OS=Rickettsia bellii (strain OSU 85-389) GN=ubiG PE=3 SV=1 38 286 2.0E-34
sp|C6DBN5|UBIG_PECCP Ubiquinone biosynthesis O-methyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=ubiG PE=3 SV=1 39 262 3.0E-34
sp|Q7N2M5|UBIG_PHOLL Ubiquinone biosynthesis O-methyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=ubiG PE=3 SV=1 35 262 4.0E-34
sp|B9JB78|UBIG_AGRRK Ubiquinone biosynthesis O-methyltransferase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=ubiG PE=3 SV=1 33 262 4.0E-34
sp|B0KTX4|UBIG_PSEPG Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas putida (strain GB-1) GN=ubiG PE=3 SV=1 38 262 4.0E-34
sp|C3MHQ9|UBIG_RHISN Ubiquinone biosynthesis O-methyltransferase OS=Rhizobium sp. (strain NGR234) GN=ubiG PE=3 SV=1 33 262 5.0E-34
sp|Q4UME7|UBIG_RICFE Ubiquinone biosynthesis O-methyltransferase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=ubiG PE=3 SV=1 38 287 5.0E-34
sp|Q47GP8|UBIG_DECAR Ubiquinone biosynthesis O-methyltransferase OS=Dechloromonas aromatica (strain RCB) GN=ubiG PE=3 SV=1 40 262 6.0E-34
sp|Q8P8H2|UBIG_XANCP Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=ubiG PE=3 SV=1 35 267 6.0E-34
sp|B0RS27|UBIG_XANCB Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=ubiG PE=3 SV=1 35 267 6.0E-34
sp|Q4UVL4|UBIG_XANC8 Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=ubiG PE=3 SV=1 35 267 6.0E-34
sp|B1Y2L3|UBIG_LEPCP Ubiquinone biosynthesis O-methyltransferase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=ubiG PE=3 SV=1 41 262 6.0E-34
sp|Q0AME1|UBIG_MARMM Ubiquinone biosynthesis O-methyltransferase OS=Maricaulis maris (strain MCS10) GN=ubiG PE=3 SV=1 27 286 6.0E-34
sp|A9M0C4|UBIG_NEIM0 Ubiquinone biosynthesis O-methyltransferase OS=Neisseria meningitidis serogroup C (strain 053442) GN=ubiG PE=3 SV=1 39 260 7.0E-34
sp|B3PP83|UBIG_RHIE6 Ubiquinone biosynthesis O-methyltransferase OS=Rhizobium etli (strain CIAT 652) GN=ubiG PE=3 SV=1 38 262 7.0E-34
sp|Q88M10|UBIG_PSEPK Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas putida (strain KT2440) GN=ubiG PE=3 SV=1 38 262 9.0E-34
sp|A5W7G3|UBIG_PSEP1 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ubiG PE=3 SV=1 38 262 9.0E-34
sp|Q9JWE6|UBIG_NEIMA Ubiquinone biosynthesis O-methyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=ubiG PE=3 SV=1 39 260 1.0E-33
sp|Q9JXI7|UBIG_NEIMB Ubiquinone biosynthesis O-methyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=ubiG PE=3 SV=2 39 260 1.0E-33
sp|B5BCS0|UBIG_SALPK Ubiquinone biosynthesis O-methyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=ubiG PE=3 SV=1 39 276 2.0E-33
sp|Q5PCY1|UBIG_SALPA Ubiquinone biosynthesis O-methyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ubiG PE=3 SV=1 39 276 2.0E-33
sp|Q885T9|UBIG_PSESM Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ubiG PE=3 SV=2 38 286 2.0E-33
sp|Q2W6W0|UBIG_MAGSA Ubiquinone biosynthesis O-methyltransferase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=ubiG PE=3 SV=1 38 262 2.0E-33
sp|A6WXQ0|UBIG_OCHA4 Ubiquinone biosynthesis O-methyltransferase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=ubiG PE=3 SV=1 35 286 3.0E-33
sp|Q46Y42|UBIG_CUPPJ Ubiquinone biosynthesis O-methyltransferase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ubiG PE=3 SV=1 41 287 3.0E-33
sp|Q1IDA6|UBIG_PSEE4 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas entomophila (strain L48) GN=ubiG PE=3 SV=1 38 262 5.0E-33
sp|B2JEZ6|UBIG_BURP8 Ubiquinone biosynthesis O-methyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ubiG PE=3 SV=1 41 286 6.0E-33
sp|Q1MBA9|UBIG_RHIL3 Ubiquinone biosynthesis O-methyltransferase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ubiG PE=3 SV=1 35 262 6.0E-33
sp|C3K6J1|UBIG_PSEFS Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=ubiG PE=3 SV=1 38 262 9.0E-33
sp|Q8Y0Z5|UBIG_RALSO Ubiquinone biosynthesis O-methyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=ubiG PE=3 SV=2 35 284 1.0E-32
sp|Q9ZCT9|UBIG_RICPR Ubiquinone biosynthesis O-methyltransferase OS=Rickettsia prowazekii (strain Madrid E) GN=ubiG PE=3 SV=1 38 287 1.0E-32
sp|B1J5G4|UBIG_PSEPW Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas putida (strain W619) GN=ubiG PE=3 SV=1 38 262 2.0E-32
sp|Q4ZQ90|UBIG_PSEU2 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ubiG PE=3 SV=1 38 262 2.0E-32
sp|Q48FM4|UBIG_PSE14 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ubiG PE=3 SV=1 38 262 2.0E-32
sp|Q13VB4|UBIG_BURXL Ubiquinone biosynthesis O-methyltransferase OS=Burkholderia xenovorans (strain LB400) GN=ubiG PE=3 SV=1 41 286 2.0E-32
sp|A8GPB1|UBIG_RICAH Ubiquinone biosynthesis O-methyltransferase OS=Rickettsia akari (strain Hartford) GN=ubiG PE=3 SV=1 38 282 3.0E-32
sp|Q4K8M4|UBIG_PSEF5 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ubiG PE=3 SV=1 38 262 3.0E-32
sp|Q63RZ8|UBIG_BURPS Ubiquinone biosynthesis O-methyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=ubiG PE=3 SV=1 41 286 4.0E-32
sp|Q3JPX1|UBIG_BURP1 Ubiquinone biosynthesis O-methyltransferase OS=Burkholderia pseudomallei (strain 1710b) GN=ubiG PE=3 SV=1 41 286 4.0E-32
sp|Q62M18|UBIG_BURMA Ubiquinone biosynthesis O-methyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=ubiG PE=3 SV=1 41 286 4.0E-32
sp|Q3K8T6|UBIG_PSEPF Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=ubiG PE=3 SV=1 38 262 5.0E-32
sp|Q68WB5|UBIG_RICTY Ubiquinone biosynthesis O-methyltransferase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=ubiG PE=3 SV=1 38 287 7.0E-32
sp|Q2SE61|UBIG_HAHCH Ubiquinone biosynthesis O-methyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=ubiG PE=3 SV=1 38 277 1.0E-31
sp|Q2SY32|UBIG_BURTA Ubiquinone biosynthesis O-methyltransferase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ubiG PE=3 SV=1 41 285 2.0E-31
sp|Q0BHA0|UBIG_BURCM Ubiquinone biosynthesis O-methyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ubiG PE=3 SV=1 41 286 6.0E-31
sp|B1YV26|UBIG_BURA4 Ubiquinone biosynthesis O-methyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=ubiG PE=3 SV=1 41 286 6.0E-31
sp|A1TSA0|UBIG_ACIAC Ubiquinone biosynthesis O-methyltransferase OS=Acidovorax citrulli (strain AAC00-1) GN=ubiG PE=3 SV=1 35 285 7.0E-31
sp|A1K8Q1|UBIG_AZOSB Ubiquinone biosynthesis O-methyltransferase OS=Azoarcus sp. (strain BH72) GN=ubiG PE=3 SV=1 39 262 1.0E-30
sp|B2T641|UBIG_BURPP Ubiquinone biosynthesis O-methyltransferase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=ubiG PE=3 SV=1 41 284 1.0E-30
sp|A9ADW3|UBIG_BURM1 Ubiquinone biosynthesis O-methyltransferase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=ubiG PE=3 SV=1 41 286 3.0E-30
sp|Q6LPD7|UBIG_PHOPR Ubiquinone biosynthesis O-methyltransferase OS=Photobacterium profundum GN=ubiG PE=3 SV=1 39 262 3.0E-30
sp|A4JCG7|UBIG_BURVG Ubiquinone biosynthesis O-methyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=ubiG PE=3 SV=1 41 286 4.0E-30
sp|A4VLX7|UBIG_PSEU5 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=ubiG PE=3 SV=1 38 262 1.0E-29
sp|A0K5L4|UBIG_BURCH Ubiquinone biosynthesis O-methyltransferase OS=Burkholderia cenocepacia (strain HI2424) GN=ubiG PE=3 SV=1 41 286 2.0E-29
sp|B1JXR2|UBIG_BURCC Ubiquinone biosynthesis O-methyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=ubiG PE=3 SV=1 41 286 2.0E-29
sp|Q1BY35|UBIG_BURCA Ubiquinone biosynthesis O-methyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=ubiG PE=3 SV=1 41 286 2.0E-29
sp|B4EB49|UBIG_BURCJ Ubiquinone biosynthesis O-methyltransferase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=ubiG PE=3 SV=1 41 286 5.0E-29
sp|Q39IG8|UBIG_BURL3 Ubiquinone biosynthesis O-methyltransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ubiG PE=3 SV=1 41 286 6.0E-29
sp|Q92H07|UBIG_RICCN Ubiquinone biosynthesis O-methyltransferase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=ubiG PE=3 SV=1 38 286 2.0E-28
sp|O13871|YE16_SCHPO Uncharacterized methyltransferase C1B3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.06c PE=3 SV=1 94 202 2.0E-07
sp|A0QUV5|Y2350_MYCS2 Probable S-adenosylmethionine-dependent methyltransferase MSMEG_2350/MSMEI_2290 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_2350 PE=1 SV=1 72 264 2.0E-07
sp|P08442|Y1184_SYNP6 Uncharacterized protein syc1184_c OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=syc1184_c PE=4 SV=1 94 205 5.0E-07
sp|P20187|YT37_STRFR Uncharacterized 37.1 kDa protein in transposon TN4556 OS=Streptomyces fradiae PE=3 SV=1 17 222 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7072
MANSMATRSSVRLAATCGRQLRCSFSSSSSSSSYSSYSSVNADQVSHFDALASSWWDPYGSSRLLHLMNPLRHDF
IRSCLASSSTSQADESLSFLDIGCGGGIFAESAARLPSTRRVVAIDPTPSVLAVARAHARRDPSLTAHRLTYQQT
TVEELPVPAVDDDSGRFDVVTLFEVLEHVDDPATFLERVRPFVRPGGWLVISTIARTWMSWLTTKLVAEDVLRIV
PPGTHDWHKYINEHELRRFLTHRGWQSPRALGVVYMPGLGWRPVQGSEILGNYFFAVQRSADEP*
Coding >OphauB2|7072
ATGGCCAACTCGATGGCGACTCGCAGCAGCGTGCGGCTGGCGGCCACGTGTGGGCGGCAACTGCGCTGCTCTTTT
TCGTCATCGTCGTCGTCGTCGTCGTACTCGTCGTACTCGTCAGTCAATGCCGACCAAGTGTCGCATTTCGACGCC
CTTGCCAGCTCGTGGTGGGATCCCTATGGCTCCTCGCGACTGCTACACCTGATGAATCCGCTGCGGCACGACTTT
ATCCGCTCGTGTCTTGCTTCATCCTCGACCTCCCAGGCCGACGAGTCGCTGAGCTTCCTCGACATTGGCTGCGGA
GGCGGCATCTTTGCCGAGAGTGCCGCCCGCCTGCCCTCGACGCGACGTGTCGTGGCCATTGACCCAACGCCCTCG
GTTCTTGCCGTGGCGCGCGCCCACGCGCGGCGCGATCCCAGCTTGACGGCGCATCGCCTCACCTACCAGCAGACG
ACGGTGGAGGAGCTGCCGGTGCCGGCTGTCGACGACGACTCGGGCCGCTTCGACGTGGTGACGCTGTTTGAGGTG
CTGGAGCATGTCGACGACCCGGCCACCTTTCTCGAGCGCGTGCGGCCCTTTGTTAGGCCGGGCGGGTGGCTTGTC
ATCAGCACCATTGCACGCACCTGGATGAGTTGGTTGACTACAAAGCTCGTGGCAGAGGACGTACTGCGCATCGTG
CCGCCAGGCACCCACGACTGGCACAAATACATCAATGAGCATGAGCTGCGCCGCTTCCTCACCCATAGGGGGTGG
CAGAGCCCCAGGGCCTTGGGCGTTGTCTATATGCCCGGCTTGGGCTGGCGGCCCGTGCAGGGCAGCGAGATACTG
GGCAACTATTTTTTCGCCGTCCAGCGCAGCGCAGACGAACCGTAG
Transcript >OphauB2|7072
ATGGCCAACTCGATGGCGACTCGCAGCAGCGTGCGGCTGGCGGCCACGTGTGGGCGGCAACTGCGCTGCTCTTTT
TCGTCATCGTCGTCGTCGTCGTCGTACTCGTCGTACTCGTCAGTCAATGCCGACCAAGTGTCGCATTTCGACGCC
CTTGCCAGCTCGTGGTGGGATCCCTATGGCTCCTCGCGACTGCTACACCTGATGAATCCGCTGCGGCACGACTTT
ATCCGCTCGTGTCTTGCTTCATCCTCGACCTCCCAGGCCGACGAGTCGCTGAGCTTCCTCGACATTGGCTGCGGA
GGCGGCATCTTTGCCGAGAGTGCCGCCCGCCTGCCCTCGACGCGACGTGTCGTGGCCATTGACCCAACGCCCTCG
GTTCTTGCCGTGGCGCGCGCCCACGCGCGGCGCGATCCCAGCTTGACGGCGCATCGCCTCACCTACCAGCAGACG
ACGGTGGAGGAGCTGCCGGTGCCGGCTGTCGACGACGACTCGGGCCGCTTCGACGTGGTGACGCTGTTTGAGGTG
CTGGAGCATGTCGACGACCCGGCCACCTTTCTCGAGCGCGTGCGGCCCTTTGTTAGGCCGGGCGGGTGGCTTGTC
ATCAGCACCATTGCACGCACCTGGATGAGTTGGTTGACTACAAAGCTCGTGGCAGAGGACGTACTGCGCATCGTG
CCGCCAGGCACCCACGACTGGCACAAATACATCAATGAGCATGAGCTGCGCCGCTTCCTCACCCATAGGGGGTGG
CAGAGCCCCAGGGCCTTGGGCGTTGTCTATATGCCCGGCTTGGGCTGGCGGCCCGTGCAGGGCAGCGAGATACTG
GGCAACTATTTTTTCGCCGTCCAGCGCAGCGCAGACGAACCGTAG
Gene >OphauB2|7072
ATGGCCAACTCGATGGCGACTCGCAGCAGCGTGCGGCTGGCGGCCACGTGTGGGCGGCAACTGCGCTGCTCTTTT
TCGTCATCGTCGTCGTCGTCGTCGTACTCGTCGTACTCGTCAGTCAATGCCGACCAAGTGTCGCATTTCGACGCC
CTTGCCAGCTCGTGGTGGGATCCCTATGGCTCCTCGCGACTGCTACACCTGATGAATCCGCTGCGGCACGACTTT
ATCCGCTCGTGTCTTGCTTCATCCTCGACCTCCCAGGCCGACGAGTCGCTGAGCTTCCTCGACATTGGCTGCGGA
GGCGGCATCTTTGCCGAGAGTGCCGCCCGCCTGCCCTCGACGCGACGTGTCGTGGCCATTGACCCAACGCCCTCG
GTTCTTGCCGTGGCGCGCGCCCACGCGCGGCGCGATCCCAGCTTGACGGCGCATCGCCTCACCTACCAGCAGACG
ACGGTGGAGGAGCTGCCGGTGCCGGCTGTCGACGACGACTCGGGCCGCTTCGACGTGGTGACGCTGTTTGAGGTG
CTGGAGCATGTCGACGACCCGGCCACCTTTCTCGAGCGCGTGCGGCCCTTTGTTAGGCCGGGCGGGTGGCTTGTC
ATCAGCACCATTGCACGCACCTGGATGAGTTGGTTGACTACAAAGCTCGTGGCAGAGGACGTACTGCGCATCGTG
CCGCCAGGCACCCACGACTGGCACAAATACATCAATGAGCATGAGCTGCGCCGCTTCCTCACCCATAGGGGGTGG
CAGAGCCCCAGGGCCTTGGGCGTTGTCTATATGCCCGGCTTGGGCTGGCGGCCCGTGCAGGGCAGCGAGATACTG
GGCAACTATTTTTTCGCCGTCCAGCGCAGCGCAGACGAACCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail