Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7063
Gene name
LocationContig_70:944..2392
Strand-
Gene length (bp)1448
Transcript length (bp)1284
Coding sequence length (bp)1284
Protein length (aa) 428

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01266 DAO FAD dependent oxidoreductase 5.5E-30 5 387
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 3.2E-05 7 62

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O43029|FAP1_SCHPO L-pipecolate oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fap1 PE=1 SV=1 4 406 2.0E-36
sp|Q9UTM9|FAP2_SCHPO L-saccharopine oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fap2 PE=1 SV=1 1 425 2.0E-34
sp|P40859|MSOX_BACB0 Monomeric sarcosine oxidase OS=Bacillus sp. (strain B-0618) GN=soxA PE=1 SV=2 6 213 1.0E-07

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7063
MAPSYLIIGAGNFGAATALTLAKRGYDNITLVDSADFPNPRAASHDVNKIVRDDYPDRLYMRMLKKAMPKWRHES
PYCDFYHEVGMLRADGTSFGHESMAAYRDMGVANDSQFLPVAEVRRRWNGAFATANFDGLDTILYNPTVGFAEAD
KLLGAVVGEAIRHGVKYVVGSMKHLNFGPDGECVGITLESGDVFKADKMLLATGARTPALLAQSAPNNKLLHLGD
RVIATGAISFKAKLFGEQKAKFAPIPVLKNCLAQVKGEGMSILQDGTIKFNCDMCFTNYITLPATGERMSVPPEP
DFFNTWTGPKFITFFQERARRTLDGLYGHEVDDIPIDSYRMCWDASTPTHDFLIAPHPHCQGLYVATGGSFHGWK
FLPVIGDYVADMMHSSLDSDYADRWAWDKKSPDGHSANPTYQVVGDLQDWIS*
Coding >OphauB2|7063
ATGGCACCTTCATATCTCATCATTGGAGCTGGCAACTTTGGCGCCGCTACTGCCCTGACACTGGCCAAGCGTGGC
TACGACAATATTACACTAGTCGACTCGGCCGATTTTCCAAATCCCAGGGCTGCTTCGCACGACGTGAACAAAATT
GTCCGCGATGACTACCCCGACCGCCTGTACATGCGCATGCTGAAGAAAGCTATGCCCAAATGGCGCCATGAGAGC
CCCTACTGTGATTTTTACCACGAGGTGGGAATGCTACGCGCCGACGGCACATCTTTTGGCCACGAGAGCATGGCA
GCCTACCGCGACATGGGCGTGGCAAATGACTCGCAGTTTCTGCCAGTGGCCGAAGTGCGCCGCCGCTGGAATGGT
GCCTTTGCAACAGCAAACTTTGACGGGCTTGACACCATTCTGTACAATCCCACCGTGGGCTTTGCAGAGGCCGAC
AAGCTTCTCGGTGCCGTGGTTGGCGAAGCCATAAGACATGGCGTCAAGTACGTGGTGGGCTCCATGAAGCACCTC
AACTTTGGCCCCGACGGCGAGTGCGTTGGCATTACGCTCGAGTCTGGCGACGTGTTTAAAGCGGACAAGATGCTA
CTCGCCACTGGGGCGCGCACTCCGGCCCTCTTGGCACAGAGCGCCCCCAACAATAAGCTGCTGCATTTGGGTGAC
CGAGTCATTGCTACTGGCGCCATCAGCTTCAAGGCTAAGCTGTTTGGCGAACAAAAGGCAAAGTTTGCGCCCATT
CCCGTCCTCAAGAACTGTCTGGCGCAGGTCAAAGGAGAGGGTATGTCGATTCTCCAAGACGGCACCATCAAGTTC
AATTGCGACATGTGCTTTACCAATTACATCACTCTGCCCGCTACGGGCGAGCGCATGTCGGTTCCCCCAGAGCCA
GACTTCTTCAACACCTGGACAGGCCCCAAATTCATCACATTTTTCCAAGAGCGGGCGCGGCGGACACTTGACGGC
CTCTACGGCCACGAGGTGGATGATATCCCCATTGACTCGTATCGCATGTGCTGGGACGCATCCACGCCTACCCAC
GACTTCCTCATCGCGCCGCACCCGCACTGCCAAGGCCTCTACGTGGCGACAGGTGGCTCGTTTCATGGCTGGAAA
TTCCTGCCCGTGATTGGCGACTACGTAGCCGACATGATGCACAGCAGCCTCGATTCGGACTACGCGGACCGTTGG
GCATGGGACAAGAAGAGCCCAGATGGCCATTCTGCCAATCCTACATACCAGGTAGTCGGTGACCTGCAGGACTGG
ATCTCGTGA
Transcript >OphauB2|7063
ATGGCACCTTCATATCTCATCATTGGAGCTGGCAACTTTGGCGCCGCTACTGCCCTGACACTGGCCAAGCGTGGC
TACGACAATATTACACTAGTCGACTCGGCCGATTTTCCAAATCCCAGGGCTGCTTCGCACGACGTGAACAAAATT
GTCCGCGATGACTACCCCGACCGCCTGTACATGCGCATGCTGAAGAAAGCTATGCCCAAATGGCGCCATGAGAGC
CCCTACTGTGATTTTTACCACGAGGTGGGAATGCTACGCGCCGACGGCACATCTTTTGGCCACGAGAGCATGGCA
GCCTACCGCGACATGGGCGTGGCAAATGACTCGCAGTTTCTGCCAGTGGCCGAAGTGCGCCGCCGCTGGAATGGT
GCCTTTGCAACAGCAAACTTTGACGGGCTTGACACCATTCTGTACAATCCCACCGTGGGCTTTGCAGAGGCCGAC
AAGCTTCTCGGTGCCGTGGTTGGCGAAGCCATAAGACATGGCGTCAAGTACGTGGTGGGCTCCATGAAGCACCTC
AACTTTGGCCCCGACGGCGAGTGCGTTGGCATTACGCTCGAGTCTGGCGACGTGTTTAAAGCGGACAAGATGCTA
CTCGCCACTGGGGCGCGCACTCCGGCCCTCTTGGCACAGAGCGCCCCCAACAATAAGCTGCTGCATTTGGGTGAC
CGAGTCATTGCTACTGGCGCCATCAGCTTCAAGGCTAAGCTGTTTGGCGAACAAAAGGCAAAGTTTGCGCCCATT
CCCGTCCTCAAGAACTGTCTGGCGCAGGTCAAAGGAGAGGGTATGTCGATTCTCCAAGACGGCACCATCAAGTTC
AATTGCGACATGTGCTTTACCAATTACATCACTCTGCCCGCTACGGGCGAGCGCATGTCGGTTCCCCCAGAGCCA
GACTTCTTCAACACCTGGACAGGCCCCAAATTCATCACATTTTTCCAAGAGCGGGCGCGGCGGACACTTGACGGC
CTCTACGGCCACGAGGTGGATGATATCCCCATTGACTCGTATCGCATGTGCTGGGACGCATCCACGCCTACCCAC
GACTTCCTCATCGCGCCGCACCCGCACTGCCAAGGCCTCTACGTGGCGACAGGTGGCTCGTTTCATGGCTGGAAA
TTCCTGCCCGTGATTGGCGACTACGTAGCCGACATGATGCACAGCAGCCTCGATTCGGACTACGCGGACCGTTGG
GCATGGGACAAGAAGAGCCCAGATGGCCATTCTGCCAATCCTACATACCAGGTAGTCGGTGACCTGCAGGACTGG
ATCTCGTGA
Gene >OphauB2|7063
ATGGCACCTTCATATCTCATCATTGGAGCTGGCAACTTTGGCGCCGCTACTGCCCTGACACTGGCCAAGCGTGGC
TACGACAATATTACACTAGTCGACTCGGCCGATTTTCCAAATCCCAGGGCTGCTTCGCACGACGTGAACAAAATT
GTCCGCGATGACTACCCCGACCGCCTGTACATGCGCATGCTGAAGAAAGCTATGCCCAAATGGCGCCATGAGAGC
CCCTACTGTGATTTTTACCACGAGGTGGGAATGCTACGCGCCGACGGCACATCTTTTGGCCACGAGAGCATGGCA
GCCTACCGCGACATGGGCGTGGCAAATGACTCGCAGTTTCTGCCAGTGGCCGAAGTGCGCCGCCGCTGGAATGGT
GCCTTTGCAACAGCAAACTTTGACGGGCTTGACACCATTCTGTACAATCCCACCGTGGGCTTTGCAGAGGCCGAC
AAGCTTCTCGGTGCCGTGGTTGGCGAAGCCATAAGACATGGCGTCAAGTACGTGGTGGGCTCCATGAAGCACCTC
AACTTTGGCCCCGACGGCGAGTGCGTTGGCATTACGCTCGAGTCTGGCGACGTGTTTAAAGCGGACAAGATGCTA
CTCGCCACTGGGGCGCGCACTCCGGCCCTCTTGGCACAGAGCGCCCCCAACAATAAGCTGCTGCATTTGGGTGAC
CGAGTCATTGCTACTGGCGCCATCAGCTTCAAGGCTAAGCTGTTTGGCGAACAAAAGGCAAAGTTTGCGCCCATT
CCCGTCCTCAAGAACTGTCTGGCGCAGGTCAAAGGTAAGGAGACCATGTCGGCGAGCCTGCTGCTCCCCTGAATG
TTGGCTGACTAGCTGTGGTGCAGGAGAGGGTATGTCGATTCTCCAAGACGGCACCATCAAGTTCAATTGCGACAT
GTGCTTTACCAATTACATCACTCTGCCCGCTACGGGCGAGCGCATGTCGGTTCCCCCAGAGCCAGACTTCTTCAA
CACCTGGACAGGCCCCAAATTCATCACATTTTTCCAAGAGCGGGCGCGGCGGACACTTGACGGCCTCTACGGCCA
CGAGGTGGATGATATCCCCATTGACTCGTATCGCATGTGCTGGTGAGTTTGCTGGTCCCTGGCTCTGCCGTGTCC
TTGGATCCAACCCTGCCCAATTCGGGCTTTGCTCGGCCAATCGCTGACTTTGGGCGCTGCCTGGTAGGGACGCAT
CCACGCCTACCCACGACTTCCTCATCGCGCCGCACCCGCACTGCCAAGGCCTCTACGTGGCGACAGGTGGCTCGT
TTCATGGCTGGAAATTCCTGCCCGTGATTGGCGACTACGTAGCCGACATGATGCACAGCAGCCTCGATTCGGACT
ACGCGGACCGTTGGGCATGGGACAAGAAGAGCCCAGATGGCCATTCTGCCAATCCTACATACCAGGTAGTCGGTG
ACCTGCAGGACTGGATCTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail