Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7053
Gene name
LocationContig_7:274970..281789
Strand+
Gene length (bp)6819
Transcript length (bp)6324
Coding sequence length (bp)6324
Protein length (aa) 2108

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04054 Not1 CCR4-Not complex component, Not1 1.4E-127 1742 2103
PF16415 CNOT1_CAF1_bind CCR4-NOT transcription complex subunit 1 CAF1-binding domain 3.8E-88 919 1136
PF12842 DUF3819 CCR4-Not complex, Not1 subunit, domain of unknown function DUF3819 1.9E-45 1198 1337
PF16417 CNOT1_TTP_bind CCR4-NOT transcription complex subunit 1 TTP binding domain 7.9E-40 716 850
PF16418 CNOT1_HEAT CCR4-NOT transcription complex subunit 1 HEAT repeat 9.8E-37 516 663

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87112|NOT1_SCHPO General negative regulator of transcription subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=not1 PE=1 SV=1 20 2103 0.0E+00
sp|Q6ZQ08|CNOT1_MOUSE CCR4-NOT transcription complex subunit 1 OS=Mus musculus GN=Cnot1 PE=1 SV=2 720 1438 1.0E-89
sp|A5YKK6|CNOT1_HUMAN CCR4-NOT transcription complex subunit 1 OS=Homo sapiens GN=CNOT1 PE=1 SV=2 720 1438 2.0E-89
sp|A1A5H6|CNOT1_DANRE CCR4-NOT transcription complex subunit 1 OS=Danio rerio GN=cnot1 PE=2 SV=1 720 1383 2.0E-85
sp|P25655|NOT1_YEAST General negative regulator of transcription subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC39 PE=1 SV=3 630 1136 7.0E-75
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87112|NOT1_SCHPO General negative regulator of transcription subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=not1 PE=1 SV=1 20 2103 0.0E+00
sp|Q6ZQ08|CNOT1_MOUSE CCR4-NOT transcription complex subunit 1 OS=Mus musculus GN=Cnot1 PE=1 SV=2 720 1438 1.0E-89
sp|A5YKK6|CNOT1_HUMAN CCR4-NOT transcription complex subunit 1 OS=Homo sapiens GN=CNOT1 PE=1 SV=2 720 1438 2.0E-89
sp|A1A5H6|CNOT1_DANRE CCR4-NOT transcription complex subunit 1 OS=Danio rerio GN=cnot1 PE=2 SV=1 720 1383 2.0E-85
sp|P25655|NOT1_YEAST General negative regulator of transcription subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC39 PE=1 SV=3 630 1136 7.0E-75
sp|P25655|NOT1_YEAST General negative regulator of transcription subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC39 PE=1 SV=3 1192 2096 4.0E-74
sp|A0JP85|CNOT1_XENTR CCR4-NOT transcription complex subunit 1 OS=Xenopus tropicalis GN=cnot1 PE=2 SV=1 720 1128 4.0E-62
sp|A1A5H6|CNOT1_DANRE CCR4-NOT transcription complex subunit 1 OS=Danio rerio GN=cnot1 PE=2 SV=1 1636 2105 3.0E-57
sp|A0JP85|CNOT1_XENTR CCR4-NOT transcription complex subunit 1 OS=Xenopus tropicalis GN=cnot1 PE=2 SV=1 1636 2105 1.0E-56
sp|Q6ZQ08|CNOT1_MOUSE CCR4-NOT transcription complex subunit 1 OS=Mus musculus GN=Cnot1 PE=1 SV=2 1636 2105 2.0E-56
sp|A5YKK6|CNOT1_HUMAN CCR4-NOT transcription complex subunit 1 OS=Homo sapiens GN=CNOT1 PE=1 SV=2 1636 2105 2.0E-56
sp|A0JP85|CNOT1_XENTR CCR4-NOT transcription complex subunit 1 OS=Xenopus tropicalis GN=cnot1 PE=2 SV=1 1176 1383 1.0E-22
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
CCR4-Not complex component, Not1

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7053
MVPPPRAGSFSPNPAQTLQTGTGHSPHPSHAGLLSAGASPSTSSPTGTNSLTKIVVAQVYLLLSTIKEDKDRDKW
EVQVDQLRKLIDDHGMEVFAKYFTRLVAGNAPQIFPGLNRPVANPGNYHILVAEMRKIAHVADQASKIAESIESG
TEDIFRDFDLSTFMEHFKLDALEKTILALAFKTGSRPDLKTKADAILSTNFQSFIDIMSRPELDTHSDVAPAFVA
LIVDRILQYHPPSFNLSSRRDLHTYVSRRYISNDQAPPSEVLAALDVGRVLADRPPNALARYIQKTGADFTRNEE
TCVSYLQNRPSNLQLGPDQVAAALTYATISQTPPHDPSVLIAALQRIFPRTFDWNAVVLSFDQPSARISSSQFLR
LYQALLLIAQDQKPNFDIQKLWGGSWSEPEAQLSFVSAYASLTPDELDATTIPGLQRSISIQDYADSPPNVQERA
AVAVRHPLVSVAALSSIFNVALNSHHASQTVEAKRLFQEVVVPNLDIFLVSAFDVPRESWAPMAVDTLNSLFENF
FYKRSPEYDFVFDTLWRKDRDWIIQHLIDAHAFKPMDLTLVFEHAVKHGWLDDLVYLPNGFGLDLAAYAHAEGQL
DLANWARFHADRNVEMARTLLQFLMIKTNQEIEFQRPTDGQPPVKKSASLQVRTVSALLQILEDFLPKAPVQDLI
LVQRHCITAYPRLINYGEGYDAIIDAAGKDGNALPQAAVIKMEEHYKKMYGDELQVRTIVDILDRYKRSQDPLDQ
DAFACMIHGLFDEYHHYVDYPLEALATTAVLFGGIISHKLISDLPLKIGLGMILEAVRDHLPDAPMYKFGLQALM
QLLARFREWPGFCKQLLQIPGLQGTEAFKKAEEVVRDHEDEMARSRNGSGTPHGLNFSSEVFANGSPDEPALTER
QAPPFTAINVDPVPPGADFEEPGEEEQGKIQFVLNNITEGTIQSMQNELRDTLERKHQQWFASHLVEERAKMQPN
YHKVYLDLVKLFEDKSLWNEVLRETYVSVARMLNSEVTLQNSTERTQLKNLGGWLGLLTLARNKPIKHKNIAFKQ
LLIEAHETKRLIVAIPFVCKVLLQGASSAVFRSPNPWLMDIIRLLIELYHHAELKLNLKFEIEVLCKGLSIDHRT
IQPTGEILNRPLAEAAAQILAQDQLDVFENLSLNGIGSVVGPSLGQTMEPSIPDLGPLISIPPTNEMVVSAARLH
EIVQSALTRALTDIIQPVVDRSITIAAISTGQMVRKDFVSEPDENRVRASAINMVKATAGSLALVTSKEPLRANL
TNYMRILANDLPSGLPEGTVIMCVNLNLDLACSVIEKQAEERAVPEIEDLLEEDFAVRRRHRMQHPNEAFYAGTV
NRWAMTIPHPFKLSPSMHGLNPEQMAIYDDFARQPRNVGVSTASHAPSTSDATRSLANEVLQEPYSTVPNLPTPA
ETPSVQHLGSQLQSYAPVHAAATSTSLTSSRPAGFQMEFHNLGERVNKLLQELIRVAGEAREEHFAGLPRPHPVL
DVVDALVQLIIKTSQNSEEFSIYTAEQISALIFQQVEDNLALESLVHVLETHGPNFLSLPLLAALAIESRKEGSL
DFLDHMLDLTLVNNRPVVLFTDFPRTFEASWNWITNNPGSPAAQRLRSKLTGQVSQQGLYADDGDDLSLRREQME
YVFEEWVHLCSNVKLISGREDLLLFIRVATELCVDRFDHIMHSGTTSDAYLMTDALARAISLFICKLDEGSTSRS
SLFDSTLALIALIFNHNITDEDHQSMLQKFAFRLETMGPLRYPGFTFAWLSLIQHRAFLPVLLRMPENAGWGPFV
KLLSHLLHSLGDQLKPITVSPVTKDIYRATLKLLVVLQHDFPEFVAAHHIRLCSMIPPHCAQLLNAVLAATPQQS
RGKLPDPMHPGLKVDLMREMKAQPLLLDEASAILRDCGLLELVDQALQNGPAEETVAQIAHTMTHSVPKETSYGF
VTVEANTQVIGAVVVHIGQQASEARAEAPSSPAIMGTEPGVSMLSLLVHELPPGARYYLLSSMINQLRFPNGHTD
YFSRVLLHMFGHDLNDPEESEIRQEMTRVFLERLVGFWPQPWGLMFTVLELIKNEKYRFFDLPFIKSTPEVAERF
AAILQRS*
Coding >OphauB2|7053
ATGGTCCCTCCACCTCGCGCGGGATCCTTCTCACCAAATCCTGCACAGACTCTTCAGACGGGAACCGGTCACTCG
CCTCATCCATCTCACGCTGGTCTCCTCAGTGCTGGCGCCAGTCCCAGTACGAGCAGTCCGACTGGGACGAACTCG
CTGACAAAAATTGTTGTCGCTCAAGTCTACCTTCTGCTCAGCACCATCAAGGAGGACAAGGACCGCGACAAGTGG
GAAGTCCAGGTCGATCAGCTAAGAAAGCTCATCGATGATCACGGTATGGAAGTCTTTGCCAAATACTTTACCAGA
CTGGTAGCAGGAAATGCGCCGCAAATTTTCCCAGGTCTCAACCGCCCAGTTGCAAACCCTGGAAACTACCACATC
CTCGTGGCCGAGATGCGCAAGATAGCACATGTCGCCGATCAAGCGAGCAAGATTGCCGAGTCGATCGAAAGCGGT
ACCGAGGACATTTTTCGCGATTTTGATCTCTCGACATTTATGGAGCATTTTAAACTTGACGCACTCGAGAAGACT
ATTCTTGCGCTAGCATTCAAGACGGGTTCACGCCCCGATTTGAAGACCAAAGCCGATGCCATTTTATCCACCAAC
TTTCAAAGCTTCATTGATATCATGTCGCGCCCAGAACTGGACACGCACTCCGATGTCGCTCCCGCTTTTGTCGCC
TTGATTGTTGATCGAATCCTGCAATATCATCCCCCGAGCTTCAACCTTTCATCCCGCCGCGACTTGCATACATAT
GTCTCTCGACGGTACATATCAAATGATCAGGCGCCACCATCCGAGGTGCTGGCCGCTCTCGACGTAGGCAGAGTC
TTGGCCGATCGGCCTCCCAACGCCCTGGCTCGGTATATTCAAAAAACGGGTGCCGACTTTACTCGCAACGAAGAG
ACCTGCGTGTCCTATCTGCAGAATCGTCCAAGCAATTTGCAGCTGGGGCCTGATCAGGTAGCTGCCGCTCTTACC
TATGCCACCATCTCGCAGACTCCGCCACACGACCCTTCAGTCTTGATTGCTGCCCTACAGCGTATATTTCCTCGG
ACGTTTGATTGGAATGCGGTGGTGCTCTCTTTTGACCAGCCATCGGCTCGAATATCATCCTCTCAATTTCTGCGC
CTGTACCAGGCACTTCTGCTAATAGCCCAGGATCAGAAGCCCAATTTCGACATTCAGAAGTTATGGGGCGGCTCA
TGGAGTGAGCCCGAGGCACAGCTGTCCTTTGTGAGCGCATACGCTTCTCTAACTCCAGACGAGCTGGATGCAACA
ACAATTCCGGGACTGCAACGAAGCATTAGCATTCAAGACTACGCCGATTCTCCTCCTAACGTGCAGGAACGCGCT
GCTGTTGCCGTACGACATCCGCTAGTCTCTGTTGCCGCTCTGTCATCAATCTTCAACGTCGCTCTCAACTCCCAT
CACGCATCCCAAACGGTCGAAGCCAAGCGCCTGTTTCAAGAGGTGGTTGTGCCTAATCTTGACATATTTCTTGTC
TCAGCTTTCGACGTGCCTCGAGAGTCATGGGCACCCATGGCTGTCGATACGCTCAACTCCCTGTTTGAAAACTTT
TTCTACAAGAGGTCGCCAGAGTACGATTTTGTGTTTGATACCCTGTGGAGAAAAGACCGAGACTGGATCATTCAG
CACTTGATTGATGCCCACGCTTTCAAGCCAATGGATCTGACGCTTGTTTTTGAACATGCTGTCAAACATGGCTGG
CTGGACGACCTGGTCTATCTTCCAAATGGCTTCGGCCTTGATCTTGCAGCTTATGCTCACGCCGAGGGCCAACTC
GATTTGGCCAACTGGGCTCGTTTTCATGCAGATCGAAATGTCGAAATGGCGCGTACTTTACTGCAGTTTCTCATG
ATCAAGACAAACCAGGAGATTGAGTTTCAACGCCCCACGGACGGACAGCCCCCAGTCAAAAAGAGCGCTAGCCTA
CAAGTTCGTACGGTATCGGCCTTGCTACAAATCCTCGAGGACTTTCTGCCAAAAGCGCCTGTGCAAGACCTCATC
CTGGTTCAGCGCCACTGCATTACCGCTTATCCGCGCCTCATTAATTACGGAGAAGGGTATGATGCCATTATTGAT
GCTGCTGGCAAGGACGGAAATGCCCTGCCGCAAGCTGCCGTCATCAAGATGGAGGAACACTACAAGAAGATGTAT
GGCGACGAACTTCAAGTACGCACCATTGTGGACATATTGGACCGGTATAAGCGCTCTCAAGACCCACTAGATCAA
GATGCGTTCGCGTGCATGATTCACGGCCTGTTCGATGAATATCACCATTACGTGGACTACCCGCTGGAGGCGCTG
GCAACAACAGCCGTCCTGTTTGGTGGTATCATATCGCACAAGCTCATTTCAGACTTGCCGCTGAAGATTGGCTTG
GGCATGATACTCGAAGCGGTGCGCGATCATCTGCCAGACGCCCCCATGTACAAATTTGGTCTCCAGGCTTTGATG
CAGCTTCTAGCTCGCTTCAGAGAGTGGCCTGGCTTCTGCAAACAACTCCTACAAATTCCTGGCTTGCAGGGCACA
GAGGCCTTCAAGAAAGCAGAAGAGGTTGTTCGAGACCACGAAGACGAAATGGCCCGGTCTCGAAACGGCTCGGGT
ACGCCTCACGGCCTCAACTTTTCGAGCGAGGTCTTTGCCAATGGAAGTCCTGACGAACCTGCCTTGACCGAACGC
CAAGCCCCGCCTTTTACTGCCATTAATGTTGATCCCGTCCCTCCGGGCGCTGACTTTGAGGAGCCTGGCGAAGAA
GAGCAGGGCAAGATTCAGTTTGTGCTCAACAACATCACCGAAGGAACAATTCAGTCAATGCAAAATGAGTTGCGT
GACACACTGGAGCGGAAACACCAGCAGTGGTTTGCAAGCCACCTGGTGGAAGAGCGTGCCAAGATGCAACCCAAT
TATCACAAGGTTTATCTGGACCTTGTAAAGCTGTTCGAGGACAAGAGCCTCTGGAATGAGGTTCTTCGGGAAACA
TATGTTAGTGTGGCGAGAATGCTCAACTCGGAGGTGACGCTGCAAAATTCGACAGAGCGGACTCAGCTTAAAAAT
CTCGGCGGGTGGTTGGGCCTTTTGACGCTGGCTCGAAACAAGCCCATCAAACACAAGAATATTGCTTTCAAGCAG
CTATTGATCGAGGCGCATGAGACCAAGCGGCTCATTGTTGCCATACCGTTTGTTTGCAAGGTTCTTCTCCAGGGA
GCCAGTTCAGCCGTCTTTCGGTCGCCCAATCCCTGGCTCATGGACATCATACGTCTTCTCATTGAGCTCTATCAT
CATGCCGAGCTAAAGCTCAATTTGAAATTCGAAATCGAAGTGCTCTGCAAAGGGCTAAGCATTGATCACAGGACA
ATTCAACCCACTGGAGAAATATTGAACCGACCGCTGGCAGAAGCGGCAGCTCAAATCCTGGCTCAAGACCAGCTG
GACGTGTTTGAAAATCTATCTCTTAACGGCATTGGATCGGTTGTTGGCCCTAGCCTGGGCCAAACGATGGAGCCA
AGCATTCCCGATCTCGGACCGCTCATCAGCATTCCGCCTACAAATGAAATGGTTGTCAGCGCAGCACGCTTGCAT
GAAATCGTGCAAAGCGCCCTGACGCGAGCCCTGACGGATATTATCCAGCCAGTGGTTGACCGATCAATTACAATT
GCGGCCATCTCAACAGGGCAGATGGTGCGCAAAGACTTTGTTTCGGAACCCGATGAAAATCGAGTGCGCGCGTCA
GCCATCAACATGGTCAAGGCTACAGCAGGGAGTCTTGCTCTTGTTACTTCCAAGGAGCCCCTGAGAGCAAACTTG
ACCAACTACATGCGCATTCTGGCCAACGATCTGCCTTCTGGTCTCCCCGAAGGGACAGTGATAATGTGTGTCAAC
TTGAACCTAGATTTGGCTTGCAGCGTGATTGAGAAGCAGGCGGAAGAAAGAGCGGTGCCGGAAATCGAAGACCTG
CTGGAGGAAGACTTTGCGGTTCGAAGACGTCATCGTATGCAGCACCCCAATGAGGCTTTTTACGCTGGCACTGTC
AACCGCTGGGCAATGACGATTCCTCATCCCTTTAAGCTTTCGCCCAGCATGCATGGCCTGAACCCCGAGCAAATG
GCCATTTATGATGACTTTGCTCGTCAGCCGCGCAATGTTGGTGTTTCAACGGCGTCGCACGCGCCATCAACATCG
GACGCGACGCGATCTCTTGCCAATGAGGTGCTGCAGGAACCTTATAGCACTGTGCCCAATTTGCCCACGCCCGCC
GAAACGCCCTCTGTTCAGCACCTCGGGTCGCAGCTGCAGTCGTACGCGCCTGTGCACGCCGCCGCGACTTCGACT
TCACTGACGAGCTCGCGCCCCGCAGGCTTCCAAATGGAGTTTCATAACTTGGGCGAGCGCGTCAATAAGCTGCTT
CAGGAGCTTATACGCGTCGCTGGCGAGGCAAGAGAGGAGCATTTTGCCGGGCTGCCCAGGCCCCATCCGGTTCTC
GATGTGGTTGATGCCTTGGTGCAGCTCATTATCAAGACGTCGCAAAACTCTGAAGAGTTCTCCATCTACACGGCT
GAGCAAATAAGCGCTCTCATCTTCCAGCAAGTCGAGGACAACCTTGCCCTCGAGAGCCTCGTCCATGTCTTGGAA
ACTCATGGTCCCAACTTCCTTAGTCTGCCCCTCTTGGCCGCGCTGGCTATCGAGTCTCGCAAAGAGGGATCACTC
GACTTTCTTGACCACATGCTTGATCTCACTCTTGTCAACAACCGCCCTGTTGTCCTCTTCACCGACTTTCCACGG
ACATTTGAAGCATCATGGAACTGGATCACCAACAACCCCGGCTCTCCTGCTGCTCAGCGCCTGAGGAGCAAGCTC
ACGGGTCAGGTTTCACAACAAGGGCTCTATGCAGACGACGGCGATGACCTGTCTCTACGTCGAGAGCAGATGGAA
TACGTCTTTGAGGAATGGGTACATCTCTGCAGCAACGTCAAGCTTATTAGCGGCCGGGAAGACTTGTTGCTCTTT
ATACGCGTTGCCACGGAACTTTGTGTGGATCGCTTTGATCACATCATGCATTCTGGCACCACTTCGGATGCCTAC
CTCATGACGGATGCCCTGGCCAGAGCCATCAGCTTGTTCATTTGCAAGCTCGACGAGGGTAGCACGTCTCGCTCC
TCTCTATTCGACTCGACTCTCGCTCTAATCGCTCTCATCTTCAACCACAATATCACAGACGAGGACCACCAAAGC
ATGCTACAAAAGTTTGCTTTTCGCCTAGAAACCATGGGGCCCCTCCGCTACCCCGGTTTTACCTTTGCTTGGCTC
TCTCTCATTCAACACCGAGCATTTCTTCCAGTGCTACTTCGTATGCCAGAAAACGCAGGTTGGGGTCCTTTTGTC
AAGCTGCTGAGCCATCTTCTCCATAGTCTGGGCGATCAACTCAAGCCCATTACTGTGTCTCCGGTGACCAAGGAC
ATCTATCGAGCAACTCTGAAACTTTTGGTTGTTCTTCAGCACGACTTTCCCGAGTTTGTTGCTGCCCATCACATC
AGACTCTGCTCCATGATTCCACCTCACTGTGCGCAACTTCTCAACGCCGTCTTGGCAGCTACTCCGCAGCAAAGC
CGTGGCAAATTGCCTGATCCCATGCATCCGGGGCTCAAGGTGGATCTCATGAGGGAAATGAAGGCACAGCCCTTG
CTTTTGGATGAAGCGTCGGCAATTTTGCGCGACTGTGGTCTACTTGAACTAGTTGATCAAGCCCTACAAAATGGA
CCAGCTGAGGAGACGGTTGCACAGATTGCTCACACCATGACTCATAGTGTTCCAAAGGAGACGAGCTACGGCTTT
GTCACGGTGGAGGCAAACACACAGGTTATTGGAGCAGTAGTGGTCCATATAGGCCAGCAGGCGTCAGAGGCGCGC
GCCGAGGCGCCGAGTTCCCCGGCAATTATGGGCACTGAGCCTGGTGTATCGATGCTGTCGCTGCTGGTCCATGAG
CTCCCGCCTGGTGCTCGCTATTATCTCTTGTCCAGCATGATCAATCAGTTGCGATTTCCCAACGGCCACACAGAT
TACTTCAGCAGAGTCTTGCTCCACATGTTTGGTCACGACTTGAATGATCCAGAAGAGTCTGAAATTCGCCAAGAG
ATGACGAGGGTTTTCCTCGAGCGCTTGGTTGGCTTTTGGCCCCAGCCTTGGGGACTGATGTTTACCGTTCTTGAG
TTGATCAAGAATGAAAAGTACAGGTTCTTTGACTTGCCATTCATCAAGTCTACGCCAGAGGTCGCTGAGAGATTT
GCCGCCATTTTGCAACGGAGCTGA
Transcript >OphauB2|7053
ATGGTCCCTCCACCTCGCGCGGGATCCTTCTCACCAAATCCTGCACAGACTCTTCAGACGGGAACCGGTCACTCG
CCTCATCCATCTCACGCTGGTCTCCTCAGTGCTGGCGCCAGTCCCAGTACGAGCAGTCCGACTGGGACGAACTCG
CTGACAAAAATTGTTGTCGCTCAAGTCTACCTTCTGCTCAGCACCATCAAGGAGGACAAGGACCGCGACAAGTGG
GAAGTCCAGGTCGATCAGCTAAGAAAGCTCATCGATGATCACGGTATGGAAGTCTTTGCCAAATACTTTACCAGA
CTGGTAGCAGGAAATGCGCCGCAAATTTTCCCAGGTCTCAACCGCCCAGTTGCAAACCCTGGAAACTACCACATC
CTCGTGGCCGAGATGCGCAAGATAGCACATGTCGCCGATCAAGCGAGCAAGATTGCCGAGTCGATCGAAAGCGGT
ACCGAGGACATTTTTCGCGATTTTGATCTCTCGACATTTATGGAGCATTTTAAACTTGACGCACTCGAGAAGACT
ATTCTTGCGCTAGCATTCAAGACGGGTTCACGCCCCGATTTGAAGACCAAAGCCGATGCCATTTTATCCACCAAC
TTTCAAAGCTTCATTGATATCATGTCGCGCCCAGAACTGGACACGCACTCCGATGTCGCTCCCGCTTTTGTCGCC
TTGATTGTTGATCGAATCCTGCAATATCATCCCCCGAGCTTCAACCTTTCATCCCGCCGCGACTTGCATACATAT
GTCTCTCGACGGTACATATCAAATGATCAGGCGCCACCATCCGAGGTGCTGGCCGCTCTCGACGTAGGCAGAGTC
TTGGCCGATCGGCCTCCCAACGCCCTGGCTCGGTATATTCAAAAAACGGGTGCCGACTTTACTCGCAACGAAGAG
ACCTGCGTGTCCTATCTGCAGAATCGTCCAAGCAATTTGCAGCTGGGGCCTGATCAGGTAGCTGCCGCTCTTACC
TATGCCACCATCTCGCAGACTCCGCCACACGACCCTTCAGTCTTGATTGCTGCCCTACAGCGTATATTTCCTCGG
ACGTTTGATTGGAATGCGGTGGTGCTCTCTTTTGACCAGCCATCGGCTCGAATATCATCCTCTCAATTTCTGCGC
CTGTACCAGGCACTTCTGCTAATAGCCCAGGATCAGAAGCCCAATTTCGACATTCAGAAGTTATGGGGCGGCTCA
TGGAGTGAGCCCGAGGCACAGCTGTCCTTTGTGAGCGCATACGCTTCTCTAACTCCAGACGAGCTGGATGCAACA
ACAATTCCGGGACTGCAACGAAGCATTAGCATTCAAGACTACGCCGATTCTCCTCCTAACGTGCAGGAACGCGCT
GCTGTTGCCGTACGACATCCGCTAGTCTCTGTTGCCGCTCTGTCATCAATCTTCAACGTCGCTCTCAACTCCCAT
CACGCATCCCAAACGGTCGAAGCCAAGCGCCTGTTTCAAGAGGTGGTTGTGCCTAATCTTGACATATTTCTTGTC
TCAGCTTTCGACGTGCCTCGAGAGTCATGGGCACCCATGGCTGTCGATACGCTCAACTCCCTGTTTGAAAACTTT
TTCTACAAGAGGTCGCCAGAGTACGATTTTGTGTTTGATACCCTGTGGAGAAAAGACCGAGACTGGATCATTCAG
CACTTGATTGATGCCCACGCTTTCAAGCCAATGGATCTGACGCTTGTTTTTGAACATGCTGTCAAACATGGCTGG
CTGGACGACCTGGTCTATCTTCCAAATGGCTTCGGCCTTGATCTTGCAGCTTATGCTCACGCCGAGGGCCAACTC
GATTTGGCCAACTGGGCTCGTTTTCATGCAGATCGAAATGTCGAAATGGCGCGTACTTTACTGCAGTTTCTCATG
ATCAAGACAAACCAGGAGATTGAGTTTCAACGCCCCACGGACGGACAGCCCCCAGTCAAAAAGAGCGCTAGCCTA
CAAGTTCGTACGGTATCGGCCTTGCTACAAATCCTCGAGGACTTTCTGCCAAAAGCGCCTGTGCAAGACCTCATC
CTGGTTCAGCGCCACTGCATTACCGCTTATCCGCGCCTCATTAATTACGGAGAAGGGTATGATGCCATTATTGAT
GCTGCTGGCAAGGACGGAAATGCCCTGCCGCAAGCTGCCGTCATCAAGATGGAGGAACACTACAAGAAGATGTAT
GGCGACGAACTTCAAGTACGCACCATTGTGGACATATTGGACCGGTATAAGCGCTCTCAAGACCCACTAGATCAA
GATGCGTTCGCGTGCATGATTCACGGCCTGTTCGATGAATATCACCATTACGTGGACTACCCGCTGGAGGCGCTG
GCAACAACAGCCGTCCTGTTTGGTGGTATCATATCGCACAAGCTCATTTCAGACTTGCCGCTGAAGATTGGCTTG
GGCATGATACTCGAAGCGGTGCGCGATCATCTGCCAGACGCCCCCATGTACAAATTTGGTCTCCAGGCTTTGATG
CAGCTTCTAGCTCGCTTCAGAGAGTGGCCTGGCTTCTGCAAACAACTCCTACAAATTCCTGGCTTGCAGGGCACA
GAGGCCTTCAAGAAAGCAGAAGAGGTTGTTCGAGACCACGAAGACGAAATGGCCCGGTCTCGAAACGGCTCGGGT
ACGCCTCACGGCCTCAACTTTTCGAGCGAGGTCTTTGCCAATGGAAGTCCTGACGAACCTGCCTTGACCGAACGC
CAAGCCCCGCCTTTTACTGCCATTAATGTTGATCCCGTCCCTCCGGGCGCTGACTTTGAGGAGCCTGGCGAAGAA
GAGCAGGGCAAGATTCAGTTTGTGCTCAACAACATCACCGAAGGAACAATTCAGTCAATGCAAAATGAGTTGCGT
GACACACTGGAGCGGAAACACCAGCAGTGGTTTGCAAGCCACCTGGTGGAAGAGCGTGCCAAGATGCAACCCAAT
TATCACAAGGTTTATCTGGACCTTGTAAAGCTGTTCGAGGACAAGAGCCTCTGGAATGAGGTTCTTCGGGAAACA
TATGTTAGTGTGGCGAGAATGCTCAACTCGGAGGTGACGCTGCAAAATTCGACAGAGCGGACTCAGCTTAAAAAT
CTCGGCGGGTGGTTGGGCCTTTTGACGCTGGCTCGAAACAAGCCCATCAAACACAAGAATATTGCTTTCAAGCAG
CTATTGATCGAGGCGCATGAGACCAAGCGGCTCATTGTTGCCATACCGTTTGTTTGCAAGGTTCTTCTCCAGGGA
GCCAGTTCAGCCGTCTTTCGGTCGCCCAATCCCTGGCTCATGGACATCATACGTCTTCTCATTGAGCTCTATCAT
CATGCCGAGCTAAAGCTCAATTTGAAATTCGAAATCGAAGTGCTCTGCAAAGGGCTAAGCATTGATCACAGGACA
ATTCAACCCACTGGAGAAATATTGAACCGACCGCTGGCAGAAGCGGCAGCTCAAATCCTGGCTCAAGACCAGCTG
GACGTGTTTGAAAATCTATCTCTTAACGGCATTGGATCGGTTGTTGGCCCTAGCCTGGGCCAAACGATGGAGCCA
AGCATTCCCGATCTCGGACCGCTCATCAGCATTCCGCCTACAAATGAAATGGTTGTCAGCGCAGCACGCTTGCAT
GAAATCGTGCAAAGCGCCCTGACGCGAGCCCTGACGGATATTATCCAGCCAGTGGTTGACCGATCAATTACAATT
GCGGCCATCTCAACAGGGCAGATGGTGCGCAAAGACTTTGTTTCGGAACCCGATGAAAATCGAGTGCGCGCGTCA
GCCATCAACATGGTCAAGGCTACAGCAGGGAGTCTTGCTCTTGTTACTTCCAAGGAGCCCCTGAGAGCAAACTTG
ACCAACTACATGCGCATTCTGGCCAACGATCTGCCTTCTGGTCTCCCCGAAGGGACAGTGATAATGTGTGTCAAC
TTGAACCTAGATTTGGCTTGCAGCGTGATTGAGAAGCAGGCGGAAGAAAGAGCGGTGCCGGAAATCGAAGACCTG
CTGGAGGAAGACTTTGCGGTTCGAAGACGTCATCGTATGCAGCACCCCAATGAGGCTTTTTACGCTGGCACTGTC
AACCGCTGGGCAATGACGATTCCTCATCCCTTTAAGCTTTCGCCCAGCATGCATGGCCTGAACCCCGAGCAAATG
GCCATTTATGATGACTTTGCTCGTCAGCCGCGCAATGTTGGTGTTTCAACGGCGTCGCACGCGCCATCAACATCG
GACGCGACGCGATCTCTTGCCAATGAGGTGCTGCAGGAACCTTATAGCACTGTGCCCAATTTGCCCACGCCCGCC
GAAACGCCCTCTGTTCAGCACCTCGGGTCGCAGCTGCAGTCGTACGCGCCTGTGCACGCCGCCGCGACTTCGACT
TCACTGACGAGCTCGCGCCCCGCAGGCTTCCAAATGGAGTTTCATAACTTGGGCGAGCGCGTCAATAAGCTGCTT
CAGGAGCTTATACGCGTCGCTGGCGAGGCAAGAGAGGAGCATTTTGCCGGGCTGCCCAGGCCCCATCCGGTTCTC
GATGTGGTTGATGCCTTGGTGCAGCTCATTATCAAGACGTCGCAAAACTCTGAAGAGTTCTCCATCTACACGGCT
GAGCAAATAAGCGCTCTCATCTTCCAGCAAGTCGAGGACAACCTTGCCCTCGAGAGCCTCGTCCATGTCTTGGAA
ACTCATGGTCCCAACTTCCTTAGTCTGCCCCTCTTGGCCGCGCTGGCTATCGAGTCTCGCAAAGAGGGATCACTC
GACTTTCTTGACCACATGCTTGATCTCACTCTTGTCAACAACCGCCCTGTTGTCCTCTTCACCGACTTTCCACGG
ACATTTGAAGCATCATGGAACTGGATCACCAACAACCCCGGCTCTCCTGCTGCTCAGCGCCTGAGGAGCAAGCTC
ACGGGTCAGGTTTCACAACAAGGGCTCTATGCAGACGACGGCGATGACCTGTCTCTACGTCGAGAGCAGATGGAA
TACGTCTTTGAGGAATGGGTACATCTCTGCAGCAACGTCAAGCTTATTAGCGGCCGGGAAGACTTGTTGCTCTTT
ATACGCGTTGCCACGGAACTTTGTGTGGATCGCTTTGATCACATCATGCATTCTGGCACCACTTCGGATGCCTAC
CTCATGACGGATGCCCTGGCCAGAGCCATCAGCTTGTTCATTTGCAAGCTCGACGAGGGTAGCACGTCTCGCTCC
TCTCTATTCGACTCGACTCTCGCTCTAATCGCTCTCATCTTCAACCACAATATCACAGACGAGGACCACCAAAGC
ATGCTACAAAAGTTTGCTTTTCGCCTAGAAACCATGGGGCCCCTCCGCTACCCCGGTTTTACCTTTGCTTGGCTC
TCTCTCATTCAACACCGAGCATTTCTTCCAGTGCTACTTCGTATGCCAGAAAACGCAGGTTGGGGTCCTTTTGTC
AAGCTGCTGAGCCATCTTCTCCATAGTCTGGGCGATCAACTCAAGCCCATTACTGTGTCTCCGGTGACCAAGGAC
ATCTATCGAGCAACTCTGAAACTTTTGGTTGTTCTTCAGCACGACTTTCCCGAGTTTGTTGCTGCCCATCACATC
AGACTCTGCTCCATGATTCCACCTCACTGTGCGCAACTTCTCAACGCCGTCTTGGCAGCTACTCCGCAGCAAAGC
CGTGGCAAATTGCCTGATCCCATGCATCCGGGGCTCAAGGTGGATCTCATGAGGGAAATGAAGGCACAGCCCTTG
CTTTTGGATGAAGCGTCGGCAATTTTGCGCGACTGTGGTCTACTTGAACTAGTTGATCAAGCCCTACAAAATGGA
CCAGCTGAGGAGACGGTTGCACAGATTGCTCACACCATGACTCATAGTGTTCCAAAGGAGACGAGCTACGGCTTT
GTCACGGTGGAGGCAAACACACAGGTTATTGGAGCAGTAGTGGTCCATATAGGCCAGCAGGCGTCAGAGGCGCGC
GCCGAGGCGCCGAGTTCCCCGGCAATTATGGGCACTGAGCCTGGTGTATCGATGCTGTCGCTGCTGGTCCATGAG
CTCCCGCCTGGTGCTCGCTATTATCTCTTGTCCAGCATGATCAATCAGTTGCGATTTCCCAACGGCCACACAGAT
TACTTCAGCAGAGTCTTGCTCCACATGTTTGGTCACGACTTGAATGATCCAGAAGAGTCTGAAATTCGCCAAGAG
ATGACGAGGGTTTTCCTCGAGCGCTTGGTTGGCTTTTGGCCCCAGCCTTGGGGACTGATGTTTACCGTTCTTGAG
TTGATCAAGAATGAAAAGTACAGGTTCTTTGACTTGCCATTCATCAAGTCTACGCCAGAGGTCGCTGAGAGATTT
GCCGCCATTTTGCAACGGAGCTGA
Gene >OphauB2|7053
ATGGTCCCTCCACCTCGCGCGGGATCCTTCTCACCAAATCCTGCACAGACTCTTCAGACGGGAACCGGTCACTCG
CCTCATCCATCTCACGCTGGTCTCCTCAGTGCTGGCGCCAGTCCCAGTACGAGCAGTCCGACTGGGACGAACTCG
CTGACAAAAATTGTTGTCGCTCAAGTCTACCTTCTGCTCAGCACCATCAAGGAGGACAAGGACCGCGACAAGTGG
GAAGTCCAGGTCGATCAGCTAAGAAAGGTCCAGGACCACCACCATCACCGCATTCATCGTCTTTATCCCTCCACA
TTACTAGTATGCTCGCCTGCTAACTTGCTGCTACCTCAAGCTCATCGATGATCACGGTATGGAAGTCTTTGCCAA
ATACTTTACCAGACTGGTAGCAGGAAATGCGCCGCAAATTTTCCCAGGTCTCAACCGCCCAGTTGCAAACCCTGG
AAACTACCACATCCTCGTGGCCGAGATGCGCAAGATAGCACATGTCGCCGATCAAGCGAGCAAGATTGCCGAGTC
GATCGAAAGCGGTACCGAGGACATTTTTCGCGATTTTGATCTCTCGACATTTATGGAGCATTTTAAACTTGACGC
ACTCGAGAAGACTATTCTTGCGCTAGCATTCAAGACGGGTTCACGCCCCGATTTGAAGACCAAAGGTAGGCGGTT
TCTTACCATCCCACTGTTCCCGACTATTTACTTGTGCACGTCTGATCCACCCCCCTCGATGCAGCCGATGCCATT
TTATCCACCAACTTTCAAAGCTTCATTGATATCATGTCGCGCCCAGAACTGGACACGCACTCCGATGTCGCTCCC
GCTTTTGTCGCCTTGATTGTTGATCGAATCCTGCAATATCATCCCCCGAGCTTCAACCTTTCATCCCGCCGCGAC
TTGCATACATATGTCTCTCGACGGTACATATCAAATGATCAGGCGCCACCATCCGAGGTGCTGGCCGCTCTCGAC
GTAGGCAGAGTCTTGGCCGATCGGCCTCCCAACGCCCTGGCTCGGTATATTCAAAAAACGGGTGCCGACTTTACT
CGCAACGAAGAGACCTGCGTGTCCTATCTGCAGAATCGTCCAAGCAATTTGCAGCTGGGGCCTGATCAGGTAGCT
GCCGCTCTTACCTATGCCACCATCTCGCAGACTCCGCCACACGACCCTTCAGTCTTGATTGCTGCCCTACAGCGT
ATATTTCCTCGGACGTTTGATTGGAATGCGGTGGTGCTCTCTTTTGACCAGCCATCGGCTCGAATATCATCCTCT
CAATTTCTGCGCCTGTACCAGGCACTTCTGCTAATAGCCCAGGATCAGAAGCCCAATTTCGACATTCAGAAGTTA
TGGGGCGGCTCATGGAGTGAGCCCGAGGCACAGCTGTCCTTTGTGAGCGCATACGCTTCTCTAACTCCAGACGAG
CTGGATGCAACAACAATTCCGGGACTGCAACGAAGCATTAGCATTCAAGACTACGCCGATTCTCCTCCTAACGTG
CAGGAACGCGCTGCTGTTGCCGTACGACATCCGCTAGTCTCTGTTGCCGCTCTGTCATCAATCTTCAACGTCGCT
CTCAACTCCCATCACGCATCCCAAACGGTCGAAGCCAAGCGCCTGTTTCAAGAGGTGGTTGTGCCTAATCTTGAC
ATATTTCTTGTCTCAGCTTTCGACGTGCCTCGAGAGTCATGGGCACCCATGGCTGTCGATACGCTCAACTCCCTG
TTTGAAAACTTTTTCTACAAGAGGTCGCCAGAGTACGATTTTGTGTTTGATACCCTGTGGAGAAAAGACCGAGAC
TGGATCATTCAGCACTTGATTGATGCCCACGCTTTCAAGCCAATGGATCTGACGCTTGTTTTTGAACATGCTGTC
AAACATGGCTGGCTGGACGACCTGGTCTATCTTCCAAATGGCTTCGGCCTTGATCTTGCAGCTTATGCTCACGCC
GAGGGCCAACTCGATTTGGCCAACTGGGCTCGTTTTCATGCAGATCGAAATGTCGAAATGGCGCGTACTTTACTG
CAGTTTCTCATGATCAAGACAAACCAGGAGATTGAGTTTCAACGCCCCACGGACGGACAGCCCCCAGTCAAAAAG
AGCGCTAGCCTACAAGTTCGTACGGTATCGGCCTTGCTACAAATCCTCGAGGACTTTCTGCCAAAAGCGCCTGTG
CAAGACCTCATCCTGGTTCAGCGCCACTGCATTACCGCTTATCCGCGCCTCATTAATTACGGAGAAGGGTATGAT
GCCATTATTGATGCTGCTGGCAAGGACGGAAATGCCCTGCCGCAAGCTGCCGTCATCAAGATGGAGGAACACTAC
AAGAAGATGTATGGCGACGAACTTCAAGTACGCACCATTGTGGACATATTGGACCGGTATAAGCGCTCTCAAGAC
CCACTAGATCAAGATGCGTTCGCGTGCATGATTCACGGCCTGTTCGATGAATATCACCATTACGTGGACTACCCG
CTGGAGGCGCTGGCAACAACAGCCGTCCTGTTTGGTGGTATCATATCGCACAAGCTCATTTCAGACTTGCCGCTG
AAGATTGGCTTGGGCATGATACTCGAAGCGGTGCGCGATCATCTGCCAGACGCCCCCATGTACAAATTTGGTCTC
CAGGCTTTGATGCAGCTTCTAGCTCGCTTCAGAGAGTGGCCTGGCTTCTGCAAACAACTCCTACAAATTCCTGGC
TTGCAGGGCACAGAGGCCTTCAAGAAAGCAGAAGAGGTTGTTCGAGACCACGAAGACGAAATGGCCCGGTCTCGA
AACGGCTCGGGTACGCCTCACGGCCTCAACTTTTCGAGCGAGGTCTTTGCCAATGGAAGTCCTGACGAACCTGCC
TTGACCGAACGCCAAGCCCCGCCTTTTACTGCCATTAATGTTGATCCCGTCCCTCCGGGCGCTGACTTTGAGGAG
CCTGGCGAAGAAGAGCAGGGCAAGATTCAGTTTGTGCTCAACAACATCACCGAAGGAACAATTCAGTCAATGCAA
AATGAGTTGCGTGACACACTGGAGCGGAAACACCAGCAGTGGTTTGCAAGCCACCTGGTGGAAGAGCGTGCCAAG
ATGCAACCCAATTATCACAAGGTTTATCTGGACCTTGTAAAGCTGTTCGAGGACAAGAGCCTCTGGAATGAGGTT
CTTCGGGAAACATATGTTAGTGTGGCGAGAATGCTCAACTCGGAGGTGACGCTGCAAAATTCGACAGAGCGGACT
CAGCTTAAAAATCTCGGCGGGTGGTTGGGCCTTTTGACGCTGGCTCGAAACAAGCCCATCAAACACAAGAATATT
GCTTTCAAGCAGCTATTGATCGAGGCGCATGAGACCAAGCGGCTCATTGTTGCCATACCGTTTGTTTGCAAGGTT
CTTCTCCAGGGAGCCAGTTCAGCCGTCTTTCGGTCGCCCAATCCCTGGCTCATGGACATCATACGTCTTCTCATT
GAGCTCTATCATCATGCCGAGCTAAAGCTCAATTTGAAATTCGAAATCGAAGTGCTCTGCAAAGGGCTAAGCATT
GATCACAGGACAATTCAACCCACTGGAGAAATATTGAACCGACCGCTGGCAGAAGCGGCAGCTCAAATCCTGGCT
CAAGACCAGCTGGACGTGTTTGAAAATCTATCTCTTAACGGCATTGGATCGGTTGTTGGCCCTAGCCTGGGCCAA
ACGATGGAGCCAAGCATTCCCGATCTCGGACCGCTCATCAGCATTCCGCCTACAAATGAAATGGTTGTCAGCGCA
GCACGCTTGCATGAAATCGTGCAAAGCGCCCTGACGCGAGCCCTGACGGATATTATCCAGCCAGTGGTTGACCGA
TCAATTACAATTGCGGCCATCTCAACAGGGCAGATGGTGCGCAAAGACTTTGTTTCGGAACCCGATGAAAATCGA
GTGCGCGCGTCAGCCATCAACATGGTCAAGGCTACAGCAGGGAGTCTTGCTCTTGTTACTTCCAAGGAGCCCCTG
AGAGCAAACTTGACCAACTACATGCGCATTCTGGCCAACGATCTGCCTTCTGGTCTCCCCGAAGGGACAGTGATA
ATGTGTGTCAACTTGAACCTAGATTTGGCTTGCAGCGTGATTGAGAAGCAGGCGGAAGAAAGAGCGGTGCCGGAA
ATCGAAGACCTGCTGGAGGAAGACTTTGCGGTTCGAAGACGTCATCGTATGCAGCACCCCAATGAGGCTTTTTAC
GCTGGCACTGTCAACCGCTGGGCAATGACGATTCCTCATCCCTTTAAGCTTTCGCCCAGCATGCATGGCCTGAAC
CCCGAGCAAATGGCCATTTATGATGACTTTGCTCGTCAGCCGCGCAATGTTGGTGTTTCAACGGCGTCGCACGCG
CCATCAACATCGGACGCGACGCGATCTCTTGCCAATGAGGTGCTGCAGGAACCTTATAGCACTGTGCCCAATTTG
CCCACGCCCGCCGAAACGCCCTCTGTTCAGCACCTCGGGTCGCAGCTGCAGTCGTACGCGCCTGTGCACGCCGCC
GCGACTTCGACTTCACTGACGAGCTCGCGCCCCGCAGGCTTCCAAATGGAGTTTCATAACTTGGGCGAGCGCGTC
AATAAGCTGCTTCAGGAGCTTATACGCGTCGCTGGCGAGGCAAGAGAGGAGCATTTTGCCGGGCTGCCCAGGCCC
CATCCGGTTCTCGATGTGGTTGATGCCTTGGTGCAGCTCATTATCAAGACGTCGCAAAACTCTGAAGAGTTCTCC
ATCTACACGGCTGAGCAAATAAGCGCTCTCATCTTCCAGCAAGTCGAGGACAACCTTGCCCTCGAGAGCCTCGTC
CATGTCTTGGAAACTGTGCGCAAGATTTCGGGTCCGGCTTTGAATAATCGCGTGCGCGCCGTCTTTGCTCAGCAG
CATGGTCCCAACTTCCTTAGTCTGCCCCTCTTGGCCGCGCTGGTGCGTACAGACTTGTTGGACTGGGGCAACATT
GATGTGGCCATGGCCAAGGCTATCGAGTCTCGCAAAGAGGGATCACTCGACTTTCTTGACCACATGCTTGATCTC
ACTCTTGTCAACAACCGCCCTGTTGTCCTCTTCACCGACTTTCCACGGACATTTGAAGCATCATGGAACTGGATC
ACCAACAACCCCGGCTCTCCTGCTGCTCAGCGCCTGAGGAGCAAGCTCACGGGTCAGGTTTCACAACAAGGGCTC
TATGCAGACGACGGCGATGACCTGTCTCTACGTCGAGAGCAGATGGAATACGTCTTTGAGGAATGGGTACATCTC
TGCAGCAACGTCAAGGTATCAGCAAAGGCAAATGACCTATTTATTGAACAGCTAGAGTCGAGGCAGCTTATTAGC
GGCCGGGAAGACTTGTTGCTCTTTATACGCGTTGCCACGGAACTTTGTGTGGATCGCTTTGATCACATCATGCAT
TCTGGCACCACTTCGGATGCCTACCTCATGACGGATGCCCTGGCCAGAGCCATCAGCTTGTTCATTTGCAAGCTC
GACGAGGGTAGCACGTCTCGCTCCTCTCTATTCGACTCGACTCTCGCTCTAATCGCTCTCATCTTCAACCAGTAC
TACATGCAAAGAGAAGAGCACATGAACCAAAAAGTCTTCTTTCGCCTCATGTCAATGCTGTTGTACGAACTTAAC
GGTAATTACAGCAATATCACAGACGAGGACCACCAAAGCATGCTACAAAAGTTTGCTTTTCGCCTAGAAACCATG
GGGCCCCTCCGCTACCCCGGTTTTACCTTTGCTTGGCTCTCTCTCATTCAACACCGAGCATTTCTTCCAGTGCTA
CTTCGTATGCCAGAAAACGCAGGTTGGGGTCCTTTTGTCAAGCTGCTGAGCCATCTTCTCCATAGTCTGGGCGAT
CAACTCAAGCCCATTACTGTGTCTCCGGTGACCAAGGACATCTATCGAGCAACTCTGAAACTTTTGGTTGTTCTT
CAGCACGACTTTCCCGAGTTTGTTGCTGCCCATCACATCAGACTCTGCTCCATGATTCCACCTCACTGTGCGCAA
CTTCTCAACGCCGTCTTGGCAGCTACTCCGCAGCAAAGCCGTGGCAAATTGCCTGATCCCATGCATCCGGGGCTC
AAGGTGGATCTCATGAGGGAAATGAAGGCACAGCCCTTGCTTTTGGATGAAGCGTCGGCAATTTTGCGCGACTGT
GGTCTACTTGAACTAGTTGATCAAGCCCTACAAAATGGACCAGCTGAGGAGACGGTTGCACAGATTGCTCACACC
ATGACTCATAGTGTTCCAAAGGAGACGAGCTACGGCTTTGTCACGGTGGAGGCAAACACACAGGTTATTGGAGCA
GTAGTGGTCCATATAGGCCAGCAGGCGTCAGAGGCGCGCGCCGAGGCGCCGAGTTCCCCGGCAATTATGGGCACT
GAGCCTGGTGTATCGATGCTGTCGCTGCTGGTCCATGAGCTCCCGCCTGGTGCTCGCTATTATCTCTTGTCCAGC
ATGATCAATCAGTTGCGATTTCCCAACGGCCACACAGATTACTTCAGCAGAGTCTTGCTCCACATGTTTGGTCAC
GACTTGAATGATCCAGAAGAGTCTGAAATTCGCCAAGAGATGACGAGGGTTTTCCTCGAGCGCTTGGTTGGCTTT
TGGCCCCAGCCTTGGGGACTGATGTTTACCGTTCTTGAGTTGATCAAGAATGAAAAGTACAGGTTCTTTGACTTG
CCATTCATCAAGTCTACGCCAGAGGTAAATACTATGTACCATGTTTTTGTTTTTGTTTTTTGGAACACGAGTGAC
AGACTGAGGACTAACGCAAGATGGCCATAGGTCGCTGAGAGATTTGCCGCCATTTTGCAACGGAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail