Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7052
Gene name
LocationContig_7:271319..274128
Strand-
Gene length (bp)2809
Transcript length (bp)2553
Coding sequence length (bp)2553
Protein length (aa) 851

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain 3.1E-16 27 97
PF07653 SH3_2 Variant SH3 domain 3.6E-11 797 850
PF00018 SH3_1 SH3 domain 8.6E-12 796 844
PF14604 SH3_9 Variant SH3 domain 1.2E-10 797 848

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10199|IMP2_SCHPO Septation protein imp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp2 PE=1 SV=1 14 433 1.0E-70
sp|Q09822|CDC15_SCHPO Cell division control protein 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc15 PE=1 SV=2 8 291 4.0E-55
sp|O43586|PPIP1_HUMAN Proline-serine-threonine phosphatase-interacting protein 1 OS=Homo sapiens GN=PSTPIP1 PE=1 SV=1 13 289 6.0E-33
sp|P97814|PPIP1_MOUSE Proline-serine-threonine phosphatase-interacting protein 1 OS=Mus musculus GN=Pstpip1 PE=1 SV=1 13 328 7.0E-33
sp|Q9H939|PPIP2_HUMAN Proline-serine-threonine phosphatase-interacting protein 2 OS=Homo sapiens GN=PSTPIP2 PE=1 SV=4 15 289 2.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10199|IMP2_SCHPO Septation protein imp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp2 PE=1 SV=1 14 433 1.0E-70
sp|Q09822|CDC15_SCHPO Cell division control protein 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc15 PE=1 SV=2 8 291 4.0E-55
sp|O43586|PPIP1_HUMAN Proline-serine-threonine phosphatase-interacting protein 1 OS=Homo sapiens GN=PSTPIP1 PE=1 SV=1 13 289 6.0E-33
sp|P97814|PPIP1_MOUSE Proline-serine-threonine phosphatase-interacting protein 1 OS=Mus musculus GN=Pstpip1 PE=1 SV=1 13 328 7.0E-33
sp|Q9H939|PPIP2_HUMAN Proline-serine-threonine phosphatase-interacting protein 2 OS=Homo sapiens GN=PSTPIP2 PE=1 SV=4 15 289 2.0E-31
sp|Q99M15|PPIP2_MOUSE Proline-serine-threonine phosphatase-interacting protein 2 OS=Mus musculus GN=Pstpip2 PE=1 SV=4 15 289 3.0E-30
sp|Q09822|CDC15_SCHPO Cell division control protein 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc15 PE=1 SV=2 512 848 1.0E-23
sp|Q555L8|Y4695_DICDI SH3 and F-BAR domain-containing protein DDB_G0274695 OS=Dictyostelium discoideum GN=DDB_G0274695 PE=3 SV=1 15 289 1.0E-22
sp|E7FBF7|FCHO1_DANRE F-BAR domain only protein 1 OS=Danio rerio GN=fcho1 PE=1 SV=2 13 284 2.0E-16
sp|Q5R807|FCHO2_PONAB F-BAR domain only protein 2 OS=Pongo abelii GN=FCHO2 PE=2 SV=1 15 281 6.0E-16
sp|Q0JRZ9|FCHO2_HUMAN F-BAR domain only protein 2 OS=Homo sapiens GN=FCHO2 PE=1 SV=2 15 281 7.0E-16
sp|D3ZYR1|FCHO2_RAT F-BAR domain only protein 2 OS=Rattus norvegicus GN=Fcho2 PE=1 SV=1 11 281 1.0E-15
sp|Q3UQN2|FCHO2_MOUSE F-BAR domain only protein 2 OS=Mus musculus GN=Fcho2 PE=1 SV=1 11 281 1.0E-15
sp|Q05080|CYK2_YEAST Cytokinesis protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOF1 PE=1 SV=1 11 278 6.0E-14
sp|Q60780|GAS7_MOUSE Growth arrest-specific protein 7 OS=Mus musculus GN=Gas7 PE=1 SV=1 14 277 7.0E-14
sp|Q502I9|FCHO2_DANRE F-BAR domain only protein 2 OS=Danio rerio GN=fcho2 PE=2 SV=1 11 286 1.0E-13
sp|O60861|GAS7_HUMAN Growth arrest-specific protein 7 OS=Homo sapiens GN=GAS7 PE=1 SV=3 14 277 2.0E-13
sp|O14526|FCHO1_HUMAN F-BAR domain only protein 1 OS=Homo sapiens GN=FCHO1 PE=1 SV=2 15 283 2.0E-13
sp|Q75JD4|Y1676_DICDI SH3 and F-BAR domain-containing protein DDB_G0271676 OS=Dictyostelium discoideum GN=DDB_G0271676 PE=3 SV=1 15 286 3.0E-13
sp|O55148|GAS7_RAT Growth arrest-specific protein 7 OS=Rattus norvegicus GN=Gas7 PE=2 SV=2 14 277 3.0E-12
sp|O14259|SFP47_SCHPO Ubp4-interactor sfp47 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sfp47 PE=1 SV=2 787 848 6.0E-12
sp|Q8K285|FCHO1_MOUSE F-BAR domain only protein 1 OS=Mus musculus GN=Fcho1 PE=1 SV=2 15 283 4.0E-11
sp|Q10199|IMP2_SCHPO Septation protein imp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp2 PE=1 SV=1 785 847 9.0E-10
sp|Q54GD0|MGP1_DICDI Mental retardation GTPase activating protein homolog 1 OS=Dictyostelium discoideum GN=mgp1 PE=3 SV=1 13 271 6.0E-07
sp|A5D7F8|SH3R1_BOVIN E3 ubiquitin-protein ligase SH3RF1 OS=Bos taurus GN=SH3RF1 PE=2 SV=1 747 848 2.0E-06
sp|Q55CK2|MGP2_DICDI Mental retardation GTPase activating protein homolog 2 OS=Dictyostelium discoideum GN=mgp2 PE=3 SV=1 1 314 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3128
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5462
Ophiocordyceps australis map64 (Brazil) OphauB2|7052 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01168
Ophiocordyceps camponoti-rufipedis Ophun1|2205
Ophiocordyceps kimflemingae Ophio5|4646
Ophiocordyceps subramaniannii Hirsu2|5491

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7052
MPAATAEVPAVTLSFANNFWGKDDAGVGPLLERMHGAKQTCDELKAFYNARAAIEDEYARKLLHLCRKALGTQEM
GSLRNSLDTVRGEVESMAKQHQSIATQMKTELEEPLAAFAGGMKERRKIVQNSIEKLLKTKTLQTQHVNKTRDKY
EQECLKIKGYLAQGHMVMGQEERRNKAKLEKTQISLASANSEYENAVKALEDTTARWNREWKAAADKFQDLEEER
LDFSKSSLWAFANISSTVCVSDDGSCEKIRLSLEKMEVERDIANFISERGTGQEIPDPPKYINFCRGDVNDTQSE
TSEDDNYSVAQFPRSINPAFRSSSPQPSTFESHHDPNSALANDLAHRDLLPSMAPQKSQAGMRPRADKRYNSQGS
VGQGPYDETAVGAVPHDPYPMDGMTMLCRTAPVPDASGQQASGRRLSEEPPGDRPNSSQEALGGSSKSSEKRINK
KKSGFFQNHSPFRRKSVKEVQAPGAAGRNTWHVSSAAKPRRAVGASPWPGDGAGHEGTASPEPIDANASLALGVG
QNVLPVATADMQRRAARGVDERDPIAVALAELKDVSINKQSSVRMSADHYHGISTPVPGTESKAARPVPVPGSHE
AAAASRGTPPPCYQQPAQVTRLGVPPPAVTSKAMKDATNKVAEQTRTIFGSRSNAPVLSPARAKDIPRAASPAPA
RSVSPQPRAASPSPYASSQTNLCNQRGADQAYYAPASPSGSSRGVSPSQYRDYMRPQSSYGGGDMAVQLAPAGDH
GYGSQRSRGSGTMGLYDGPSRPRSKSVADPARQYSRDGRPILHFARALYLYHAVIPEELGFNKGDYLAVFRHQDD
GWWEAEVHGGNGRVGLVPSNYLEPC*
Coding >OphauB2|7052
ATGCCTGCGGCAACGGCAGAAGTTCCAGCCGTCACGCTGTCGTTTGCCAACAACTTTTGGGGAAAGGACGATGCC
GGTGTCGGTCCGCTGCTCGAGCGCATGCACGGCGCCAAGCAGACGTGCGACGAGTTGAAAGCCTTTTACAATGCG
CGCGCGGCGATTGAGGATGAATATGCTCGAAAACTGCTTCATTTGTGCCGCAAGGCTCTCGGGACCCAGGAAATG
GGATCTTTACGAAATTCCCTTGACACGGTCCGCGGCGAGGTCGAGTCCATGGCAAAGCAACACCAAAGCATAGCG
ACACAGATGAAGACAGAGCTCGAAGAGCCGCTGGCGGCTTTTGCTGGTGGCATGAAGGAGCGGCGGAAAATCGTA
CAAAACTCTATTGAGAAGCTTCTCAAGACCAAGACTCTACAAACGCAGCACGTCAACAAGACGCGGGACAAGTAC
GAACAAGAATGTCTCAAGATCAAGGGCTACCTTGCGCAAGGCCACATGGTGATGGGCCAGGAAGAACGTCGCAAC
AAGGCCAAGCTAGAAAAGACGCAGATCAGCTTGGCATCAGCAAACAGCGAGTATGAGAACGCAGTCAAGGCGCTG
GAAGACACAACGGCCAGATGGAACAGGGAGTGGAAGGCTGCGGCAGACAAGTTCCAAGACCTGGAGGAGGAGCGG
CTCGACTTTAGCAAAAGCAGTCTGTGGGCATTTGCCAATATCTCGTCAACGGTGTGTGTCAGCGACGATGGCTCG
TGTGAAAAGATTCGGCTGTCGCTGGAGAAGATGGAGGTGGAGCGAGACATTGCCAACTTCATCTCTGAGCGCGGG
ACGGGGCAGGAGATTCCCGACCCGCCAAAGTACATCAACTTTTGCCGGGGCGACGTCAATGACACGCAGTCTGAG
ACGTCAGAGGACGACAATTACTCGGTGGCGCAGTTTCCTCGCAGCATCAATCCGGCCTTTAGGTCGTCGTCGCCG
CAGCCGTCAACATTTGAGTCGCACCACGACCCCAATTCTGCCCTGGCCAACGACCTGGCGCACCGGGACCTGTTG
CCGTCCATGGCGCCGCAAAAGAGCCAGGCTGGTATGAGGCCAAGGGCGGACAAGCGCTACAACTCGCAAGGGTCT
GTAGGACAAGGGCCATATGACGAGACGGCCGTGGGTGCTGTGCCACACGACCCATACCCCATGGACGGCATGACG
ATGCTCTGCCGCACGGCGCCGGTGCCAGACGCAAGCGGGCAGCAGGCGTCGGGCCGGCGCTTGAGCGAGGAGCCA
CCGGGCGACAGGCCAAACTCGAGCCAAGAAGCACTTGGAGGCAGCAGCAAGAGCTCGGAGAAGCGCATCAACAAG
AAGAAGAGCGGCTTCTTCCAGAACCACAGCCCCTTCAGGCGCAAGAGCGTCAAGGAGGTGCAGGCTCCTGGGGCA
GCGGGCCGCAACACGTGGCACGTGTCGAGCGCGGCCAAGCCTCGACGGGCCGTGGGTGCTTCGCCATGGCCGGGT
GACGGAGCTGGGCACGAGGGCACGGCGAGCCCTGAACCGATAGATGCCAATGCCAGCCTGGCGCTGGGCGTGGGG
CAGAACGTGCTGCCCGTGGCCACGGCCGACATGCAGCGGCGGGCGGCAAGAGGCGTGGATGAGCGCGACCCCATT
GCCGTGGCGCTTGCCGAGCTCAAGGACGTCAGCATCAACAAGCAGTCGTCGGTGCGCATGTCGGCCGACCACTAC
CATGGCATCTCGACGCCCGTGCCTGGGACGGAGAGCAAGGCTGCGCGGCCGGTGCCCGTTCCCGGCAGCCATGAG
GCAGCAGCAGCCAGCCGCGGCACGCCGCCTCCATGCTATCAGCAGCCGGCCCAGGTGACGAGGCTGGGCGTGCCG
CCGCCTGCTGTCACGTCCAAGGCGATGAAGGATGCCACCAACAAGGTGGCGGAGCAGACGCGCACCATCTTTGGC
AGTCGCTCCAACGCGCCCGTCCTTTCGCCAGCCCGTGCCAAGGACATTCCTCGAGCCGCATCGCCAGCTCCCGCT
CGAAGCGTCTCGCCGCAGCCCCGCGCCGCCTCTCCCAGTCCGTACGCCTCGTCGCAGACCAATCTTTGCAACCAG
CGCGGCGCCGACCAGGCCTACTACGCACCAGCCTCTCCCAGTGGGTCCTCGCGAGGCGTCTCGCCCTCACAGTAC
CGAGACTACATGCGGCCGCAGAGCAGCTATGGCGGCGGCGACATGGCGGTCCAGCTGGCTCCCGCGGGCGACCAT
GGCTATGGGTCGCAGAGGAGCAGAGGCTCGGGCACCATGGGCTTGTACGACGGCCCATCGCGTCCGCGCAGCAAA
AGTGTCGCGGATCCAGCCAGGCAGTACTCGCGCGATGGGCGGCCCATTCTTCACTTTGCTCGTGCCCTCTATCTC
TATCACGCAGTCATCCCCGAGGAACTCGGCTTCAACAAGGGCGACTACCTGGCTGTCTTCCGTCACCAGGACGAC
GGCTGGTGGGAGGCCGAGGTCCATGGAGGCAACGGTCGTGTTGGGCTGGTCCCAAGCAACTACCTCGAGCCCTGC
TGA
Transcript >OphauB2|7052
ATGCCTGCGGCAACGGCAGAAGTTCCAGCCGTCACGCTGTCGTTTGCCAACAACTTTTGGGGAAAGGACGATGCC
GGTGTCGGTCCGCTGCTCGAGCGCATGCACGGCGCCAAGCAGACGTGCGACGAGTTGAAAGCCTTTTACAATGCG
CGCGCGGCGATTGAGGATGAATATGCTCGAAAACTGCTTCATTTGTGCCGCAAGGCTCTCGGGACCCAGGAAATG
GGATCTTTACGAAATTCCCTTGACACGGTCCGCGGCGAGGTCGAGTCCATGGCAAAGCAACACCAAAGCATAGCG
ACACAGATGAAGACAGAGCTCGAAGAGCCGCTGGCGGCTTTTGCTGGTGGCATGAAGGAGCGGCGGAAAATCGTA
CAAAACTCTATTGAGAAGCTTCTCAAGACCAAGACTCTACAAACGCAGCACGTCAACAAGACGCGGGACAAGTAC
GAACAAGAATGTCTCAAGATCAAGGGCTACCTTGCGCAAGGCCACATGGTGATGGGCCAGGAAGAACGTCGCAAC
AAGGCCAAGCTAGAAAAGACGCAGATCAGCTTGGCATCAGCAAACAGCGAGTATGAGAACGCAGTCAAGGCGCTG
GAAGACACAACGGCCAGATGGAACAGGGAGTGGAAGGCTGCGGCAGACAAGTTCCAAGACCTGGAGGAGGAGCGG
CTCGACTTTAGCAAAAGCAGTCTGTGGGCATTTGCCAATATCTCGTCAACGGTGTGTGTCAGCGACGATGGCTCG
TGTGAAAAGATTCGGCTGTCGCTGGAGAAGATGGAGGTGGAGCGAGACATTGCCAACTTCATCTCTGAGCGCGGG
ACGGGGCAGGAGATTCCCGACCCGCCAAAGTACATCAACTTTTGCCGGGGCGACGTCAATGACACGCAGTCTGAG
ACGTCAGAGGACGACAATTACTCGGTGGCGCAGTTTCCTCGCAGCATCAATCCGGCCTTTAGGTCGTCGTCGCCG
CAGCCGTCAACATTTGAGTCGCACCACGACCCCAATTCTGCCCTGGCCAACGACCTGGCGCACCGGGACCTGTTG
CCGTCCATGGCGCCGCAAAAGAGCCAGGCTGGTATGAGGCCAAGGGCGGACAAGCGCTACAACTCGCAAGGGTCT
GTAGGACAAGGGCCATATGACGAGACGGCCGTGGGTGCTGTGCCACACGACCCATACCCCATGGACGGCATGACG
ATGCTCTGCCGCACGGCGCCGGTGCCAGACGCAAGCGGGCAGCAGGCGTCGGGCCGGCGCTTGAGCGAGGAGCCA
CCGGGCGACAGGCCAAACTCGAGCCAAGAAGCACTTGGAGGCAGCAGCAAGAGCTCGGAGAAGCGCATCAACAAG
AAGAAGAGCGGCTTCTTCCAGAACCACAGCCCCTTCAGGCGCAAGAGCGTCAAGGAGGTGCAGGCTCCTGGGGCA
GCGGGCCGCAACACGTGGCACGTGTCGAGCGCGGCCAAGCCTCGACGGGCCGTGGGTGCTTCGCCATGGCCGGGT
GACGGAGCTGGGCACGAGGGCACGGCGAGCCCTGAACCGATAGATGCCAATGCCAGCCTGGCGCTGGGCGTGGGG
CAGAACGTGCTGCCCGTGGCCACGGCCGACATGCAGCGGCGGGCGGCAAGAGGCGTGGATGAGCGCGACCCCATT
GCCGTGGCGCTTGCCGAGCTCAAGGACGTCAGCATCAACAAGCAGTCGTCGGTGCGCATGTCGGCCGACCACTAC
CATGGCATCTCGACGCCCGTGCCTGGGACGGAGAGCAAGGCTGCGCGGCCGGTGCCCGTTCCCGGCAGCCATGAG
GCAGCAGCAGCCAGCCGCGGCACGCCGCCTCCATGCTATCAGCAGCCGGCCCAGGTGACGAGGCTGGGCGTGCCG
CCGCCTGCTGTCACGTCCAAGGCGATGAAGGATGCCACCAACAAGGTGGCGGAGCAGACGCGCACCATCTTTGGC
AGTCGCTCCAACGCGCCCGTCCTTTCGCCAGCCCGTGCCAAGGACATTCCTCGAGCCGCATCGCCAGCTCCCGCT
CGAAGCGTCTCGCCGCAGCCCCGCGCCGCCTCTCCCAGTCCGTACGCCTCGTCGCAGACCAATCTTTGCAACCAG
CGCGGCGCCGACCAGGCCTACTACGCACCAGCCTCTCCCAGTGGGTCCTCGCGAGGCGTCTCGCCCTCACAGTAC
CGAGACTACATGCGGCCGCAGAGCAGCTATGGCGGCGGCGACATGGCGGTCCAGCTGGCTCCCGCGGGCGACCAT
GGCTATGGGTCGCAGAGGAGCAGAGGCTCGGGCACCATGGGCTTGTACGACGGCCCATCGCGTCCGCGCAGCAAA
AGTGTCGCGGATCCAGCCAGGCAGTACTCGCGCGATGGGCGGCCCATTCTTCACTTTGCTCGTGCCCTCTATCTC
TATCACGCAGTCATCCCCGAGGAACTCGGCTTCAACAAGGGCGACTACCTGGCTGTCTTCCGTCACCAGGACGAC
GGCTGGTGGGAGGCCGAGGTCCATGGAGGCAACGGTCGTGTTGGGCTGGTCCCAAGCAACTACCTCGAGCCCTGC
TGA
Gene >OphauB2|7052
ATGCCTGCGGCAACGGCAGAAGTTCCAGCCGTCACGCTGTCGTGTACGATGCTCATTTGGTGTGCTCTGCTTGGC
GATTGCGTGACATTGACTAATGGGCTGGCCGAGCAGTTGCCAACAACTTTTGGGGAAAGGACGATGCCGGTGTCG
GTCCGCTGCTCGAGCGCATGCACGGCGCCAAGCAGACGTGCGACGAGTTGAAAGCCTTTTACAATGGTACGAGGC
ACTGTCTGCGCTTTCAGATGTGGGACTGACGCTGGTGGCTCTGACGCTCAGCGCGCGCGGCGATTGAGGATGAAT
ATGCTCGAAAACTGCTTCATTTGTGCCGCAAGGCTCTCGGGACCCAGGAAATGGGATCTTTACGAAATTCCCTTG
ACACGGTCCGCGGCGAGGTCGAGTCCATGGCAAAGCAACACCAAAGCATAGCGACACAGATGAAGACAGAGCTCG
AAGAGCCGCTGGCGGCTTTTGCTGGTGGCATGAAGGAGCGGCGGAAAATCGTACAAAACTCTATTGAGAAGCTTC
TCAAGACCAAGACTCTACAAACGCAGCACGTCAACAAGGTCAGCAGTCCGGCGCCGACAGCACCATGTTTGGAGT
GAATGCTGACAAGATTGACTTTACTACAACAAGACGCGGGACAAGTACGAACAAGAATGTCTCAAGATCAAGGGC
TACCTTGCGCAAGGCCACATGGTGATGGGCCAGGAAGAACGTCGCAACAAGGCCAAGCTAGAAAAGACGCAGATC
AGCTTGGCATCAGCAAACAGCGAGTATGAGAACGCAGTCAAGGCGCTGGAAGACACAACGGCCAGATGGAACAGG
GAGTGGAAGGCTGCGGCAGACAAGTTCCAAGACCTGGAGGAGGAGCGGCTCGACTTTAGCAAAAGCAGTCTGTGG
GCATTTGCCAATATCTCGTCAACGGTGTGTGTCAGCGACGATGGCTCGTGTGAAAAGATTCGGCTGTCGCTGGAG
AAGATGGAGGTGGAGCGAGACATTGCCAACTTCATCTCTGAGCGCGGGACGGGGCAGGAGATTCCCGACCCGCCA
AAGTACATCAACTTTTGCCGGGGCGACGTCAATGACACGCAGTCTGAGACGTCAGAGGACGACAATTACTCGGTG
GCGCAGTTTCCTCGCAGCATCAATCCGGCCTTTAGGTCGTCGTCGCCGCAGCCGTCAACATTTGAGTCGCACCAC
GACCCCAATTCTGCCCTGGCCAACGACCTGGCGCACCGGGACCTGTTGCCGTCCATGGCGCCGCAAAAGAGCCAG
GCTGGTATGAGGCCAAGGGCGGACAAGCGCTACAACTCGCAAGGGTCTGTAGGACAAGGGCCATATGACGAGACG
GCCGTGGGTGCTGTGCCACACGACCCATACCCCATGGACGGCATGACGATGCTCTGCCGCACGGCGCCGGTGCCA
GACGCAAGCGGGCAGCAGGCGTCGGGCCGGCGCTTGAGCGAGGAGCCACCGGGCGACAGGCCAAACTCGAGCCAA
GAAGCACTTGGAGGCAGCAGCAAGAGCTCGGAGAAGCGCATCAACAAGAAGAAGAGCGGCTTCTTCCAGAACCAC
AGCCCCTTCAGGCGCAAGAGCGTCAAGGAGGTGCAGGCTCCTGGGGCAGCGGGCCGCAACACGTGGCACGTGTCG
AGCGCGGCCAAGCCTCGACGGGCCGTGGGTGCTTCGCCATGGCCGGGTGACGGAGCTGGGCACGAGGGCACGGCG
AGCCCTGAACCGATAGATGCCAATGCCAGCCTGGCGCTGGGCGTGGGGCAGAACGTGCTGCCCGTGGCCACGGCC
GACATGCAGCGGCGGGCGGCAAGAGGCGTGGATGAGCGCGACCCCATTGCCGTGGCGCTTGCCGAGCTCAAGGAC
GTCAGCATCAACAAGCAGTCGTCGGTGCGCATGTCGGCCGACCACTACCATGGCATCTCGACGCCCGTGCCTGGG
ACGGAGAGCAAGGCTGCGCGGCCGGTGCCCGTTCCCGGCAGCCATGAGGCAGCAGCAGCCAGCCGCGGCACGCCG
CCTCCATGCTATCAGCAGCCGGCCCAGGTGACGAGGCTGGGCGTGCCGCCGCCTGCTGTCACGTCCAAGGCGATG
AAGGATGCCACCAACAAGGTGGCGGAGCAGACGCGCACCATCTTTGGCAGTCGCTCCAACGCGCCCGTCCTTTCG
CCAGCCCGTGCCAAGGACATTCCTCGAGCCGCATCGCCAGCTCCCGCTCGAAGCGTCTCGCCGCAGCCCCGCGCC
GCCTCTCCCAGTCCGTACGCCTCGTCGCAGACCAATCTTTGCAACCAGCGCGGCGCCGACCAGGCCTACTACGCA
CCAGCCTCTCCCAGTGGGTCCTCGCGAGGCGTCTCGCCCTCACAGTACCGAGACTACATGCGGCCGCAGAGCAGC
TATGGCGGCGGCGACATGGCGGTCCAGCTGGCTCCCGCGGGCGACCATGGCTATGGGTCGCAGAGGAGCAGAGGC
TCGGGCACCATGGGCTTGTACGACGGCCCATCGCGTCCGCGCAGCAAAAGTGTCGCGGATCCAGCCAGGCAGTAC
TCGCGCGATGGGCGGCCCATTCTTCACTTTGGTAAGAGTTGACTAGCTAGGCTACATGTTGGGCACTAGACTGAC
GCATGGTGACACAGCTCGTGCCCTCTATCTCTATCACGCAGTCATCCCCGAGGAACTCGGCTTCAACAAGGGCGA
CTACCTGGCTGTCTTCCGTCACCAGGACGACGGCTGGTGGGAGGCCGAGGTCCATGGAGGCAACGGTCGTGTTGG
GCTGGTCCCAAGCAACTACCTCGAGCCCTGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail