Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7052
Gene name
LocationContig_7:271319..274128
Strand-
Gene length (bp)2809
Transcript length (bp)2553
Coding sequence length (bp)2553
Protein length (aa) 851

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain 3.1E-16 27 97
PF07653 SH3_2 Variant SH3 domain 3.6E-11 797 850
PF00018 SH3_1 SH3 domain 8.6E-12 796 844
PF14604 SH3_9 Variant SH3 domain 1.2E-10 797 848

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10199|IMP2_SCHPO Septation protein imp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp2 PE=1 SV=1 14 433 1.0E-70
sp|Q09822|CDC15_SCHPO Cell division control protein 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc15 PE=1 SV=2 8 291 4.0E-55
sp|O43586|PPIP1_HUMAN Proline-serine-threonine phosphatase-interacting protein 1 OS=Homo sapiens GN=PSTPIP1 PE=1 SV=1 13 289 6.0E-33
sp|P97814|PPIP1_MOUSE Proline-serine-threonine phosphatase-interacting protein 1 OS=Mus musculus GN=Pstpip1 PE=1 SV=1 13 328 7.0E-33
sp|Q9H939|PPIP2_HUMAN Proline-serine-threonine phosphatase-interacting protein 2 OS=Homo sapiens GN=PSTPIP2 PE=1 SV=4 15 289 2.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10199|IMP2_SCHPO Septation protein imp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp2 PE=1 SV=1 14 433 1.0E-70
sp|Q09822|CDC15_SCHPO Cell division control protein 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc15 PE=1 SV=2 8 291 4.0E-55
sp|O43586|PPIP1_HUMAN Proline-serine-threonine phosphatase-interacting protein 1 OS=Homo sapiens GN=PSTPIP1 PE=1 SV=1 13 289 6.0E-33
sp|P97814|PPIP1_MOUSE Proline-serine-threonine phosphatase-interacting protein 1 OS=Mus musculus GN=Pstpip1 PE=1 SV=1 13 328 7.0E-33
sp|Q9H939|PPIP2_HUMAN Proline-serine-threonine phosphatase-interacting protein 2 OS=Homo sapiens GN=PSTPIP2 PE=1 SV=4 15 289 2.0E-31
sp|Q99M15|PPIP2_MOUSE Proline-serine-threonine phosphatase-interacting protein 2 OS=Mus musculus GN=Pstpip2 PE=1 SV=4 15 289 3.0E-30
sp|Q09822|CDC15_SCHPO Cell division control protein 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc15 PE=1 SV=2 512 848 1.0E-23
sp|Q555L8|Y4695_DICDI SH3 and F-BAR domain-containing protein DDB_G0274695 OS=Dictyostelium discoideum GN=DDB_G0274695 PE=3 SV=1 15 289 1.0E-22
sp|E7FBF7|FCHO1_DANRE F-BAR domain only protein 1 OS=Danio rerio GN=fcho1 PE=1 SV=2 13 284 2.0E-16
sp|Q5R807|FCHO2_PONAB F-BAR domain only protein 2 OS=Pongo abelii GN=FCHO2 PE=2 SV=1 15 281 6.0E-16
sp|Q0JRZ9|FCHO2_HUMAN F-BAR domain only protein 2 OS=Homo sapiens GN=FCHO2 PE=1 SV=2 15 281 7.0E-16
sp|D3ZYR1|FCHO2_RAT F-BAR domain only protein 2 OS=Rattus norvegicus GN=Fcho2 PE=1 SV=1 11 281 1.0E-15
sp|Q3UQN2|FCHO2_MOUSE F-BAR domain only protein 2 OS=Mus musculus GN=Fcho2 PE=1 SV=1 11 281 1.0E-15
sp|Q05080|CYK2_YEAST Cytokinesis protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOF1 PE=1 SV=1 11 278 6.0E-14
sp|Q60780|GAS7_MOUSE Growth arrest-specific protein 7 OS=Mus musculus GN=Gas7 PE=1 SV=1 14 277 7.0E-14
sp|Q502I9|FCHO2_DANRE F-BAR domain only protein 2 OS=Danio rerio GN=fcho2 PE=2 SV=1 11 286 1.0E-13
sp|O60861|GAS7_HUMAN Growth arrest-specific protein 7 OS=Homo sapiens GN=GAS7 PE=1 SV=3 14 277 2.0E-13
sp|O14526|FCHO1_HUMAN F-BAR domain only protein 1 OS=Homo sapiens GN=FCHO1 PE=1 SV=2 15 283 2.0E-13
sp|Q75JD4|Y1676_DICDI SH3 and F-BAR domain-containing protein DDB_G0271676 OS=Dictyostelium discoideum GN=DDB_G0271676 PE=3 SV=1 15 286 3.0E-13
sp|O55148|GAS7_RAT Growth arrest-specific protein 7 OS=Rattus norvegicus GN=Gas7 PE=2 SV=2 14 277 3.0E-12
sp|O14259|SFP47_SCHPO Ubp4-interactor sfp47 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sfp47 PE=1 SV=2 787 848 6.0E-12
sp|Q8K285|FCHO1_MOUSE F-BAR domain only protein 1 OS=Mus musculus GN=Fcho1 PE=1 SV=2 15 283 4.0E-11
sp|Q10199|IMP2_SCHPO Septation protein imp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp2 PE=1 SV=1 785 847 9.0E-10
sp|Q54GD0|MGP1_DICDI Mental retardation GTPase activating protein homolog 1 OS=Dictyostelium discoideum GN=mgp1 PE=3 SV=1 13 271 6.0E-07
sp|A5D7F8|SH3R1_BOVIN E3 ubiquitin-protein ligase SH3RF1 OS=Bos taurus GN=SH3RF1 PE=2 SV=1 747 848 2.0E-06
sp|Q55CK2|MGP2_DICDI Mental retardation GTPase activating protein homolog 2 OS=Dictyostelium discoideum GN=mgp2 PE=3 SV=1 1 314 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7052
MPAATAEVPAVTLSFANNFWGKDDAGVGPLLERMHGAKQTCDELKAFYNARAAIEDEYARKLLHLCRKALGTQEM
GSLRNSLDTVRGEVESMAKQHQSIATQMKTELEEPLAAFAGGMKERRKIVQNSIEKLLKTKTLQTQHVNKTRDKY
EQECLKIKGYLAQGHMVMGQEERRNKAKLEKTQISLASANSEYENAVKALEDTTARWNREWKAAADKFQDLEEER
LDFSKSSLWAFANISSTVCVSDDGSCEKIRLSLEKMEVERDIANFISERGTGQEIPDPPKYINFCRGDVNDTQSE
TSEDDNYSVAQFPRSINPAFRSSSPQPSTFESHHDPNSALANDLAHRDLLPSMAPQKSQAGMRPRADKRYNSQGS
VGQGPYDETAVGAVPHDPYPMDGMTMLCRTAPVPDASGQQASGRRLSEEPPGDRPNSSQEALGGSSKSSEKRINK
KKSGFFQNHSPFRRKSVKEVQAPGAAGRNTWHVSSAAKPRRAVGASPWPGDGAGHEGTASPEPIDANASLALGVG
QNVLPVATADMQRRAARGVDERDPIAVALAELKDVSINKQSSVRMSADHYHGISTPVPGTESKAARPVPVPGSHE
AAAASRGTPPPCYQQPAQVTRLGVPPPAVTSKAMKDATNKVAEQTRTIFGSRSNAPVLSPARAKDIPRAASPAPA
RSVSPQPRAASPSPYASSQTNLCNQRGADQAYYAPASPSGSSRGVSPSQYRDYMRPQSSYGGGDMAVQLAPAGDH
GYGSQRSRGSGTMGLYDGPSRPRSKSVADPARQYSRDGRPILHFARALYLYHAVIPEELGFNKGDYLAVFRHQDD
GWWEAEVHGGNGRVGLVPSNYLEPC*
Coding >OphauB2|7052
ATGCCTGCGGCAACGGCAGAAGTTCCAGCCGTCACGCTGTCGTTTGCCAACAACTTTTGGGGAAAGGACGATGCC
GGTGTCGGTCCGCTGCTCGAGCGCATGCACGGCGCCAAGCAGACGTGCGACGAGTTGAAAGCCTTTTACAATGCG
CGCGCGGCGATTGAGGATGAATATGCTCGAAAACTGCTTCATTTGTGCCGCAAGGCTCTCGGGACCCAGGAAATG
GGATCTTTACGAAATTCCCTTGACACGGTCCGCGGCGAGGTCGAGTCCATGGCAAAGCAACACCAAAGCATAGCG
ACACAGATGAAGACAGAGCTCGAAGAGCCGCTGGCGGCTTTTGCTGGTGGCATGAAGGAGCGGCGGAAAATCGTA
CAAAACTCTATTGAGAAGCTTCTCAAGACCAAGACTCTACAAACGCAGCACGTCAACAAGACGCGGGACAAGTAC
GAACAAGAATGTCTCAAGATCAAGGGCTACCTTGCGCAAGGCCACATGGTGATGGGCCAGGAAGAACGTCGCAAC
AAGGCCAAGCTAGAAAAGACGCAGATCAGCTTGGCATCAGCAAACAGCGAGTATGAGAACGCAGTCAAGGCGCTG
GAAGACACAACGGCCAGATGGAACAGGGAGTGGAAGGCTGCGGCAGACAAGTTCCAAGACCTGGAGGAGGAGCGG
CTCGACTTTAGCAAAAGCAGTCTGTGGGCATTTGCCAATATCTCGTCAACGGTGTGTGTCAGCGACGATGGCTCG
TGTGAAAAGATTCGGCTGTCGCTGGAGAAGATGGAGGTGGAGCGAGACATTGCCAACTTCATCTCTGAGCGCGGG
ACGGGGCAGGAGATTCCCGACCCGCCAAAGTACATCAACTTTTGCCGGGGCGACGTCAATGACACGCAGTCTGAG
ACGTCAGAGGACGACAATTACTCGGTGGCGCAGTTTCCTCGCAGCATCAATCCGGCCTTTAGGTCGTCGTCGCCG
CAGCCGTCAACATTTGAGTCGCACCACGACCCCAATTCTGCCCTGGCCAACGACCTGGCGCACCGGGACCTGTTG
CCGTCCATGGCGCCGCAAAAGAGCCAGGCTGGTATGAGGCCAAGGGCGGACAAGCGCTACAACTCGCAAGGGTCT
GTAGGACAAGGGCCATATGACGAGACGGCCGTGGGTGCTGTGCCACACGACCCATACCCCATGGACGGCATGACG
ATGCTCTGCCGCACGGCGCCGGTGCCAGACGCAAGCGGGCAGCAGGCGTCGGGCCGGCGCTTGAGCGAGGAGCCA
CCGGGCGACAGGCCAAACTCGAGCCAAGAAGCACTTGGAGGCAGCAGCAAGAGCTCGGAGAAGCGCATCAACAAG
AAGAAGAGCGGCTTCTTCCAGAACCACAGCCCCTTCAGGCGCAAGAGCGTCAAGGAGGTGCAGGCTCCTGGGGCA
GCGGGCCGCAACACGTGGCACGTGTCGAGCGCGGCCAAGCCTCGACGGGCCGTGGGTGCTTCGCCATGGCCGGGT
GACGGAGCTGGGCACGAGGGCACGGCGAGCCCTGAACCGATAGATGCCAATGCCAGCCTGGCGCTGGGCGTGGGG
CAGAACGTGCTGCCCGTGGCCACGGCCGACATGCAGCGGCGGGCGGCAAGAGGCGTGGATGAGCGCGACCCCATT
GCCGTGGCGCTTGCCGAGCTCAAGGACGTCAGCATCAACAAGCAGTCGTCGGTGCGCATGTCGGCCGACCACTAC
CATGGCATCTCGACGCCCGTGCCTGGGACGGAGAGCAAGGCTGCGCGGCCGGTGCCCGTTCCCGGCAGCCATGAG
GCAGCAGCAGCCAGCCGCGGCACGCCGCCTCCATGCTATCAGCAGCCGGCCCAGGTGACGAGGCTGGGCGTGCCG
CCGCCTGCTGTCACGTCCAAGGCGATGAAGGATGCCACCAACAAGGTGGCGGAGCAGACGCGCACCATCTTTGGC
AGTCGCTCCAACGCGCCCGTCCTTTCGCCAGCCCGTGCCAAGGACATTCCTCGAGCCGCATCGCCAGCTCCCGCT
CGAAGCGTCTCGCCGCAGCCCCGCGCCGCCTCTCCCAGTCCGTACGCCTCGTCGCAGACCAATCTTTGCAACCAG
CGCGGCGCCGACCAGGCCTACTACGCACCAGCCTCTCCCAGTGGGTCCTCGCGAGGCGTCTCGCCCTCACAGTAC
CGAGACTACATGCGGCCGCAGAGCAGCTATGGCGGCGGCGACATGGCGGTCCAGCTGGCTCCCGCGGGCGACCAT
GGCTATGGGTCGCAGAGGAGCAGAGGCTCGGGCACCATGGGCTTGTACGACGGCCCATCGCGTCCGCGCAGCAAA
AGTGTCGCGGATCCAGCCAGGCAGTACTCGCGCGATGGGCGGCCCATTCTTCACTTTGCTCGTGCCCTCTATCTC
TATCACGCAGTCATCCCCGAGGAACTCGGCTTCAACAAGGGCGACTACCTGGCTGTCTTCCGTCACCAGGACGAC
GGCTGGTGGGAGGCCGAGGTCCATGGAGGCAACGGTCGTGTTGGGCTGGTCCCAAGCAACTACCTCGAGCCCTGC
TGA
Transcript >OphauB2|7052
ATGCCTGCGGCAACGGCAGAAGTTCCAGCCGTCACGCTGTCGTTTGCCAACAACTTTTGGGGAAAGGACGATGCC
GGTGTCGGTCCGCTGCTCGAGCGCATGCACGGCGCCAAGCAGACGTGCGACGAGTTGAAAGCCTTTTACAATGCG
CGCGCGGCGATTGAGGATGAATATGCTCGAAAACTGCTTCATTTGTGCCGCAAGGCTCTCGGGACCCAGGAAATG
GGATCTTTACGAAATTCCCTTGACACGGTCCGCGGCGAGGTCGAGTCCATGGCAAAGCAACACCAAAGCATAGCG
ACACAGATGAAGACAGAGCTCGAAGAGCCGCTGGCGGCTTTTGCTGGTGGCATGAAGGAGCGGCGGAAAATCGTA
CAAAACTCTATTGAGAAGCTTCTCAAGACCAAGACTCTACAAACGCAGCACGTCAACAAGACGCGGGACAAGTAC
GAACAAGAATGTCTCAAGATCAAGGGCTACCTTGCGCAAGGCCACATGGTGATGGGCCAGGAAGAACGTCGCAAC
AAGGCCAAGCTAGAAAAGACGCAGATCAGCTTGGCATCAGCAAACAGCGAGTATGAGAACGCAGTCAAGGCGCTG
GAAGACACAACGGCCAGATGGAACAGGGAGTGGAAGGCTGCGGCAGACAAGTTCCAAGACCTGGAGGAGGAGCGG
CTCGACTTTAGCAAAAGCAGTCTGTGGGCATTTGCCAATATCTCGTCAACGGTGTGTGTCAGCGACGATGGCTCG
TGTGAAAAGATTCGGCTGTCGCTGGAGAAGATGGAGGTGGAGCGAGACATTGCCAACTTCATCTCTGAGCGCGGG
ACGGGGCAGGAGATTCCCGACCCGCCAAAGTACATCAACTTTTGCCGGGGCGACGTCAATGACACGCAGTCTGAG
ACGTCAGAGGACGACAATTACTCGGTGGCGCAGTTTCCTCGCAGCATCAATCCGGCCTTTAGGTCGTCGTCGCCG
CAGCCGTCAACATTTGAGTCGCACCACGACCCCAATTCTGCCCTGGCCAACGACCTGGCGCACCGGGACCTGTTG
CCGTCCATGGCGCCGCAAAAGAGCCAGGCTGGTATGAGGCCAAGGGCGGACAAGCGCTACAACTCGCAAGGGTCT
GTAGGACAAGGGCCATATGACGAGACGGCCGTGGGTGCTGTGCCACACGACCCATACCCCATGGACGGCATGACG
ATGCTCTGCCGCACGGCGCCGGTGCCAGACGCAAGCGGGCAGCAGGCGTCGGGCCGGCGCTTGAGCGAGGAGCCA
CCGGGCGACAGGCCAAACTCGAGCCAAGAAGCACTTGGAGGCAGCAGCAAGAGCTCGGAGAAGCGCATCAACAAG
AAGAAGAGCGGCTTCTTCCAGAACCACAGCCCCTTCAGGCGCAAGAGCGTCAAGGAGGTGCAGGCTCCTGGGGCA
GCGGGCCGCAACACGTGGCACGTGTCGAGCGCGGCCAAGCCTCGACGGGCCGTGGGTGCTTCGCCATGGCCGGGT
GACGGAGCTGGGCACGAGGGCACGGCGAGCCCTGAACCGATAGATGCCAATGCCAGCCTGGCGCTGGGCGTGGGG
CAGAACGTGCTGCCCGTGGCCACGGCCGACATGCAGCGGCGGGCGGCAAGAGGCGTGGATGAGCGCGACCCCATT
GCCGTGGCGCTTGCCGAGCTCAAGGACGTCAGCATCAACAAGCAGTCGTCGGTGCGCATGTCGGCCGACCACTAC
CATGGCATCTCGACGCCCGTGCCTGGGACGGAGAGCAAGGCTGCGCGGCCGGTGCCCGTTCCCGGCAGCCATGAG
GCAGCAGCAGCCAGCCGCGGCACGCCGCCTCCATGCTATCAGCAGCCGGCCCAGGTGACGAGGCTGGGCGTGCCG
CCGCCTGCTGTCACGTCCAAGGCGATGAAGGATGCCACCAACAAGGTGGCGGAGCAGACGCGCACCATCTTTGGC
AGTCGCTCCAACGCGCCCGTCCTTTCGCCAGCCCGTGCCAAGGACATTCCTCGAGCCGCATCGCCAGCTCCCGCT
CGAAGCGTCTCGCCGCAGCCCCGCGCCGCCTCTCCCAGTCCGTACGCCTCGTCGCAGACCAATCTTTGCAACCAG
CGCGGCGCCGACCAGGCCTACTACGCACCAGCCTCTCCCAGTGGGTCCTCGCGAGGCGTCTCGCCCTCACAGTAC
CGAGACTACATGCGGCCGCAGAGCAGCTATGGCGGCGGCGACATGGCGGTCCAGCTGGCTCCCGCGGGCGACCAT
GGCTATGGGTCGCAGAGGAGCAGAGGCTCGGGCACCATGGGCTTGTACGACGGCCCATCGCGTCCGCGCAGCAAA
AGTGTCGCGGATCCAGCCAGGCAGTACTCGCGCGATGGGCGGCCCATTCTTCACTTTGCTCGTGCCCTCTATCTC
TATCACGCAGTCATCCCCGAGGAACTCGGCTTCAACAAGGGCGACTACCTGGCTGTCTTCCGTCACCAGGACGAC
GGCTGGTGGGAGGCCGAGGTCCATGGAGGCAACGGTCGTGTTGGGCTGGTCCCAAGCAACTACCTCGAGCCCTGC
TGA
Gene >OphauB2|7052
ATGCCTGCGGCAACGGCAGAAGTTCCAGCCGTCACGCTGTCGTGTACGATGCTCATTTGGTGTGCTCTGCTTGGC
GATTGCGTGACATTGACTAATGGGCTGGCCGAGCAGTTGCCAACAACTTTTGGGGAAAGGACGATGCCGGTGTCG
GTCCGCTGCTCGAGCGCATGCACGGCGCCAAGCAGACGTGCGACGAGTTGAAAGCCTTTTACAATGGTACGAGGC
ACTGTCTGCGCTTTCAGATGTGGGACTGACGCTGGTGGCTCTGACGCTCAGCGCGCGCGGCGATTGAGGATGAAT
ATGCTCGAAAACTGCTTCATTTGTGCCGCAAGGCTCTCGGGACCCAGGAAATGGGATCTTTACGAAATTCCCTTG
ACACGGTCCGCGGCGAGGTCGAGTCCATGGCAAAGCAACACCAAAGCATAGCGACACAGATGAAGACAGAGCTCG
AAGAGCCGCTGGCGGCTTTTGCTGGTGGCATGAAGGAGCGGCGGAAAATCGTACAAAACTCTATTGAGAAGCTTC
TCAAGACCAAGACTCTACAAACGCAGCACGTCAACAAGGTCAGCAGTCCGGCGCCGACAGCACCATGTTTGGAGT
GAATGCTGACAAGATTGACTTTACTACAACAAGACGCGGGACAAGTACGAACAAGAATGTCTCAAGATCAAGGGC
TACCTTGCGCAAGGCCACATGGTGATGGGCCAGGAAGAACGTCGCAACAAGGCCAAGCTAGAAAAGACGCAGATC
AGCTTGGCATCAGCAAACAGCGAGTATGAGAACGCAGTCAAGGCGCTGGAAGACACAACGGCCAGATGGAACAGG
GAGTGGAAGGCTGCGGCAGACAAGTTCCAAGACCTGGAGGAGGAGCGGCTCGACTTTAGCAAAAGCAGTCTGTGG
GCATTTGCCAATATCTCGTCAACGGTGTGTGTCAGCGACGATGGCTCGTGTGAAAAGATTCGGCTGTCGCTGGAG
AAGATGGAGGTGGAGCGAGACATTGCCAACTTCATCTCTGAGCGCGGGACGGGGCAGGAGATTCCCGACCCGCCA
AAGTACATCAACTTTTGCCGGGGCGACGTCAATGACACGCAGTCTGAGACGTCAGAGGACGACAATTACTCGGTG
GCGCAGTTTCCTCGCAGCATCAATCCGGCCTTTAGGTCGTCGTCGCCGCAGCCGTCAACATTTGAGTCGCACCAC
GACCCCAATTCTGCCCTGGCCAACGACCTGGCGCACCGGGACCTGTTGCCGTCCATGGCGCCGCAAAAGAGCCAG
GCTGGTATGAGGCCAAGGGCGGACAAGCGCTACAACTCGCAAGGGTCTGTAGGACAAGGGCCATATGACGAGACG
GCCGTGGGTGCTGTGCCACACGACCCATACCCCATGGACGGCATGACGATGCTCTGCCGCACGGCGCCGGTGCCA
GACGCAAGCGGGCAGCAGGCGTCGGGCCGGCGCTTGAGCGAGGAGCCACCGGGCGACAGGCCAAACTCGAGCCAA
GAAGCACTTGGAGGCAGCAGCAAGAGCTCGGAGAAGCGCATCAACAAGAAGAAGAGCGGCTTCTTCCAGAACCAC
AGCCCCTTCAGGCGCAAGAGCGTCAAGGAGGTGCAGGCTCCTGGGGCAGCGGGCCGCAACACGTGGCACGTGTCG
AGCGCGGCCAAGCCTCGACGGGCCGTGGGTGCTTCGCCATGGCCGGGTGACGGAGCTGGGCACGAGGGCACGGCG
AGCCCTGAACCGATAGATGCCAATGCCAGCCTGGCGCTGGGCGTGGGGCAGAACGTGCTGCCCGTGGCCACGGCC
GACATGCAGCGGCGGGCGGCAAGAGGCGTGGATGAGCGCGACCCCATTGCCGTGGCGCTTGCCGAGCTCAAGGAC
GTCAGCATCAACAAGCAGTCGTCGGTGCGCATGTCGGCCGACCACTACCATGGCATCTCGACGCCCGTGCCTGGG
ACGGAGAGCAAGGCTGCGCGGCCGGTGCCCGTTCCCGGCAGCCATGAGGCAGCAGCAGCCAGCCGCGGCACGCCG
CCTCCATGCTATCAGCAGCCGGCCCAGGTGACGAGGCTGGGCGTGCCGCCGCCTGCTGTCACGTCCAAGGCGATG
AAGGATGCCACCAACAAGGTGGCGGAGCAGACGCGCACCATCTTTGGCAGTCGCTCCAACGCGCCCGTCCTTTCG
CCAGCCCGTGCCAAGGACATTCCTCGAGCCGCATCGCCAGCTCCCGCTCGAAGCGTCTCGCCGCAGCCCCGCGCC
GCCTCTCCCAGTCCGTACGCCTCGTCGCAGACCAATCTTTGCAACCAGCGCGGCGCCGACCAGGCCTACTACGCA
CCAGCCTCTCCCAGTGGGTCCTCGCGAGGCGTCTCGCCCTCACAGTACCGAGACTACATGCGGCCGCAGAGCAGC
TATGGCGGCGGCGACATGGCGGTCCAGCTGGCTCCCGCGGGCGACCATGGCTATGGGTCGCAGAGGAGCAGAGGC
TCGGGCACCATGGGCTTGTACGACGGCCCATCGCGTCCGCGCAGCAAAAGTGTCGCGGATCCAGCCAGGCAGTAC
TCGCGCGATGGGCGGCCCATTCTTCACTTTGGTAAGAGTTGACTAGCTAGGCTACATGTTGGGCACTAGACTGAC
GCATGGTGACACAGCTCGTGCCCTCTATCTCTATCACGCAGTCATCCCCGAGGAACTCGGCTTCAACAAGGGCGA
CTACCTGGCTGTCTTCCGTCACCAGGACGACGGCTGGTGGGAGGCCGAGGTCCATGGAGGCAACGGTCGTGTTGG
GCTGGTCCCAAGCAACTACCTCGAGCCCTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail