Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|705
Gene name
LocationContig_113:43206..45154
Strand+
Gene length (bp)1948
Transcript length (bp)1887
Coding sequence length (bp)1887
Protein length (aa) 629

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 8.6E-13 210 413
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 6.2E-11 208 413
PF00743 FMO-like Flavin-binding monooxygenase-like 3.1E-09 267 461
PF13434 K_oxygenase L-lysine 6-monooxygenase (NADPH-requiring) 2.0E-05 284 413
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 4.0E-05 211 264

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SZY8|YUC1_ARATH Probable indole-3-pyruvate monooxygenase YUCCA1 OS=Arabidopsis thaliana GN=YUC1 PE=1 SV=1 210 553 8.0E-27
sp|O23024|YUC3_ARATH Probable indole-3-pyruvate monooxygenase YUCCA3 OS=Arabidopsis thaliana GN=YUC3 PE=2 SV=1 210 553 3.0E-24
sp|Q9LFM5|YUC4_ARATH Probable indole-3-pyruvate monooxygenase YUCCA4 OS=Arabidopsis thaliana GN=YUC4 PE=1 SV=1 207 553 4.0E-23
sp|Q9FVQ0|YUC10_ARATH Probable indole-3-pyruvate monooxygenase YUCCA10 OS=Arabidopsis thaliana GN=YUC10 PE=2 SV=1 206 553 5.0E-23
sp|O49312|YUC7_ARATH Probable indole-3-pyruvate monooxygenase YUCCA7 OS=Arabidopsis thaliana GN=YUC7 PE=2 SV=1 210 553 5.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SZY8|YUC1_ARATH Probable indole-3-pyruvate monooxygenase YUCCA1 OS=Arabidopsis thaliana GN=YUC1 PE=1 SV=1 210 553 8.0E-27
sp|O23024|YUC3_ARATH Probable indole-3-pyruvate monooxygenase YUCCA3 OS=Arabidopsis thaliana GN=YUC3 PE=2 SV=1 210 553 3.0E-24
sp|Q9LFM5|YUC4_ARATH Probable indole-3-pyruvate monooxygenase YUCCA4 OS=Arabidopsis thaliana GN=YUC4 PE=1 SV=1 207 553 4.0E-23
sp|Q9FVQ0|YUC10_ARATH Probable indole-3-pyruvate monooxygenase YUCCA10 OS=Arabidopsis thaliana GN=YUC10 PE=2 SV=1 206 553 5.0E-23
sp|O49312|YUC7_ARATH Probable indole-3-pyruvate monooxygenase YUCCA7 OS=Arabidopsis thaliana GN=YUC7 PE=2 SV=1 210 553 5.0E-23
sp|Q9LPL3|YUC11_ARATH Probable indole-3-pyruvate monooxygenase YUCCA11 OS=Arabidopsis thaliana GN=YUC11 PE=2 SV=1 209 598 1.0E-22
sp|Q9SVQ1|YUC2_ARATH Indole-3-pyruvate monooxygenase YUCCA2 OS=Arabidopsis thaliana GN=YUC2 PE=1 SV=1 207 553 5.0E-22
sp|Q8VZ59|YUC6_ARATH Indole-3-pyruvate monooxygenase YUCCA6 OS=Arabidopsis thaliana GN=YUC6 PE=1 SV=1 210 553 6.0E-22
sp|Q9SVU0|YUC8_ARATH Probable indole-3-pyruvate monooxygenase YUCCA8 OS=Arabidopsis thaliana GN=YUC8 PE=2 SV=1 210 553 7.0E-22
sp|O64489|YUC9_ARATH Probable indole-3-pyruvate monooxygenase YUCCA9 OS=Arabidopsis thaliana GN=YUC9 PE=2 SV=1 196 553 9.0E-21
sp|Q9LKC0|YUC5_ARATH Probable indole-3-pyruvate monooxygenase YUCCA5 OS=Arabidopsis thaliana GN=YUC5 PE=2 SV=1 210 553 2.0E-17
sp|Q5L2G3|CZCO_GEOKA Uncharacterized oxidoreductase CzcO-like OS=Geobacillus kaustophilus (strain HTA426) GN=GK0582 PE=4 SV=1 209 401 7.0E-15
sp|O07085|CZCO_BACSU Uncharacterized oxidoreductase CzcO OS=Bacillus subtilis (strain 168) GN=czcO PE=1 SV=1 210 398 1.0E-08
sp|A7Z1S7|CZCO_BACMF Uncharacterized oxidoreductase CzcO OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=czcO PE=3 SV=1 210 398 2.0E-08
sp|Q99518|FMO2_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Homo sapiens GN=FMO2 PE=1 SV=4 209 562 1.0E-07
sp|Q28505|FMO2_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Macaca mulatta GN=FMO2 PE=2 SV=2 209 562 2.0E-07
sp|Q8HZ69|FMO2_GORGO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Gorilla gorilla gorilla GN=FMO2 PE=3 SV=3 209 562 4.0E-07
sp|P31512|FMO4_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Homo sapiens GN=FMO4 PE=1 SV=3 209 551 6.0E-07
sp|Q8HZ70|FMO2_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pan troglodytes GN=FMO2 PE=3 SV=3 209 562 6.0E-07
sp|Q5REK0|FMO2_PONAB Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pongo abelii GN=FMO2 PE=2 SV=3 209 562 7.0E-07
sp|Q9EQ76|FMO3_RAT Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Rattus norvegicus GN=Fmo3 PE=1 SV=1 209 417 2.0E-06
sp|Q95LA1|FMO3_CANLF Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Canis lupus familiaris GN=FMO3 PE=2 SV=3 209 417 4.0E-06
sp|P36366|FMO2_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Cavia porcellus GN=FMO2 PE=2 SV=2 209 562 4.0E-06
sp|P97501|FMO3_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Mus musculus GN=Fmo3 PE=1 SV=1 209 417 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0050661 NADP binding Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0016491 oxidoreductase activity Yes
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:0043168 anion binding No
GO:0000166 nucleotide binding No
GO:0004497 monooxygenase activity No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0048037 cofactor binding No
GO:0008152 metabolic process No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0008150 biological_process No
GO:0050662 coenzyme binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|705
MASISRKQRDAIPLVPAQIPSSTPTGPVDARAIAEQVLDALNQALLQKNYSVLTQLFVEDGFWRDHLALSWEFRT
LQGHDDIVGFLQACTKSRDGFRLKNLTLDASGPSKEPSAVPFDPDAKTKGVQAFFAFETAIGSGRGVMRLVFDRE
DWKIFTFYTSLQQLKGFEEAVYHRRPRGVEFGDSQPGKNNWAEKLERRRNFEDGSEPAVLVVGGGQGGLAMAARL
EMLGVNTLVIDRNKRIGDNWRGRYRHLVLHDPVWYDHMPYINFPPQWPIFSPKDKLAGFLESYAELLELNVWLQT
ELESCEWDRQTERWTATVLQKSDGGTRRRTFHPHHIIQATGLSGLKHEPSFKGMDTFKGSRICHSSEFPGAQRVG
QQGSKKAVIVGSCNSAHDIAQDFFENGYDVTIVQRSSTHVVSVNAILGFSMKGVYEEDGPPVEDADMLVQGLPSS
ILKTIHIKLAEHIKKYDEETLSGLEKAGFKVNEGPDGAGLFFQYFEHSGGYYIDVGTSKLIADGNIKCKQGQEVV
EILPHGVRLADGLELEADEIIFATGYQNMRSQTRYIFGDAVADSVDDVWEFNEEGEFRTIWQQSGHPGFWYHGGN
LGQCRFYSRLLALQIKAIQEGLCKYGEM*
Coding >OphauB2|705
ATGGCATCAATTAGCAGGAAGCAACGGGATGCGATACCCCTTGTCCCTGCTCAGATCCCCTCCTCAACACCTACA
GGCCCTGTCGACGCACGGGCTATAGCGGAGCAAGTACTGGATGCATTAAATCAGGCTTTGCTGCAAAAGAATTAC
TCGGTATTGACGCAGCTCTTTGTAGAAGATGGGTTTTGGCGCGACCACTTGGCACTTTCTTGGGAATTCCGGACT
CTCCAGGGGCACGATGACATTGTCGGCTTTCTCCAGGCCTGTACAAAGTCGCGCGATGGATTTAGGCTCAAAAAT
TTGACACTTGATGCGAGCGGCCCGTCCAAGGAGCCAAGCGCCGTGCCGTTTGACCCCGACGCCAAAACCAAGGGA
GTACAAGCCTTTTTCGCCTTTGAAACAGCGATAGGATCGGGAAGAGGAGTCATGCGCCTTGTTTTCGACAGAGAA
GATTGGAAAATATTCACCTTTTATACCAGCCTTCAGCAACTCAAGGGCTTTGAAGAGGCGGTATACCATCGCCGA
CCGCGGGGTGTCGAATTCGGCGATAGCCAGCCAGGAAAAAATAATTGGGCGGAGAAACTCGAGCGGCGAAGAAAC
TTTGAGGATGGAAGTGAGCCAGCCGTATTGGTCGTTGGCGGTGGGCAGGGAGGCCTGGCCATGGCGGCACGGCTT
GAGATGCTAGGGGTAAATACTCTTGTCATTGATCGAAATAAACGAATCGGCGACAACTGGCGAGGACGGTACCGC
CATCTTGTACTTCATGATCCGGTTTGGTACGACCACATGCCGTATATCAATTTTCCGCCGCAGTGGCCCATCTTT
AGCCCAAAGGATAAGTTGGCTGGGTTCTTGGAATCATACGCAGAGCTCTTGGAGCTCAACGTGTGGCTTCAGACG
GAGCTTGAGAGCTGTGAATGGGATAGGCAGACAGAAAGGTGGACTGCCACCGTCTTGCAAAAATCAGACGGCGGC
ACGCGCCGTAGGACATTTCATCCGCATCACATTATTCAGGCCACAGGACTATCGGGCCTGAAGCATGAACCATCA
TTCAAGGGCATGGACACCTTCAAGGGCAGTCGAATATGTCATTCATCCGAATTCCCTGGCGCTCAGCGAGTCGGC
CAACAAGGCAGCAAAAAGGCCGTTATTGTCGGTAGCTGCAACTCGGCTCACGACATTGCTCAAGATTTCTTTGAA
AATGGCTATGACGTTACTATAGTCCAGCGATCAAGTACGCATGTTGTCTCGGTAAACGCGATTCTGGGATTTTCG
ATGAAGGGCGTGTATGAGGAAGACGGTCCACCAGTCGAGGATGCGGATATGCTGGTGCAAGGCCTTCCATCCAGC
ATTCTCAAGACGATCCATATCAAGCTTGCAGAACATATAAAGAAATACGACGAGGAAACTCTTTCCGGACTGGAA
AAAGCTGGCTTCAAGGTAAATGAAGGGCCCGATGGGGCTGGCCTCTTCTTTCAGTACTTTGAACACTCAGGGGGC
TACTACATTGATGTGGGGACATCCAAGCTCATTGCCGACGGCAATATCAAGTGCAAACAAGGCCAAGAGGTAGTA
GAGATCCTACCACATGGTGTCCGACTTGCCGATGGCCTCGAGCTCGAGGCCGATGAGATTATATTTGCTACCGGA
TACCAAAATATGCGTTCTCAGACGAGGTATATTTTTGGCGACGCTGTCGCGGATAGCGTCGATGATGTGTGGGAA
TTCAATGAGGAGGGTGAGTTTAGGACGATATGGCAGCAGAGTGGACACCCAGGCTTCTGGTATCACGGAGGTAAT
CTCGGCCAATGCCGCTTCTACTCGAGATTGTTGGCTCTGCAGATCAAGGCGATACAAGAGGGGCTATGCAAGTAT
GGGGAGATGTAG
Transcript >OphauB2|705
ATGGCATCAATTAGCAGGAAGCAACGGGATGCGATACCCCTTGTCCCTGCTCAGATCCCCTCCTCAACACCTACA
GGCCCTGTCGACGCACGGGCTATAGCGGAGCAAGTACTGGATGCATTAAATCAGGCTTTGCTGCAAAAGAATTAC
TCGGTATTGACGCAGCTCTTTGTAGAAGATGGGTTTTGGCGCGACCACTTGGCACTTTCTTGGGAATTCCGGACT
CTCCAGGGGCACGATGACATTGTCGGCTTTCTCCAGGCCTGTACAAAGTCGCGCGATGGATTTAGGCTCAAAAAT
TTGACACTTGATGCGAGCGGCCCGTCCAAGGAGCCAAGCGCCGTGCCGTTTGACCCCGACGCCAAAACCAAGGGA
GTACAAGCCTTTTTCGCCTTTGAAACAGCGATAGGATCGGGAAGAGGAGTCATGCGCCTTGTTTTCGACAGAGAA
GATTGGAAAATATTCACCTTTTATACCAGCCTTCAGCAACTCAAGGGCTTTGAAGAGGCGGTATACCATCGCCGA
CCGCGGGGTGTCGAATTCGGCGATAGCCAGCCAGGAAAAAATAATTGGGCGGAGAAACTCGAGCGGCGAAGAAAC
TTTGAGGATGGAAGTGAGCCAGCCGTATTGGTCGTTGGCGGTGGGCAGGGAGGCCTGGCCATGGCGGCACGGCTT
GAGATGCTAGGGGTAAATACTCTTGTCATTGATCGAAATAAACGAATCGGCGACAACTGGCGAGGACGGTACCGC
CATCTTGTACTTCATGATCCGGTTTGGTACGACCACATGCCGTATATCAATTTTCCGCCGCAGTGGCCCATCTTT
AGCCCAAAGGATAAGTTGGCTGGGTTCTTGGAATCATACGCAGAGCTCTTGGAGCTCAACGTGTGGCTTCAGACG
GAGCTTGAGAGCTGTGAATGGGATAGGCAGACAGAAAGGTGGACTGCCACCGTCTTGCAAAAATCAGACGGCGGC
ACGCGCCGTAGGACATTTCATCCGCATCACATTATTCAGGCCACAGGACTATCGGGCCTGAAGCATGAACCATCA
TTCAAGGGCATGGACACCTTCAAGGGCAGTCGAATATGTCATTCATCCGAATTCCCTGGCGCTCAGCGAGTCGGC
CAACAAGGCAGCAAAAAGGCCGTTATTGTCGGTAGCTGCAACTCGGCTCACGACATTGCTCAAGATTTCTTTGAA
AATGGCTATGACGTTACTATAGTCCAGCGATCAAGTACGCATGTTGTCTCGGTAAACGCGATTCTGGGATTTTCG
ATGAAGGGCGTGTATGAGGAAGACGGTCCACCAGTCGAGGATGCGGATATGCTGGTGCAAGGCCTTCCATCCAGC
ATTCTCAAGACGATCCATATCAAGCTTGCAGAACATATAAAGAAATACGACGAGGAAACTCTTTCCGGACTGGAA
AAAGCTGGCTTCAAGGTAAATGAAGGGCCCGATGGGGCTGGCCTCTTCTTTCAGTACTTTGAACACTCAGGGGGC
TACTACATTGATGTGGGGACATCCAAGCTCATTGCCGACGGCAATATCAAGTGCAAACAAGGCCAAGAGGTAGTA
GAGATCCTACCACATGGTGTCCGACTTGCCGATGGCCTCGAGCTCGAGGCCGATGAGATTATATTTGCTACCGGA
TACCAAAATATGCGTTCTCAGACGAGGTATATTTTTGGCGACGCTGTCGCGGATAGCGTCGATGATGTGTGGGAA
TTCAATGAGGAGGGTGAGTTTAGGACGATATGGCAGCAGAGTGGACACCCAGGCTTCTGGTATCACGGAGGTAAT
CTCGGCCAATGCCGCTTCTACTCGAGATTGTTGGCTCTGCAGATCAAGGCGATACAAGAGGGGCTATGCAAGTAT
GGGGAGATGTAG
Gene >OphauB2|705
ATGGCATCAATTAGCAGGAAGCAACGGGATGCGATACCCCTTGTCCCTGCTCAGATCCCCTCCTCAACACCTACA
GGCCCTGTCGACGCACGGGCTATAGCGGAGCAAGTACTGGATGCATTAAATCAGGCTTTGCTGCAAAAGAATTAC
TCGGTATTGACGCAGCTCTTTGTAGAAGATGGGTTTTGGCGCGACCACTTGGCACTTTCTTGGGAATTCCGGACT
CTCCAGGGGCACGATGACATTGTCGGCTTTCTCCAGGCCTGTACAAAGTCGCGCGATGGATTTAGGCTCAAAAAT
TTGACACTTGATGCGAGCGGCCCGTCCAAGGAGCCAAGCGCCGTGCCGTTTGACCCCGACGCCAAAACCAAGGGA
GTACAAGCCTTTTTCGCCTTTGAAACAGCGATAGGATCGGGAAGAGGAGTCATGCGCCTTGTTTTCGACAGAGAA
GATTGGAAAATATTCACCTTTTATACCAGCCTTCAGCAACTCAAGGGCTTTGAAGAGGCGGTATACCATCGCCGA
CCGCGGGGTGTCGAATTCGGCGATAGCCAGCCAGGAAAAAATAATTGGGCGGAGAAACTCGAGCGGCGAAGAAAC
TTTGAGGATGGAAGTGAGCCAGCCGTATTGGTCGTTGGTAAGCTAGCTCTTCTCGGCATCAAACTCGAATGAACT
TTGAGCGCTGACAAAAACGCCAGGCGGTGGGCAGGGAGGCCTGGCCATGGCGGCACGGCTTGAGATGCTAGGGGT
AAATACTCTTGTCATTGATCGAAATAAACGAATCGGCGACAACTGGCGAGGACGGTACCGCCATCTTGTACTTCA
TGATCCGGTTTGGTACGACCACATGCCGTATATCAATTTTCCGCCGCAGTGGCCCATCTTTAGCCCAAAGGATAA
GTTGGCTGGGTTCTTGGAATCATACGCAGAGCTCTTGGAGCTCAACGTGTGGCTTCAGACGGAGCTTGAGAGCTG
TGAATGGGATAGGCAGACAGAAAGGTGGACTGCCACCGTCTTGCAAAAATCAGACGGCGGCACGCGCCGTAGGAC
ATTTCATCCGCATCACATTATTCAGGCCACAGGACTATCGGGCCTGAAGCATGAACCATCATTCAAGGGCATGGA
CACCTTCAAGGGCAGTCGAATATGTCATTCATCCGAATTCCCTGGCGCTCAGCGAGTCGGCCAACAAGGCAGCAA
AAAGGCCGTTATTGTCGGTAGCTGCAACTCGGCTCACGACATTGCTCAAGATTTCTTTGAAAATGGCTATGACGT
TACTATAGTCCAGCGATCAAGTACGCATGTTGTCTCGGTAAACGCGATTCTGGGATTTTCGATGAAGGGCGTGTA
TGAGGAAGACGGTCCACCAGTCGAGGATGCGGATATGCTGGTGCAAGGCCTTCCATCCAGCATTCTCAAGACGAT
CCATATCAAGCTTGCAGAACATATAAAGAAATACGACGAGGAAACTCTTTCCGGACTGGAAAAAGCTGGCTTCAA
GGTAAATGAAGGGCCCGATGGGGCTGGCCTCTTCTTTCAGTACTTTGAACACTCAGGGGGCTACTACATTGATGT
GGGGACATCCAAGCTCATTGCCGACGGCAATATCAAGTGCAAACAAGGCCAAGAGGTAGTAGAGATCCTACCACA
TGGTGTCCGACTTGCCGATGGCCTCGAGCTCGAGGCCGATGAGATTATATTTGCTACCGGATACCAAAATATGCG
TTCTCAGACGAGGTATATTTTTGGCGACGCTGTCGCGGATAGCGTCGATGATGTGTGGGAATTCAATGAGGAGGG
TGAGTTTAGGACGATATGGCAGCAGAGTGGACACCCAGGCTTCTGGTATCACGGAGGTAATCTCGGCCAATGCCG
CTTCTACTCGAGATTGTTGGCTCTGCAGATCAAGGCGATACAAGAGGGGCTATGCAAGTATGGGGAGATGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail