Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7049
Gene name
LocationContig_7:262997..264734
Strand-
Gene length (bp)1737
Transcript length (bp)1626
Coding sequence length (bp)1626
Protein length (aa) 542

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00144 Beta-lactamase Beta-lactamase 1.3E-43 41 369

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A6WYS5|DAP_OCHA4 D-aminopeptidase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=dap PE=3 SV=1 40 411 2.0E-12
sp|P15555|DAC_STRSR D-alanyl-D-alanine carboxypeptidase OS=Streptomyces sp. (strain R61) PE=1 SV=2 54 377 3.0E-12
sp|Q9ZBA9|DAP_OCHAN D-aminopeptidase OS=Ochrobactrum anthropi GN=dap PE=1 SV=3 37 411 5.0E-11
sp|Q8YD27|DAP_BRUME D-aminopeptidase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dap PE=3 SV=1 40 389 2.0E-10
sp|A5VVL2|DAP_BRUO2 D-aminopeptidase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dap PE=3 SV=1 40 389 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A6WYS5|DAP_OCHA4 D-aminopeptidase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=dap PE=3 SV=1 40 411 2.0E-12
sp|P15555|DAC_STRSR D-alanyl-D-alanine carboxypeptidase OS=Streptomyces sp. (strain R61) PE=1 SV=2 54 377 3.0E-12
sp|Q9ZBA9|DAP_OCHAN D-aminopeptidase OS=Ochrobactrum anthropi GN=dap PE=1 SV=3 37 411 5.0E-11
sp|Q8YD27|DAP_BRUME D-aminopeptidase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dap PE=3 SV=1 40 389 2.0E-10
sp|A5VVL2|DAP_BRUO2 D-aminopeptidase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dap PE=3 SV=1 40 389 2.0E-10
sp|C0RM93|DAP_BRUMB D-aminopeptidase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=dap PE=3 SV=1 40 389 2.0E-10
sp|B2SD81|DAP_BRUA1 D-aminopeptidase OS=Brucella abortus (strain S19) GN=dap PE=3 SV=1 40 389 2.0E-10
sp|Q2YLB4|DAP_BRUA2 D-aminopeptidase OS=Brucella abortus (strain 2308) GN=dap PE=3 SV=1 40 389 2.0E-10
sp|Q579G4|DAP_BRUAB D-aminopeptidase OS=Brucella abortus biovar 1 (strain 9-941) GN=dap PE=3 SV=1 40 389 2.0E-10
sp|A9MCM7|DAP_BRUC2 D-aminopeptidase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=dap PE=3 SV=1 40 389 2.0E-10
sp|A9WVV8|DAP_BRUSI D-aminopeptidase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=dap PE=3 SV=1 40 389 2.0E-10
sp|Q8FV99|DAP_BRUSU D-aminopeptidase OS=Brucella suis biovar 1 (strain 1330) GN=dap PE=3 SV=1 40 389 2.0E-10
sp|Q7A3Q5|FLP_STAAN Protein flp OS=Staphylococcus aureus (strain N315) GN=flp PE=1 SV=1 39 365 6.0E-10
sp|Q99RJ0|FLP_STAAM Protein flp OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=flp PE=3 SV=1 39 365 6.0E-10
sp|Q6GDZ1|FLP_STAAR Protein flp OS=Staphylococcus aureus (strain MRSA252) GN=flp PE=3 SV=1 39 365 7.0E-10
sp|Q6G6M9|FLP_STAAS Protein flp OS=Staphylococcus aureus (strain MSSA476) GN=flp PE=3 SV=1 39 365 1.0E-09
sp|Q8NUZ4|FLP_STAAW Protein flp OS=Staphylococcus aureus (strain MW2) GN=flp PE=3 SV=1 39 365 1.0E-09
sp|Q5HDB2|FLP_STAAC Protein flp OS=Staphylococcus aureus (strain COL) GN=flp PE=4 SV=1 39 365 2.0E-09
sp|Q9KJ74|FLP_STAAU Protein flp OS=Staphylococcus aureus GN=flp PE=4 SV=1 39 365 3.0E-08
sp|Q2FVH6|FLP_STAA8 Protein flp OS=Staphylococcus aureus (strain NCTC 8325) GN=flp PE=4 SV=1 39 365 3.0E-08
sp|B5RCU8|YFEW_SALG2 UPF0214 protein YfeW OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=yfeW PE=3 SV=1 54 229 1.0E-07
sp|Q8XBJ0|YFEW_ECO57 UPF0214 protein YfeW OS=Escherichia coli O157:H7 GN=yfeW PE=3 SV=1 1 245 2.0E-07
sp|A9N307|YFEW_SALPB UPF0214 protein YfeW OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=yfeW PE=3 SV=1 54 229 1.0E-06
sp|Q8ZN80|YFEW_SALTY UPF0214 protein YfeW OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yfeW PE=3 SV=1 54 229 1.0E-06
sp|Q57LN2|YFEW_SALCH UPF0214 protein YfeW OS=Salmonella choleraesuis (strain SC-B67) GN=yfeW PE=3 SV=1 54 229 1.0E-06
sp|B5FQG8|YFEW_SALDC UPF0214 protein YfeW OS=Salmonella dublin (strain CT_02021853) GN=yfeW PE=3 SV=1 54 229 1.0E-06
sp|B4T0K5|YFEW_SALNS UPF0214 protein YfeW OS=Salmonella newport (strain SL254) GN=yfeW PE=3 SV=1 54 229 1.0E-06
sp|C0PZ64|YFEW_SALPC UPF0214 protein YfeW OS=Salmonella paratyphi C (strain RKS4594) GN=yfeW PE=3 SV=1 54 229 1.0E-06
sp|Q8Z4S7|YFEW_SALTI UPF0214 protein YfeW OS=Salmonella typhi GN=yfeW PE=3 SV=1 54 229 1.0E-06
sp|B5R4I5|YFEW_SALEP UPF0214 protein YfeW OS=Salmonella enteritidis PT4 (strain P125109) GN=yfeW PE=3 SV=1 54 229 1.0E-06
sp|Q5PCQ2|YFEW_SALPA UPF0214 protein YfeW OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=yfeW PE=3 SV=1 54 229 1.0E-06
sp|B5BB26|YFEW_SALPK UPF0214 protein YfeW OS=Salmonella paratyphi A (strain AKU_12601) GN=yfeW PE=3 SV=1 54 229 1.0E-06
sp|Q06317|PBP4_AMYLA Penicillin-binding protein 4 OS=Amycolatopsis lactamdurans GN=pbp PE=3 SV=1 46 236 1.0E-06
sp|P77619|YFEW_ECOLI UPF0214 protein YfeW OS=Escherichia coli (strain K12) GN=yfeW PE=3 SV=2 1 326 2.0E-06
sp|B4TR50|YFEW_SALSV UPF0214 protein YfeW OS=Salmonella schwarzengrund (strain CVM19633) GN=yfeW PE=3 SV=1 54 245 2.0E-06
sp|B5F0K5|YFEW_SALA4 UPF0214 protein YfeW OS=Salmonella agona (strain SL483) GN=yfeW PE=3 SV=1 54 229 2.0E-06
sp|B4TD53|YFEW_SALHS UPF0214 protein YfeW OS=Salmonella heidelberg (strain SL476) GN=yfeW PE=3 SV=1 54 229 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7049
MKLESLALALAARVCALAAELQSPLGQGVGQQQGPLTAEFDDFVADKLREWKVPGMSLAVIDGHKVYAKGYGFAT
LPSTPATPDTLWYGASTTKAYVAATLGHLIDSGEHAELAKGWDTAMASILGDDFVLEDEWATNHVTLDDAVSHRS
GMTRHDKSCVHMVNGSQASPRDIVRNMRNLPLKREPRVKYSYCNLMYVALGHALERLTRQPVAKLLHDVIWRPLG
MKATFVHLDDAQQAPQHLASGYWWDDETDSFKPVENMHLSELVSAGGIISNVLDYAQWVKCLIHQQAPFSNRVHA
DIRRPRTIKDDVSLPGLEFSLYGLGWEHRSYMGHTVLTHSGILDAFGAQVYWLPDAKFGAVAFANTAWTSNAVQD
IAIHRLIRDKLGIPQGGMVDVDKIWKDLLFSMKHAGDKVDQRLFPDRADPPCPSTFRAESLEGTYSNPGFGEFTL
HRELDPERPADIVLVADRSNMTWRYQFRLHHVSGNFWVVHATVAGNPTFLHDYHRGEFRAGVNGNVSQLDIQWTG
VLSGEDEGTSVFEKVA*
Coding >OphauB2|7049
ATGAAGTTGGAAAGTTTAGCATTGGCCCTGGCGGCCAGAGTCTGCGCTCTTGCAGCCGAGCTTCAGAGCCCACTG
GGGCAAGGCGTCGGACAGCAACAGGGACCTCTGACTGCTGAATTTGACGATTTTGTTGCCGACAAGCTCCGAGAA
TGGAAAGTGCCAGGCATGTCTCTGGCTGTCATTGACGGACACAAAGTCTATGCCAAGGGATATGGATTTGCTACG
CTGCCCAGCACGCCGGCCACGCCAGACACGCTGTGGTATGGCGCATCGACAACAAAGGCATACGTGGCCGCCACC
CTGGGGCATCTCATAGACTCGGGAGAGCACGCAGAGCTGGCCAAGGGCTGGGACACGGCCATGGCGTCCATCCTT
GGCGACGACTTTGTCCTCGAGGATGAATGGGCCACAAATCATGTAACGCTCGACGACGCCGTCAGTCACCGCAGT
GGCATGACGCGGCATGACAAGTCGTGTGTGCACATGGTTAATGGGAGCCAGGCATCGCCCAGAGACATTGTACGC
AACATGAGGAATCTGCCCCTGAAGCGCGAGCCACGCGTCAAGTATTCTTATTGCAACCTCATGTATGTGGCTCTG
GGCCATGCTCTGGAAAGACTCACTCGTCAGCCCGTGGCCAAGCTGTTGCATGACGTGATATGGAGGCCCCTTGGT
ATGAAGGCCACCTTTGTCCATCTCGACGACGCTCAGCAGGCGCCACAGCATCTGGCCTCGGGGTACTGGTGGGAC
GACGAGACGGACAGCTTCAAGCCCGTCGAGAATATGCATCTCTCCGAGCTCGTCTCTGCCGGCGGAATCATCTCC
AACGTGCTTGATTATGCCCAGTGGGTCAAGTGTCTGATTCATCAGCAAGCGCCCTTTTCCAACAGGGTCCACGCC
GATATCAGAAGGCCTAGAACCATCAAGGACGACGTGTCGCTGCCGGGACTGGAATTCTCTCTCTATGGACTCGGG
TGGGAGCACAGGAGCTACATGGGACACACCGTCTTGACACATAGTGGCATACTCGACGCTTTTGGAGCCCAGGTC
TACTGGCTGCCAGACGCCAAGTTTGGTGCCGTCGCCTTTGCCAACACTGCGTGGACTTCCAACGCCGTCCAAGAC
ATTGCCATCCATCGCTTAATACGCGACAAACTGGGTATCCCGCAGGGCGGCATGGTTGATGTAGACAAGATTTGG
AAAGACTTGTTGTTCAGTATGAAGCATGCCGGGGACAAGGTGGACCAACGCTTGTTCCCGGACCGAGCAGATCCC
CCCTGCCCATCCACATTCAGGGCTGAGAGCCTCGAGGGCACGTATTCAAATCCAGGCTTTGGAGAATTCACACTG
CATCGAGAACTGGATCCCGAGAGACCAGCAGACATTGTTCTCGTGGCAGACCGGAGCAACATGACGTGGCGCTAC
CAGTTTAGGCTGCACCACGTGTCAGGAAACTTCTGGGTCGTCCATGCCACCGTTGCAGGGAACCCAACATTTCTT
CATGATTATCACAGGGGCGAATTCAGGGCCGGGGTCAATGGCAACGTCTCTCAGCTGGATATTCAGTGGACTGGA
GTCCTGAGTGGTGAGGATGAGGGAACATCAGTCTTTGAAAAGGTGGCATAG
Transcript >OphauB2|7049
ATGAAGTTGGAAAGTTTAGCATTGGCCCTGGCGGCCAGAGTCTGCGCTCTTGCAGCCGAGCTTCAGAGCCCACTG
GGGCAAGGCGTCGGACAGCAACAGGGACCTCTGACTGCTGAATTTGACGATTTTGTTGCCGACAAGCTCCGAGAA
TGGAAAGTGCCAGGCATGTCTCTGGCTGTCATTGACGGACACAAAGTCTATGCCAAGGGATATGGATTTGCTACG
CTGCCCAGCACGCCGGCCACGCCAGACACGCTGTGGTATGGCGCATCGACAACAAAGGCATACGTGGCCGCCACC
CTGGGGCATCTCATAGACTCGGGAGAGCACGCAGAGCTGGCCAAGGGCTGGGACACGGCCATGGCGTCCATCCTT
GGCGACGACTTTGTCCTCGAGGATGAATGGGCCACAAATCATGTAACGCTCGACGACGCCGTCAGTCACCGCAGT
GGCATGACGCGGCATGACAAGTCGTGTGTGCACATGGTTAATGGGAGCCAGGCATCGCCCAGAGACATTGTACGC
AACATGAGGAATCTGCCCCTGAAGCGCGAGCCACGCGTCAAGTATTCTTATTGCAACCTCATGTATGTGGCTCTG
GGCCATGCTCTGGAAAGACTCACTCGTCAGCCCGTGGCCAAGCTGTTGCATGACGTGATATGGAGGCCCCTTGGT
ATGAAGGCCACCTTTGTCCATCTCGACGACGCTCAGCAGGCGCCACAGCATCTGGCCTCGGGGTACTGGTGGGAC
GACGAGACGGACAGCTTCAAGCCCGTCGAGAATATGCATCTCTCCGAGCTCGTCTCTGCCGGCGGAATCATCTCC
AACGTGCTTGATTATGCCCAGTGGGTCAAGTGTCTGATTCATCAGCAAGCGCCCTTTTCCAACAGGGTCCACGCC
GATATCAGAAGGCCTAGAACCATCAAGGACGACGTGTCGCTGCCGGGACTGGAATTCTCTCTCTATGGACTCGGG
TGGGAGCACAGGAGCTACATGGGACACACCGTCTTGACACATAGTGGCATACTCGACGCTTTTGGAGCCCAGGTC
TACTGGCTGCCAGACGCCAAGTTTGGTGCCGTCGCCTTTGCCAACACTGCGTGGACTTCCAACGCCGTCCAAGAC
ATTGCCATCCATCGCTTAATACGCGACAAACTGGGTATCCCGCAGGGCGGCATGGTTGATGTAGACAAGATTTGG
AAAGACTTGTTGTTCAGTATGAAGCATGCCGGGGACAAGGTGGACCAACGCTTGTTCCCGGACCGAGCAGATCCC
CCCTGCCCATCCACATTCAGGGCTGAGAGCCTCGAGGGCACGTATTCAAATCCAGGCTTTGGAGAATTCACACTG
CATCGAGAACTGGATCCCGAGAGACCAGCAGACATTGTTCTCGTGGCAGACCGGAGCAACATGACGTGGCGCTAC
CAGTTTAGGCTGCACCACGTGTCAGGAAACTTCTGGGTCGTCCATGCCACCGTTGCAGGGAACCCAACATTTCTT
CATGATTATCACAGGGGCGAATTCAGGGCCGGGGTCAATGGCAACGTCTCTCAGCTGGATATTCAGTGGACTGGA
GTCCTGAGTGGTGAGGATGAGGGAACATCAGTCTTTGAAAAGGTGGCATAG
Gene >OphauB2|7049
ATGAAGTTGGAAAGTTTAGCATTGGCCCTGGCGGCCAGAGTCTGCGCTCTTGCAGCCGAGCTTCAGAGCCCACTG
GGGCAAGGCGTCGGACAGCAACAGGGACCTCTGACTGCTGAATTTGACGATTTTGTTGCCGACAAGCTCCGAGAA
TGGAAAGTGCCAGGCATGTCTCTGGCTGTCATTGACGGACACAAAGTCTATGCCAAGGTTTCAAGATAGGCCCTC
TTGGACATTGAAGGGGCTGCCACTCTGACAATGGGCAGGGATATGGATTTGCTACGCTGCCCAGCACGCCGGCCA
CGCCAGACACGCTGTGGTATGGCGCATCGACAACAAAGGCATACGTGGCCGCCACCCTGGGGCATCTCATAGACT
CGGGAGAGCACGCAGAGCTGGCCAAGGGCTGGGACACGGCCATGGCGTCCATCCTTGGCGACGACTTTGTCCTCG
AGGATGAATGGGCCACAAATCATGTAACGCTCGACGACGCCGTCAGTCACCGCAGTGGCATGACGCGGCATGACA
AGTCGTGTGTGCACATGGTTAATGGGAGCCAGGCATCGCCCAGAGACATTGTACGCAACATGAGGAATCTGCCCC
TGAAGCGCGAGCCACGCGTCAAGTATTCTTATTGCAACCTCATGTATGTGGCTCTGGGCCATGCTCTGGAAAGAC
TCACTCGTCAGCCCGTGGCCAAGCTGTTGCATGACGTGATATGGAGGCCCCTTGGTATGAAGGCCACCTTTGTCC
ATCTCGACGACGCTCAGCAGGCGCCACAGCATCTGGCCTCGGGGTACTGGTGGGACGACGAGACGGACAGCTTCA
AGCCCGTCGAGAATATGCATCTCTCCGAGCTCGTCTCTGCCGGCGGAATCATCTCCAACGTGCTTGATTATGCCC
AGTGGGTCAAGTGTCTGATTCATCAGCAAGCGCCCTTTTCCAACAGGGTCCACGCCGATATCAGAAGGCCTAGAA
CCATCAAGGACGACGTGTCGCTGCCGGGACTGGAATTCTCTCTCTATGGACTCGGGTGGGAGCACAGGAGCTACA
TGGGACACACCGTCTTGACACATAGTGGCATACTCGACGCTTTTGGAGCCCAGGTCTACTGGCTGCCAGACGCCA
AGTTTGGTGCCGTCGCCTTTGCCAACACTGCGTGGACTTCCAACGCCGTCCAAGACATTGCCATCCATCGCTTAA
TACGCGACAAACTGGGTATCCCGCAGGGCGGCATGGTTGATGTAGACAAGATGTATGTTCACGACAAACCAAGAC
ACACCTTGTTGAAACTTACCCGTTTGACTTAGTTGGAAAGACTTGTTGTTCAGTATGAAGCATGCCGGGGACAAG
GTGGACCAACGCTTGTTCCCGGACCGAGCAGATCCCCCCTGCCCATCCACATTCAGGGCTGAGAGCCTCGAGGGC
ACGTATTCAAATCCAGGCTTTGGAGAATTCACACTGCATCGAGAACTGGATCCCGAGAGACCAGCAGACATTGTT
CTCGTGGCAGACCGGAGCAACATGACGTGGCGCTACCAGTTTAGGCTGCACCACGTGTCAGGAAACTTCTGGGTC
GTCCATGCCACCGTTGCAGGGAACCCAACATTTCTTCATGATTATCACAGGGGCGAATTCAGGGCCGGGGTCAAT
GGCAACGTCTCTCAGCTGGATATTCAGTGGACTGGAGTCCTGAGTGGTGAGGATGAGGGAACATCAGTCTTTGAA
AAGGTGGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail