Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7046
Gene name
LocationContig_7:255770..257553
Strand+
Gene length (bp)1783
Transcript length (bp)1515
Coding sequence length (bp)1515
Protein length (aa) 505

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00790 VHS VHS domain 2.9E-37 9 140
PF00018 SH3_1 SH3 domain 2.5E-15 217 261
PF14604 SH3_9 Variant SH3 domain 7.7E-15 218 266
PF07653 SH3_2 Variant SH3 domain 8.4E-12 215 266
PF03127 GAT GAT domain 1.0E-10 291 362

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S6J4|HSE1_NEUCR Class E vacuolar protein-sorting machinery protein hse1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hse1 PE=3 SV=1 1 388 0.0E+00
sp|A4RF61|HSE1_MAGO7 Class E vacuolar protein-sorting machinery protein HSE1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HSE1 PE=3 SV=2 1 491 0.0E+00
sp|Q2GT05|HSE1_CHAGB Class E vacuolar protein-sorting machinery protein HSE1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HSE1 PE=3 SV=1 1 469 0.0E+00
sp|Q0CJU8|HSE1_ASPTN Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hse1 PE=3 SV=1 10 455 0.0E+00
sp|A1CEK6|HSE1_ASPCL Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hse1 PE=3 SV=1 10 467 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S6J4|HSE1_NEUCR Class E vacuolar protein-sorting machinery protein hse1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hse1 PE=3 SV=1 1 388 0.0E+00
sp|A4RF61|HSE1_MAGO7 Class E vacuolar protein-sorting machinery protein HSE1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HSE1 PE=3 SV=2 1 491 0.0E+00
sp|Q2GT05|HSE1_CHAGB Class E vacuolar protein-sorting machinery protein HSE1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HSE1 PE=3 SV=1 1 469 0.0E+00
sp|Q0CJU8|HSE1_ASPTN Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hse1 PE=3 SV=1 10 455 0.0E+00
sp|A1CEK6|HSE1_ASPCL Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hse1 PE=3 SV=1 10 467 0.0E+00
sp|Q1E878|HSE1_COCIM Class E vacuolar protein-sorting machinery protein HSE1 OS=Coccidioides immitis (strain RS) GN=HSE1 PE=3 SV=1 10 454 0.0E+00
sp|A2QW93|HSE1_ASPNC Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=hse1 PE=3 SV=1 10 470 0.0E+00
sp|A1DFN5|HSE1_NEOFI Class E vacuolar protein-sorting machinery protein hse1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hse1 PE=3 SV=1 10 469 0.0E+00
sp|Q5BBL4|HSE1_EMENI Class E vacuolar protein-sorting machinery protein hse1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hse1 PE=3 SV=1 10 455 1.0E-174
sp|Q0U6X7|HSE1_PHANO Class E vacuolar protein-sorting machinery protein HSE1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HSE1 PE=3 SV=1 10 455 6.0E-173
sp|Q4WHP5|HSE1_ASPFU Class E vacuolar protein-sorting machinery protein hse1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hse1 PE=3 SV=1 10 472 6.0E-167
sp|Q6C2N2|HSE1_YARLI Class E vacuolar protein-sorting machinery protein HSE1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HSE1 PE=3 SV=1 9 365 3.0E-107
sp|Q4P5J4|HSE1_USTMA Class E vacuolar protein-sorting machinery protein HSE1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HSE1 PE=3 SV=1 1 504 5.0E-100
sp|O74749|HSE1_SCHPO Class E vacuolar protein-sorting machinery protein hse1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hse1 PE=3 SV=1 8 367 4.0E-89
sp|Q6BNP6|HSE1_DEBHA Class E vacuolar protein-sorting machinery protein HSE1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HSE1 PE=3 SV=2 1 395 2.0E-80
sp|Q5A895|HSE1_CANAL Class E vacuolar protein-sorting machinery protein HSE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSE1 PE=3 SV=1 10 388 1.0E-76
sp|Q6FN49|HSE1_CANGA Class E vacuolar protein-sorting machinery protein HSE1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HSE1 PE=3 SV=1 14 421 2.0E-75
sp|Q75DS3|HSE1_ASHGO Class E vacuolar protein-sorting machinery protein HSE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HSE1 PE=3 SV=1 10 430 1.0E-72
sp|P38753|HSE1_YEAST Class E vacuolar protein-sorting machinery protein HSE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSE1 PE=1 SV=1 4 362 8.0E-67
sp|A3LXQ8|HSE1_PICST Class E vacuolar protein-sorting machinery protein HSE1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HSE1 PE=3 SV=2 10 372 1.0E-66
sp|Q6CVA8|HSE1_KLULA Class E vacuolar protein-sorting machinery protein HSE1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HSE1 PE=3 SV=1 12 361 4.0E-60
sp|Q92783|STAM1_HUMAN Signal transducing adapter molecule 1 OS=Homo sapiens GN=STAM PE=1 SV=3 6 427 2.0E-48
sp|P70297|STAM1_MOUSE Signal transducing adapter molecule 1 OS=Mus musculus GN=Stam PE=1 SV=3 6 418 1.0E-46
sp|O75886|STAM2_HUMAN Signal transducing adapter molecule 2 OS=Homo sapiens GN=STAM2 PE=1 SV=1 7 391 2.0E-46
sp|O93436|STAM2_CHICK Signal transducing adapter molecule 2 OS=Gallus gallus GN=STAM2 PE=1 SV=1 5 371 8.0E-44
sp|O88811|STAM2_MOUSE Signal transducing adapter molecule 2 OS=Mus musculus GN=Stam2 PE=1 SV=1 7 361 2.0E-43
sp|Q5XHY7|STAM2_RAT Signal transducing adapter molecule 2 OS=Rattus norvegicus GN=Stam2 PE=2 SV=1 7 361 4.0E-42
sp|P0CR78|HSE1_CRYNJ Class E vacuolar protein-sorting machinery protein HSE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HSE1 PE=3 SV=1 1 148 1.0E-38
sp|P0CR79|HSE1_CRYNB Class E vacuolar protein-sorting machinery protein HSE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HSE1 PE=3 SV=1 1 148 4.0E-38
sp|P0CR78|HSE1_CRYNJ Class E vacuolar protein-sorting machinery protein HSE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HSE1 PE=3 SV=1 212 360 2.0E-35
sp|P0CR79|HSE1_CRYNB Class E vacuolar protein-sorting machinery protein HSE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HSE1 PE=3 SV=1 212 360 2.0E-34
sp|O01498|STAM1_CAEEL Signal transducing adapter molecule 1 OS=Caenorhabditis elegans GN=stam-1 PE=1 SV=2 10 375 2.0E-21
sp|Q99LI8|HGS_MOUSE Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Mus musculus GN=Hgs PE=1 SV=2 6 139 5.0E-18
sp|Q9JJ50|HGS_RAT Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Rattus norvegicus GN=Hgs PE=1 SV=1 6 139 5.0E-18
sp|Q0V8S0|HGS_BOVIN Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Bos taurus GN=HGS PE=2 SV=1 6 139 8.0E-18
sp|O14964|HGS_HUMAN Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens GN=HGS PE=1 SV=1 6 139 8.0E-18
sp|Q5SRX1|TM1L2_MOUSE TOM1-like protein 2 OS=Mus musculus GN=Tom1l2 PE=1 SV=1 1 140 2.0E-17
sp|Q68FJ8|TM1L2_XENLA TOM1-like protein 2 OS=Xenopus laevis GN=tom1l2 PE=2 SV=1 1 140 5.0E-17
sp|Q6ZVM7|TM1L2_HUMAN TOM1-like protein 2 OS=Homo sapiens GN=TOM1L2 PE=1 SV=1 1 140 7.0E-17
sp|Q0U4Z8|VPS27_PHANO Vacuolar protein sorting-associated protein 27 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=VPS27 PE=3 SV=1 2 140 3.0E-16
sp|Q0CJV3|VPS27_ASPTN Vacuolar protein sorting-associated protein 27 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=vps27 PE=3 SV=1 5 140 1.0E-15
sp|O60784|TOM1_HUMAN Target of Myb protein 1 OS=Homo sapiens GN=TOM1 PE=1 SV=2 1 140 1.0E-15
sp|Q4WHN8|VPS27_ASPFU Vacuolar protein sorting-associated protein 27 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=vps27 PE=3 SV=1 5 140 2.0E-15
sp|O88746|TOM1_MOUSE Target of Myb protein 1 OS=Mus musculus GN=Tom1 PE=1 SV=1 1 140 6.0E-15
sp|A1DFP5|VPS27_NEOFI Vacuolar protein sorting-associated protein 27 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=vps27 PE=3 SV=1 10 139 6.0E-15
sp|O75674|TM1L1_HUMAN TOM1-like protein 1 OS=Homo sapiens GN=TOM1L1 PE=1 SV=2 2 138 8.0E-15
sp|A1CEK1|VPS27_ASPCL Vacuolar protein sorting-associated protein 27 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=vps27 PE=3 SV=1 5 139 3.0E-14
sp|O12940|TOM1_CHICK Target of Myb protein 1 OS=Gallus gallus GN=TOM1 PE=2 SV=2 1 140 4.0E-14
sp|O43125|CSH3_SCHPO Protein csh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csh3 PE=2 SV=1 208 270 1.0E-13
sp|Q6CFT4|VPS27_YARLI Vacuolar protein sorting-associated protein 27 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=VPS27 PE=3 SV=1 10 139 1.0E-13
sp|A2QWA2|VPS27_ASPNC Vacuolar protein sorting-associated protein 27 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=vps27 PE=3 SV=1 14 139 2.0E-13
sp|Q4P7Q1|VPS27_USTMA Vacuolar protein sorting-associated protein 27 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=VPS27 PE=3 SV=1 1 139 2.0E-13
sp|F1LM81|TM1L1_RAT TOM1-like protein 1 OS=Rattus norvegicus GN=Tom1l1 PE=1 SV=1 2 138 2.0E-13
sp|Q5BBK9|VPS27_EMENI Vacuolar protein sorting-associated protein 27 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=vps27 PE=3 SV=1 5 139 3.0E-13
sp|Q2GS33|VPS27_CHAGB Vacuolar protein sorting-associated protein 27 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=VPS27 PE=3 SV=2 2 140 3.0E-13
sp|Q923U0|TM1L1_MOUSE TOM1-like protein 1 OS=Mus musculus GN=Tom1l1 PE=1 SV=1 2 138 3.0E-13
sp|Q9UJY4|GGA2_HUMAN ADP-ribosylation factor-binding protein GGA2 OS=Homo sapiens GN=GGA2 PE=1 SV=3 16 151 8.0E-13
sp|P0CS26|VPS27_CRYNJ Vacuolar protein sorting-associated protein 27 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=VPS27 PE=3 SV=1 24 145 2.0E-12
sp|P0CS27|VPS27_CRYNB Vacuolar protein sorting-associated protein 27 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=VPS27 PE=3 SV=1 24 145 2.0E-12
sp|Q07883|GRB2_CHICK Growth factor receptor-bound protein 2 OS=Gallus gallus GN=GRB2 PE=1 SV=1 216 265 4.0E-12
sp|Q6P5E6|GGA2_MOUSE ADP-ribosylation factor-binding protein GGA2 OS=Mus musculus GN=Gga2 PE=1 SV=1 16 156 4.0E-12
sp|A4QTV1|VPS27_MAGO7 Vacuolar protein sorting-associated protein 27 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=VPS27 PE=3 SV=1 2 140 5.0E-12
sp|Q54GH3|TOM1_DICDI Target of Myb protein 1 OS=Dictyostelium discoideum GN=tom1 PE=1 SV=1 12 141 5.0E-12
sp|Q60631|GRB2_MOUSE Growth factor receptor-bound protein 2 OS=Mus musculus GN=Grb2 PE=1 SV=1 216 265 6.0E-12
sp|P62994|GRB2_RAT Growth factor receptor-bound protein 2 OS=Rattus norvegicus GN=Grb2 PE=1 SV=1 216 265 6.0E-12
sp|Q5R4J7|GRB2_PONAB Growth factor receptor-bound protein 2 OS=Pongo abelii GN=GRB2 PE=2 SV=1 216 265 6.0E-12
sp|P62993|GRB2_HUMAN Growth factor receptor-bound protein 2 OS=Homo sapiens GN=GRB2 PE=1 SV=1 216 265 6.0E-12
sp|Q6YKA8|DRK_DROSI Protein E(sev)2B OS=Drosophila simulans GN=drk PE=3 SV=1 216 265 7.0E-12
sp|Q08012|DRK_DROME Protein enhancer of sevenless 2B OS=Drosophila melanogaster GN=drk PE=1 SV=1 216 265 7.0E-12
sp|Q8AXV1|SH3G2_CHICK Endophilin-A1 OS=Gallus gallus GN=SH3GL2 PE=1 SV=1 216 274 8.0E-12
sp|Q66II3|GRB2_XENTR Growth factor receptor-bound protein 2 OS=Xenopus tropicalis GN=grb2 PE=2 SV=1 216 265 1.0E-11
sp|Q6GPJ9|GRB2B_XENLA Growth factor receptor-bound protein 2-B OS=Xenopus laevis GN=grb2-b PE=1 SV=1 216 265 1.0E-11
sp|P29355|SEM5_CAEEL Sex muscle abnormal protein 5 OS=Caenorhabditis elegans GN=sem-5 PE=1 SV=1 216 265 3.0E-11
sp|Q7RZJ2|VPS27_NEUCR Vacuolar protein sorting-associated protein 27 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vps27 PE=3 SV=2 2 140 3.0E-11
sp|O35180|SH3G3_RAT Endophilin-A3 OS=Rattus norvegicus GN=Sh3gl3 PE=1 SV=2 167 273 6.0E-11
sp|Q960X8|HRS_DROME Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Drosophila melanogaster GN=Hrs PE=1 SV=1 10 139 7.0E-11
sp|Q62420|SH3G2_MOUSE Endophilin-A1 OS=Mus musculus GN=Sh3gl2 PE=1 SV=2 216 269 9.0E-11
sp|O35179|SH3G2_RAT Endophilin-A1 OS=Rattus norvegicus GN=Sh3gl2 PE=1 SV=2 216 269 9.0E-11
sp|P87379|GRB2A_XENLA Growth factor receptor-bound protein 2-A OS=Xenopus laevis GN=grb2-a PE=1 SV=2 216 265 9.0E-11
sp|Q99962|SH3G2_HUMAN Endophilin-A1 OS=Homo sapiens GN=SH3GL2 PE=1 SV=1 216 269 1.0E-10
sp|A6QLK6|GRAP_BOVIN GRB2-related adapter protein OS=Bos taurus GN=GRAP PE=2 SV=1 218 265 1.0E-10
sp|Q8AXV0|SH3G1_CHICK Endophilin-A2 OS=Gallus gallus GN=SH3GL1 PE=1 SV=1 190 273 2.0E-10
sp|Q8I1C0|SH3G3_DROPS Endophilin-A OS=Drosophila pseudoobscura pseudoobscura GN=EndoA PE=3 SV=1 206 265 2.0E-10
sp|Q62421|SH3G3_MOUSE Endophilin-A3 OS=Mus musculus GN=Sh3gl3 PE=1 SV=1 216 273 3.0E-10
sp|Q99963|SH3G3_HUMAN Endophilin-A3 OS=Homo sapiens GN=SH3GL3 PE=1 SV=1 193 273 3.0E-10
sp|Q8I1A6|SH3G3_DROWI Endophilin-A OS=Drosophila willistoni GN=EndoA PE=3 SV=1 218 265 3.0E-10
sp|Q8MJ50|OSTF1_BOVIN Osteoclast-stimulating factor 1 OS=Bos taurus GN=OSTF1 PE=2 SV=1 213 265 4.0E-10
sp|Q5ZJJ9|OSTF1_CHICK Osteoclast-stimulating factor 1 OS=Gallus gallus GN=OSTF1 PE=2 SV=1 213 265 4.0E-10
sp|Q06449|PIN3_YEAST [PSI+] inducibility protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIN3 PE=1 SV=1 157 265 4.0E-10
sp|Q8BMI3|GGA3_MOUSE ADP-ribosylation factor-binding protein GGA3 OS=Mus musculus GN=Gga3 PE=1 SV=2 16 157 5.0E-10
sp|Q8I190|SH3G3_DROVI Endophilin-A OS=Drosophila virilis GN=EndoA PE=3 SV=1 216 265 5.0E-10
sp|Q6P686|OSTF1_RAT Osteoclast-stimulating factor 1 OS=Rattus norvegicus GN=Ostf1 PE=1 SV=1 213 265 6.0E-10
sp|Q62422|OSTF1_MOUSE Osteoclast-stimulating factor 1 OS=Mus musculus GN=Ostf1 PE=1 SV=2 213 265 6.0E-10
sp|Q8T390|SH3G3_DROME Endophilin-A OS=Drosophila melanogaster GN=EndoA PE=1 SV=1 218 265 7.0E-10
sp|Q8I1I3|SH3G3_DROER Endophilin-A OS=Drosophila erecta GN=EndoA PE=3 SV=1 218 265 7.0E-10
sp|Q9NZ52|GGA3_HUMAN ADP-ribosylation factor-binding protein GGA3 OS=Homo sapiens GN=GGA3 PE=1 SV=1 16 157 8.0E-10
sp|Q8MJ49|OSTF1_PIG Osteoclast-stimulating factor 1 OS=Sus scrofa GN=OSTF1 PE=2 SV=1 213 265 8.0E-10
sp|Q92882|OSTF1_HUMAN Osteoclast-stimulating factor 1 OS=Homo sapiens GN=OSTF1 PE=1 SV=2 213 265 9.0E-10
sp|Q3SZ01|SH3Y1_BOVIN SH3 domain-containing YSC84-like protein 1 OS=Bos taurus GN=SH3YL1 PE=2 SV=1 216 265 1.0E-09
sp|O35964|SH3G1_RAT Endophilin-A2 OS=Rattus norvegicus GN=Sh3gl1 PE=1 SV=1 216 273 1.0E-09
sp|Q62419|SH3G1_MOUSE Endophilin-A2 OS=Mus musculus GN=Sh3gl1 PE=1 SV=1 216 273 1.0E-09
sp|Q99961|SH3G1_HUMAN Endophilin-A2 OS=Homo sapiens GN=SH3GL1 PE=1 SV=1 216 273 1.0E-09
sp|Q99469|STAC_HUMAN SH3 and cysteine-rich domain-containing protein OS=Homo sapiens GN=STAC PE=1 SV=1 218 268 2.0E-09
sp|Q15080|NCF4_HUMAN Neutrophil cytosol factor 4 OS=Homo sapiens GN=NCF4 PE=1 SV=2 215 270 2.0E-09
sp|Q2KJA1|SH3G1_BOVIN Endophilin-A2 OS=Bos taurus GN=SH3GL1 PE=2 SV=1 216 273 2.0E-09
sp|Q4R729|SH321_MACFA SH3 domain-containing protein 21 OS=Macaca fascicularis GN=SH3D21 PE=2 SV=1 217 265 2.0E-09
sp|A4FU49|SH321_HUMAN SH3 domain-containing protein 21 OS=Homo sapiens GN=SH3D21 PE=2 SV=2 217 265 2.0E-09
sp|Q8AXU9|SH3G3_CHICK Endophilin-A3 OS=Gallus gallus GN=SH3GL3 PE=1 SV=1 216 273 3.0E-09
sp|Q9JLQ0|CD2AP_MOUSE CD2-associated protein OS=Mus musculus GN=Cd2ap PE=1 SV=3 215 286 3.0E-09
sp|Q6XJU9|OSTF1_MONAL Osteoclast-stimulating factor 1 OS=Monopterus albus GN=ostf1 PE=2 SV=1 213 265 3.0E-09
sp|Q7ZYG4|OSTF1_XENLA Osteoclast-stimulating factor 1 OS=Xenopus laevis GN=ostf1 PE=2 SV=1 213 265 3.0E-09
sp|Q3UTJ2|SRBS2_MOUSE Sorbin and SH3 domain-containing protein 2 OS=Mus musculus GN=Sorbs2 PE=1 SV=2 217 271 3.0E-09
sp|F1LRS8|CD2AP_RAT CD2-associated protein OS=Rattus norvegicus GN=Cd2ap PE=1 SV=2 215 286 4.0E-09
sp|Q6TGW5|OSTF1_DANRE Osteoclast-stimulating factor 1 OS=Danio rerio GN=ostf1 PE=2 SV=1 213 265 4.0E-09
sp|O35413|SRBS2_RAT Sorbin and SH3 domain-containing protein 2 OS=Rattus norvegicus GN=Sorbs2 PE=1 SV=2 217 271 4.0E-09
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 208 275 4.0E-09
sp|O94875|SRBS2_HUMAN Sorbin and SH3 domain-containing protein 2 OS=Homo sapiens GN=SORBS2 PE=1 SV=3 217 271 4.0E-09
sp|Q5RAQ2|SH3Y1_PONAB SH3 domain-containing YSC84-like protein 1 OS=Pongo abelii GN=SH3YL1 PE=2 SV=1 216 265 6.0E-09
sp|Q96HL8|SH3Y1_HUMAN SH3 domain-containing YSC84-like protein 1 OS=Homo sapiens GN=SH3YL1 PE=1 SV=1 216 265 6.0E-09
sp|P43603|LSB3_YEAST LAS seventeen-binding protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSB3 PE=1 SV=3 218 266 6.0E-09
sp|A7A261|LSB3_YEAS7 LAS seventeen-binding protein 3 OS=Saccharomyces cerevisiae (strain YJM789) GN=LSB3 PE=3 SV=2 218 266 6.0E-09
sp|P53281|LSB1_YEAST LAS seventeen-binding protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSB1 PE=1 SV=1 209 265 8.0E-09
sp|P32793|YSC84_YEAST Protein YSC84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSC84 PE=1 SV=2 208 265 9.0E-09
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 213 275 9.0E-09
sp|A0JNJ1|STAC_BOVIN SH3 and cysteine-rich domain-containing protein OS=Bos taurus GN=STAC PE=2 SV=1 218 268 9.0E-09
sp|O89100|GRAP2_MOUSE GRB2-related adaptor protein 2 OS=Mus musculus GN=Grap2 PE=1 SV=1 210 265 1.0E-08
sp|Q7TSG5|SH321_MOUSE SH3 domain-containing protein 21 OS=Mus musculus GN=Sh3d21 PE=1 SV=1 209 297 1.0E-08
sp|P97306|STAC_MOUSE SH3 and cysteine-rich domain-containing protein OS=Mus musculus GN=Stac PE=2 SV=1 218 268 1.0E-08
sp|Q5HYK7|SH319_HUMAN SH3 domain-containing protein 19 OS=Homo sapiens GN=SH3D19 PE=1 SV=2 215 268 1.0E-08
sp|Q13588|GRAP_HUMAN GRB2-related adapter protein OS=Homo sapiens GN=GRAP PE=1 SV=1 218 265 1.0E-08
sp|B0BNA1|SH3Y1_RAT SH3 domain-containing YSC84-like protein 1 OS=Rattus norvegicus GN=Sh3yl1 PE=2 SV=1 216 265 2.0E-08
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus GN=Itsn2 PE=1 SV=2 181 275 2.0E-08
sp|O08641|SH3Y1_MOUSE SH3 domain-containing YSC84-like protein 1 OS=Mus musculus GN=Sh3yl1 PE=1 SV=1 216 265 2.0E-08
sp|Q9URW6|YIE2_SCHPO SH3 domain-containing protein PJ696.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPJ696.02 PE=1 SV=1 217 265 3.0E-08
sp|P97369|NCF4_MOUSE Neutrophil cytosol factor 4 OS=Mus musculus GN=Ncf4 PE=1 SV=2 215 275 3.0E-08
sp|A3LX75|VPS27_PICST Vacuolar protein sorting-associated protein 27 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=VPS27 PE=3 SV=2 2 139 3.0E-08
sp|O75791|GRAP2_HUMAN GRB2-related adapter protein 2 OS=Homo sapiens GN=GRAP2 PE=1 SV=1 210 269 3.0E-08
sp|Q91X43|SH319_MOUSE SH3 domain-containing protein 19 OS=Mus musculus GN=Sh3d19 PE=1 SV=2 215 268 4.0E-08
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 213 275 5.0E-08
sp|Q9WVE9|ITSN1_RAT Intersectin-1 OS=Rattus norvegicus GN=Itsn1 PE=1 SV=1 213 275 5.0E-08
sp|Q6XZF7|DNMBP_HUMAN Dynamin-binding protein OS=Homo sapiens GN=DNMBP PE=1 SV=1 218 275 7.0E-08
sp|P10569|MYSC_ACACA Myosin IC heavy chain OS=Acanthamoeba castellanii GN=MIC PE=1 SV=1 217 268 7.0E-08
sp|P19878|NCF2_HUMAN Neutrophil cytosol factor 2 OS=Homo sapiens GN=NCF2 PE=1 SV=2 214 280 7.0E-08
sp|P38817|GGA2_YEAST ADP-ribosylation factor-binding protein GGA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GGA2 PE=1 SV=1 5 184 8.0E-08
sp|O42287|ITSN1_XENLA Intersectin-1 OS=Xenopus laevis GN=itsn1 PE=1 SV=1 208 275 1.0E-07
sp|Q5HYK7|SH319_HUMAN SH3 domain-containing protein 19 OS=Homo sapiens GN=SH3D19 PE=1 SV=2 214 270 2.0E-07
sp|P07751|SPTN1_CHICK Spectrin alpha chain, non-erythrocytic 1 OS=Gallus gallus GN=SPTAN1 PE=1 SV=3 216 348 2.0E-07
sp|O77775|NCF2_BOVIN Neutrophil cytosol factor 2 OS=Bos taurus GN=NCF2 PE=2 SV=1 214 274 2.0E-07
sp|Q14155|ARHG7_HUMAN Rho guanine nucleotide exchange factor 7 OS=Homo sapiens GN=ARHGEF7 PE=1 SV=2 216 265 2.0E-07
sp|Q6NRD3|SH3R1_XENLA E3 ubiquitin-protein ligase SH3RF1 OS=Xenopus laevis GN=sh3rf1 PE=1 SV=1 217 273 2.0E-07
sp|Q8C120|SH3R3_MOUSE SH3 domain-containing RING finger protein 3 OS=Mus musculus GN=Sh3rf3 PE=1 SV=2 209 392 2.0E-07
sp|Q9CX99|GRAP_MOUSE GRB2-related adapter protein OS=Mus musculus GN=Grap PE=1 SV=1 218 265 2.0E-07
sp|Q9Y5K6|CD2AP_HUMAN CD2-associated protein OS=Homo sapiens GN=CD2AP PE=1 SV=1 215 285 2.0E-07
sp|Q13813|SPTN1_HUMAN Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3 216 348 2.0E-07
sp|Q28E95|SH3R1_XENTR E3 ubiquitin-protein ligase SH3RF1 OS=Xenopus tropicalis GN=sh3rf1 PE=2 SV=1 217 273 3.0E-07
sp|P02549|SPTA1_HUMAN Spectrin alpha chain, erythrocytic 1 OS=Homo sapiens GN=SPTA1 PE=1 SV=5 200 268 3.0E-07
sp|P34109|MYOD_DICDI Myosin ID heavy chain OS=Dictyostelium discoideum GN=myoD PE=1 SV=2 217 273 3.0E-07
sp|Q6WKZ7|NOSTN_MOUSE Nostrin OS=Mus musculus GN=Nostrin PE=1 SV=2 216 268 3.0E-07
sp|Q69ZI1|SH3R1_MOUSE E3 ubiquitin-protein ligase SH3RF1 OS=Mus musculus GN=Sh3rf1 PE=1 SV=2 217 294 5.0E-07
sp|Q8R0H9|GGA1_MOUSE ADP-ribosylation factor-binding protein GGA1 OS=Mus musculus GN=Gga1 PE=1 SV=1 14 168 6.0E-07
sp|A5D7F8|SH3R1_BOVIN E3 ubiquitin-protein ligase SH3RF1 OS=Bos taurus GN=SH3RF1 PE=2 SV=1 217 294 6.0E-07
sp|Q7Z6J0|SH3R1_HUMAN E3 ubiquitin-protein ligase SH3RF1 OS=Homo sapiens GN=SH3RF1 PE=1 SV=2 217 294 6.0E-07
sp|Q71F54|SH3R1_RAT E3 ubiquitin-protein ligase SH3RF1 OS=Rattus norvegicus GN=Sh3rf1 PE=1 SV=1 217 294 6.0E-07
sp|P16546|SPTN1_MOUSE Spectrin alpha chain, non-erythrocytic 1 OS=Mus musculus GN=Sptan1 PE=1 SV=4 216 271 6.0E-07
sp|Q5RBR0|SH3R1_PONAB E3 ubiquitin-protein ligase SH3RF1 OS=Pongo abelii GN=SH3RF1 PE=2 SV=1 217 294 6.0E-07
sp|P16086|SPTN1_RAT Spectrin alpha chain, non-erythrocytic 1 OS=Rattus norvegicus GN=Sptan1 PE=1 SV=2 216 271 6.0E-07
sp|Q557J6|DBNL_DICDI Drebrin-like protein OS=Dictyostelium discoideum GN=abpE-1 PE=2 SV=1 215 268 6.0E-07
sp|Q9P7E8|APP1_SCHPO Protein app1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=app1 PE=2 SV=1 216 268 6.0E-07
sp|Q66HL2|SRC8_RAT Src substrate cortactin OS=Rattus norvegicus GN=Cttn PE=1 SV=1 218 266 7.0E-07
sp|Q8IVI9|NOSTN_HUMAN Nostrin OS=Homo sapiens GN=NOSTRIN PE=1 SV=2 193 268 7.0E-07
sp|A5D8S5|SH3R1_DANRE E3 ubiquitin-protein ligase SH3RF1 OS=Danio rerio GN=sh3rf1 PE=2 SV=2 217 294 8.0E-07
sp|Q01406|SRC8_CHICK Src substrate protein p85 OS=Gallus gallus GN=CTTN1 PE=1 SV=1 218 266 9.0E-07
sp|Q2KJB5|NOSTN_BOVIN Nostrin OS=Bos taurus GN=NOSTRIN PE=1 SV=1 191 268 9.0E-07
sp|Q14247|SRC8_HUMAN Src substrate cortactin OS=Homo sapiens GN=CTTN PE=1 SV=2 218 266 9.0E-07
sp|O70145|NCF2_MOUSE Neutrophil cytosol factor 2 OS=Mus musculus GN=Ncf2 PE=1 SV=1 214 280 1.0E-06
sp|O13821|VPS27_SCHPO Vacuolar protein sorting-associated protein 27 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sst4 PE=3 SV=1 10 149 1.0E-06
sp|Q60598|SRC8_MOUSE Src substrate cortactin OS=Mus musculus GN=Cttn PE=1 SV=2 218 266 1.0E-06
sp|Q96B97|SH3K1_HUMAN SH3 domain-containing kinase-binding protein 1 OS=Homo sapiens GN=SH3KBP1 PE=1 SV=2 220 276 1.0E-06
sp|Q925Q9|SH3K1_RAT SH3 domain-containing kinase-binding protein 1 OS=Rattus norvegicus GN=Sh3kbp1 PE=1 SV=2 220 276 1.0E-06
sp|Q8R550|SH3K1_MOUSE SH3 domain-containing kinase-binding protein 1 OS=Mus musculus GN=Sh3kbp1 PE=1 SV=1 220 276 1.0E-06
sp|Q5I0D6|NOSTN_RAT Nostrin OS=Rattus norvegicus GN=Nostrin PE=1 SV=1 216 268 2.0E-06
sp|Q6DTM3|AHI1_RAT Jouberin OS=Rattus norvegicus GN=Ahi1 PE=1 SV=1 216 265 2.0E-06
sp|Q16584|M3K11_HUMAN Mitogen-activated protein kinase kinase kinase 11 OS=Homo sapiens GN=MAP3K11 PE=1 SV=1 218 296 2.0E-06
sp|P13395|SPTCA_DROME Spectrin alpha chain OS=Drosophila melanogaster GN=alpha-Spec PE=1 SV=2 216 268 2.0E-06
sp|A7E3N2|NCF2_RAT Neutrophil cytosol factor 2 OS=Rattus norvegicus GN=Ncf2 PE=2 SV=1 214 266 2.0E-06
sp|Q54CL3|PEX13_DICDI Probable peroxisomal membrane protein PEX13 OS=Dictyostelium discoideum GN=pex13 PE=3 SV=1 215 269 3.0E-06
sp|Q6DFH5|SH3Y1_XENLA SH3 domain-containing YSC84-like protein 1 OS=Xenopus laevis GN=sh3yl1 PE=2 SV=1 218 265 3.0E-06
sp|P08032|SPTA1_MOUSE Spectrin alpha chain, erythrocytic 1 OS=Mus musculus GN=Spta1 PE=1 SV=3 210 276 3.0E-06
sp|Q80XI6|M3K11_MOUSE Mitogen-activated protein kinase kinase kinase 11 OS=Mus musculus GN=Map3k11 PE=1 SV=1 218 296 3.0E-06
sp|Q66HA1|M3K11_RAT Mitogen-activated protein kinase kinase kinase 11 OS=Rattus norvegicus GN=Map3k11 PE=1 SV=1 218 296 3.0E-06
sp|Q9UJY5|GGA1_HUMAN ADP-ribosylation factor-binding protein GGA1 OS=Homo sapiens GN=GGA1 PE=1 SV=1 14 166 3.0E-06
sp|Q555L8|Y4695_DICDI SH3 and F-BAR domain-containing protein DDB_G0274695 OS=Dictyostelium discoideum GN=DDB_G0274695 PE=3 SV=1 217 266 3.0E-06
sp|Q5U597|SKA2B_XENLA Src kinase-associated phosphoprotein 2-B OS=Xenopus laevis GN=skap2-b PE=2 SV=1 154 270 4.0E-06
sp|Q9QY17|PACN2_RAT Protein kinase C and casein kinase substrate in neurons 2 protein OS=Rattus norvegicus GN=Pacsin2 PE=1 SV=2 188 268 4.0E-06
sp|Q06336|GGA1_YEAST ADP-ribosylation factor-binding protein GGA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GGA1 PE=1 SV=1 14 171 5.0E-06
sp|Q8N157|AHI1_HUMAN Jouberin OS=Homo sapiens GN=AHI1 PE=1 SV=1 212 265 5.0E-06
sp|Q9WVE8|PACN2_MOUSE Protein kinase C and casein kinase substrate in neurons protein 2 OS=Mus musculus GN=Pacsin2 PE=1 SV=1 188 268 5.0E-06
sp|P46109|CRKL_HUMAN Crk-like protein OS=Homo sapiens GN=CRKL PE=1 SV=1 216 273 5.0E-06
sp|Q5U2U2|CRKL_RAT Crk-like protein OS=Rattus norvegicus GN=Crkl PE=1 SV=1 200 273 6.0E-06
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 187 273 8.0E-06
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 218 265 8.0E-06
sp|P47941|CRKL_MOUSE Crk-like protein OS=Mus musculus GN=Crkl PE=1 SV=2 208 273 8.0E-06
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus GN=Itsn2 PE=1 SV=2 177 268 9.0E-06
sp|Q9UNF0|PACN2_HUMAN Protein kinase C and casein kinase substrate in neurons protein 2 OS=Homo sapiens GN=PACSIN2 PE=1 SV=2 144 268 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0035091 phosphatidylinositol binding Yes
GO:0043130 ubiquitin binding Yes
GO:0003674 molecular_function No
GO:0005543 phospholipid binding No
GO:0005488 binding No
GO:0032182 ubiquitin-like protein binding No
GO:0008289 lipid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7046
MFGAAAAGPFDQVVAKATDEKLTSEDWGAIMEVCDKVSGDGNGPKEAVQSMMKRLAHRNANVQLYTLELAHALCQ
NCGKPMHREVSSRAFTEALLKLANDRNTHTQVKGKILEKVKDWSDMFSDDADLGIMDDAYHRLKQSNPTLQAPSA
PQKQGLTASDRQKEEDELQMALKLSLQEEDRKKKAVAPWTATTSGEAARPSDGAVAGTTAATVSRVRALYDFSPS
EPGELEFRRGDVIAVLESVYKDWWRGSLKGRTGIFPLNYVDKLTDPTPDELQREAQIEAEVFAEIKNVEKLLTLL
SASNTAPREEDNEEISKLYHQTLAIRPKLIKLIEKYSQKKDDFTQLNEKFIKARRDYEALLESSMSHPPQHNYQQ
YALRPFYSSAGPGESYQTPSQQQTPPASAPFYVAGTEVPTQQQQQPEQATLPHQSPYAHHRPQSTYGAQELATSV
YDSPMPPASAPGRVASPPATNQYGAAYQGRVQPEHQQYKPYVPPSAPGPDDYYR*
Coding >OphauB2|7046
ATGTTCGGAGCAGCAGCGGCTGGGCCGTTTGACCAAGTCGTCGCCAAGGCGACGGACGAGAAGCTCACATCAGAG
GACTGGGGCGCCATCATGGAGGTGTGCGACAAGGTCTCGGGGGATGGCAACGGGCCCAAGGAGGCAGTGCAGAGC
ATGATGAAGCGGCTGGCACATCGCAACGCCAACGTGCAGCTCTACACACTCGAGCTGGCGCACGCGCTGTGCCAA
AACTGCGGCAAGCCCATGCACCGCGAAGTGTCGAGCCGGGCCTTTACCGAGGCGCTGCTCAAGCTGGCCAACGAC
CGCAACACGCATACGCAGGTCAAGGGCAAGATTCTGGAAAAGGTCAAGGACTGGAGCGACATGTTTAGCGACGAT
GCCGACCTGGGCATCATGGACGACGCCTACCACCGGCTCAAGCAGAGCAATCCGACGCTGCAGGCGCCGAGCGCG
CCGCAAAAACAGGGCCTGACAGCGTCGGACCGGCAAAAGGAAGAGGACGAGCTGCAGATGGCGCTCAAGCTGAGT
CTGCAGGAAGAGGACCGCAAGAAGAAAGCGGTGGCGCCCTGGACAGCCACGACGAGTGGCGAGGCGGCGCGGCCC
AGCGATGGGGCGGTGGCGGGCACGACGGCGGCAACCGTCAGCCGCGTGCGCGCCCTCTACGACTTCTCGCCCTCG
GAGCCGGGCGAGCTCGAGTTTCGGCGCGGCGACGTGATTGCAGTGCTGGAGAGCGTCTACAAGGACTGGTGGCGC
GGCTCGCTCAAGGGCCGCACCGGCATCTTTCCCCTCAACTACGTGGACAAGCTGACGGACCCTACGCCCGACGAG
CTGCAGCGCGAGGCGCAAATCGAGGCCGAGGTGTTTGCCGAGATCAAGAATGTGGAGAAGCTGCTGACGCTGCTG
AGCGCCTCCAACACGGCGCCGCGCGAAGAGGACAATGAGGAGATATCGAAGCTCTACCACCAAACACTGGCCATC
CGCCCAAAGCTCATCAAGCTGATTGAAAAGTACTCGCAAAAAAAGGACGACTTTACCCAGCTCAACGAAAAGTTC
ATCAAGGCGCGCAGGGACTACGAGGCGCTGCTCGAGTCGAGCATGTCGCATCCGCCCCAGCACAACTACCAGCAG
TACGCGCTGCGCCCCTTTTACTCGTCGGCCGGCCCGGGCGAGTCGTACCAGACACCCTCGCAGCAGCAGACGCCG
CCAGCTTCGGCCCCCTTTTACGTGGCCGGCACAGAGGTGCCCACGCAGCAGCAGCAGCAGCCAGAGCAAGCCACT
CTGCCCCATCAGTCGCCCTATGCTCACCACCGCCCGCAAAGCACCTATGGTGCCCAAGAGCTGGCCACGTCGGTC
TACGATTCGCCAATGCCACCCGCTTCTGCTCCCGGCCGTGTCGCCTCGCCCCCAGCCACCAACCAGTACGGCGCT
GCCTACCAGGGCCGCGTCCAGCCCGAGCACCAGCAGTACAAGCCATATGTGCCGCCCAGTGCGCCTGGGCCTGAT
GACTATTATCGATGA
Transcript >OphauB2|7046
ATGTTCGGAGCAGCAGCGGCTGGGCCGTTTGACCAAGTCGTCGCCAAGGCGACGGACGAGAAGCTCACATCAGAG
GACTGGGGCGCCATCATGGAGGTGTGCGACAAGGTCTCGGGGGATGGCAACGGGCCCAAGGAGGCAGTGCAGAGC
ATGATGAAGCGGCTGGCACATCGCAACGCCAACGTGCAGCTCTACACACTCGAGCTGGCGCACGCGCTGTGCCAA
AACTGCGGCAAGCCCATGCACCGCGAAGTGTCGAGCCGGGCCTTTACCGAGGCGCTGCTCAAGCTGGCCAACGAC
CGCAACACGCATACGCAGGTCAAGGGCAAGATTCTGGAAAAGGTCAAGGACTGGAGCGACATGTTTAGCGACGAT
GCCGACCTGGGCATCATGGACGACGCCTACCACCGGCTCAAGCAGAGCAATCCGACGCTGCAGGCGCCGAGCGCG
CCGCAAAAACAGGGCCTGACAGCGTCGGACCGGCAAAAGGAAGAGGACGAGCTGCAGATGGCGCTCAAGCTGAGT
CTGCAGGAAGAGGACCGCAAGAAGAAAGCGGTGGCGCCCTGGACAGCCACGACGAGTGGCGAGGCGGCGCGGCCC
AGCGATGGGGCGGTGGCGGGCACGACGGCGGCAACCGTCAGCCGCGTGCGCGCCCTCTACGACTTCTCGCCCTCG
GAGCCGGGCGAGCTCGAGTTTCGGCGCGGCGACGTGATTGCAGTGCTGGAGAGCGTCTACAAGGACTGGTGGCGC
GGCTCGCTCAAGGGCCGCACCGGCATCTTTCCCCTCAACTACGTGGACAAGCTGACGGACCCTACGCCCGACGAG
CTGCAGCGCGAGGCGCAAATCGAGGCCGAGGTGTTTGCCGAGATCAAGAATGTGGAGAAGCTGCTGACGCTGCTG
AGCGCCTCCAACACGGCGCCGCGCGAAGAGGACAATGAGGAGATATCGAAGCTCTACCACCAAACACTGGCCATC
CGCCCAAAGCTCATCAAGCTGATTGAAAAGTACTCGCAAAAAAAGGACGACTTTACCCAGCTCAACGAAAAGTTC
ATCAAGGCGCGCAGGGACTACGAGGCGCTGCTCGAGTCGAGCATGTCGCATCCGCCCCAGCACAACTACCAGCAG
TACGCGCTGCGCCCCTTTTACTCGTCGGCCGGCCCGGGCGAGTCGTACCAGACACCCTCGCAGCAGCAGACGCCG
CCAGCTTCGGCCCCCTTTTACGTGGCCGGCACAGAGGTGCCCACGCAGCAGCAGCAGCAGCCAGAGCAAGCCACT
CTGCCCCATCAGTCGCCCTATGCTCACCACCGCCCGCAAAGCACCTATGGTGCCCAAGAGCTGGCCACGTCGGTC
TACGATTCGCCAATGCCACCCGCTTCTGCTCCCGGCCGTGTCGCCTCGCCCCCAGCCACCAACCAGTACGGCGCT
GCCTACCAGGGCCGCGTCCAGCCCGAGCACCAGCAGTACAAGCCATATGTGCCGCCCAGTGCGCCTGGGCCTGAT
GACTATTATCGATGA
Gene >OphauB2|7046
ATGTTCGGAGCAGCAGCGGCTGGGCCGTTTGACCAAGTCGTCGGTAAGCGGGGCTGTGGCAAGACGAGGGAGATG
AGGGCTCGGGCGGCGCTGACGACGAAGCTGCAGCCAAGGCGACGGACGAGAAGCTCACATCAGAGGACTGGGGCG
CCATCATGGAGGTGTGCGACAAGGTCTCGGGGGATGGCAACGGGCCCAAGGAGGCAGTGCAGAGCATGATGAAGC
GGCTGGCACATCGCAACGCCAACGTGCAGCTCTACACACTCGAGGTGGGTGGGCGACGGGGCCAGGAGCAGGGCA
TGGCACGGGGACAGGCTGACGCAGAGACAGCTGGCGCACGCGCTGTGCCAAAACTGCGGCAAGCCCATGCACCGC
GAAGTGTCGAGCCGGGCCTTTACCGAGGCGCTGCTCAAGCTGGCCAACGACCGCAACACGCATACGCAGGTCAAG
GGCAAGATTCTGGAAAAGGTCAAGGACTGGAGCGACATGTTTAGCGACGATGCCGACCTGGGCATCATGGACGAC
GCCTACCACCGGCTCAAGCAGAGCAATCCGACGCTGCAGGCGCCGAGCGCGCCGCAAAAACAGGGCCTGACAGCG
TCGGACCGGCAAAAGGAAGAGGACGAGCTGCAGATGGCGCTCAAGCTGAGTCTGCAGGAAGAGGACCGCAAGAAG
AAAGCGGTGGCGCCCTGGACAGCCACGACGAGTGGCGAGGCGGCGCGGCCCAGCGATGGGGCGGTGGCGGGCACG
ACGGCGGCAACCGTCAGCCGCGTGCGCGCCCTCTACGACTTCTCGCCCTCGGAGCCGGGCGAGCTCGAGTTTCGG
CGCGGCGACGTGATTGCAGTGCTGGAGAGCGTCTACAAGGACTGGTGGCGCGGCTCGCTCAAGGGCCGCACCGGC
ATCTTTCCCCTCAACTACGTGGACAAGCTGACGGACCCTACGCCCGACGAGCTGCAGCGCGAGGCGCAAATCGAG
GCCGAGGTGTTTGCCGAGATCAAGAATGTGGAGAAGCTGCTGACGCTGCTGAGCGCCTCCAACACGGCGCCGCGC
GAAGAGGACAATGAGGAGATATCGGTAGGTGCCATTTATTATGCTGGCTGGCTGGCTGGCTGGAGAGGCTGGCTG
GCTGGCTGGAGAGGCTGGCTGGCTGACTGGATAGCAGAAGCTCTACCACCAAACACTGGCCATCCGCCCAAAGCT
CATCAAGCTGATTGAAAAGTACTCGCAAAAAAAGGGTATCGCCGCCGCCTGCCCCCTCGTGCTGGCCACAGGCTG
ACGCGGCCCTCTAGACGACTTTACCCAGCTCAACGAAAAGTTCATCAAGGCGCGCAGGGACTACGAGGCGCTGCT
CGAGTCGAGCATGTCGCATCCGCCCCAGCACAACTACCAGCAGTACGCGCTGCGCCCCTTTTACTCGTCGGCCGG
CCCGGGCGAGTCGTACCAGACACCCTCGCAGCAGCAGACGCCGCCAGCTTCGGCCCCCTTTTACGTGGCCGGCAC
AGAGGTGCCCACGCAGCAGCAGCAGCAGCCAGAGCAAGCCACTCTGCCCCATCAGTCGCCCTATGCTCACCACCG
CCCGCAAAGCACCTATGGTGCCCAAGAGCTGGCCACGTCGGTCTACGATTCGCCAATGCCACCCGCTTCTGCTCC
CGGCCGTGTCGCCTCGCCCCCAGCCACCAACCAGTACGGCGCTGCCTACCAGGGCCGCGTCCAGCCCGAGCACCA
GCAGTACAAGCCATATGTGCCGCCCAGTGCGCCTGGGCCTGATGACTATTATCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail