Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7046
Gene name
LocationContig_7:255770..257553
Strand+
Gene length (bp)1783
Transcript length (bp)1515
Coding sequence length (bp)1515
Protein length (aa) 505

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00790 VHS VHS domain 2.9E-37 9 140
PF00018 SH3_1 SH3 domain 2.5E-15 217 261
PF14604 SH3_9 Variant SH3 domain 7.7E-15 218 266
PF07653 SH3_2 Variant SH3 domain 8.4E-12 215 266
PF03127 GAT GAT domain 1.0E-10 291 362

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S6J4|HSE1_NEUCR Class E vacuolar protein-sorting machinery protein hse1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hse1 PE=3 SV=1 1 388 0.0E+00
sp|A4RF61|HSE1_MAGO7 Class E vacuolar protein-sorting machinery protein HSE1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HSE1 PE=3 SV=2 1 491 0.0E+00
sp|Q2GT05|HSE1_CHAGB Class E vacuolar protein-sorting machinery protein HSE1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HSE1 PE=3 SV=1 1 469 0.0E+00
sp|Q0CJU8|HSE1_ASPTN Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hse1 PE=3 SV=1 10 455 0.0E+00
sp|A1CEK6|HSE1_ASPCL Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hse1 PE=3 SV=1 10 467 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S6J4|HSE1_NEUCR Class E vacuolar protein-sorting machinery protein hse1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hse1 PE=3 SV=1 1 388 0.0E+00
sp|A4RF61|HSE1_MAGO7 Class E vacuolar protein-sorting machinery protein HSE1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HSE1 PE=3 SV=2 1 491 0.0E+00
sp|Q2GT05|HSE1_CHAGB Class E vacuolar protein-sorting machinery protein HSE1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HSE1 PE=3 SV=1 1 469 0.0E+00
sp|Q0CJU8|HSE1_ASPTN Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hse1 PE=3 SV=1 10 455 0.0E+00
sp|A1CEK6|HSE1_ASPCL Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hse1 PE=3 SV=1 10 467 0.0E+00
sp|Q1E878|HSE1_COCIM Class E vacuolar protein-sorting machinery protein HSE1 OS=Coccidioides immitis (strain RS) GN=HSE1 PE=3 SV=1 10 454 0.0E+00
sp|A2QW93|HSE1_ASPNC Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=hse1 PE=3 SV=1 10 470 0.0E+00
sp|A1DFN5|HSE1_NEOFI Class E vacuolar protein-sorting machinery protein hse1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hse1 PE=3 SV=1 10 469 0.0E+00
sp|Q5BBL4|HSE1_EMENI Class E vacuolar protein-sorting machinery protein hse1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hse1 PE=3 SV=1 10 455 1.0E-174
sp|Q0U6X7|HSE1_PHANO Class E vacuolar protein-sorting machinery protein HSE1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HSE1 PE=3 SV=1 10 455 6.0E-173
sp|Q4WHP5|HSE1_ASPFU Class E vacuolar protein-sorting machinery protein hse1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hse1 PE=3 SV=1 10 472 6.0E-167
sp|Q6C2N2|HSE1_YARLI Class E vacuolar protein-sorting machinery protein HSE1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HSE1 PE=3 SV=1 9 365 3.0E-107
sp|Q4P5J4|HSE1_USTMA Class E vacuolar protein-sorting machinery protein HSE1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HSE1 PE=3 SV=1 1 504 5.0E-100
sp|O74749|HSE1_SCHPO Class E vacuolar protein-sorting machinery protein hse1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hse1 PE=3 SV=1 8 367 4.0E-89
sp|Q6BNP6|HSE1_DEBHA Class E vacuolar protein-sorting machinery protein HSE1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HSE1 PE=3 SV=2 1 395 2.0E-80
sp|Q5A895|HSE1_CANAL Class E vacuolar protein-sorting machinery protein HSE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSE1 PE=3 SV=1 10 388 1.0E-76
sp|Q6FN49|HSE1_CANGA Class E vacuolar protein-sorting machinery protein HSE1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HSE1 PE=3 SV=1 14 421 2.0E-75
sp|Q75DS3|HSE1_ASHGO Class E vacuolar protein-sorting machinery protein HSE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HSE1 PE=3 SV=1 10 430 1.0E-72
sp|P38753|HSE1_YEAST Class E vacuolar protein-sorting machinery protein HSE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSE1 PE=1 SV=1 4 362 8.0E-67
sp|A3LXQ8|HSE1_PICST Class E vacuolar protein-sorting machinery protein HSE1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HSE1 PE=3 SV=2 10 372 1.0E-66
sp|Q6CVA8|HSE1_KLULA Class E vacuolar protein-sorting machinery protein HSE1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HSE1 PE=3 SV=1 12 361 4.0E-60
sp|Q92783|STAM1_HUMAN Signal transducing adapter molecule 1 OS=Homo sapiens GN=STAM PE=1 SV=3 6 427 2.0E-48
sp|P70297|STAM1_MOUSE Signal transducing adapter molecule 1 OS=Mus musculus GN=Stam PE=1 SV=3 6 418 1.0E-46
sp|O75886|STAM2_HUMAN Signal transducing adapter molecule 2 OS=Homo sapiens GN=STAM2 PE=1 SV=1 7 391 2.0E-46
sp|O93436|STAM2_CHICK Signal transducing adapter molecule 2 OS=Gallus gallus GN=STAM2 PE=1 SV=1 5 371 8.0E-44
sp|O88811|STAM2_MOUSE Signal transducing adapter molecule 2 OS=Mus musculus GN=Stam2 PE=1 SV=1 7 361 2.0E-43
sp|Q5XHY7|STAM2_RAT Signal transducing adapter molecule 2 OS=Rattus norvegicus GN=Stam2 PE=2 SV=1 7 361 4.0E-42
sp|P0CR78|HSE1_CRYNJ Class E vacuolar protein-sorting machinery protein HSE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HSE1 PE=3 SV=1 1 148 1.0E-38
sp|P0CR79|HSE1_CRYNB Class E vacuolar protein-sorting machinery protein HSE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HSE1 PE=3 SV=1 1 148 4.0E-38
sp|P0CR78|HSE1_CRYNJ Class E vacuolar protein-sorting machinery protein HSE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HSE1 PE=3 SV=1 212 360 2.0E-35
sp|P0CR79|HSE1_CRYNB Class E vacuolar protein-sorting machinery protein HSE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HSE1 PE=3 SV=1 212 360 2.0E-34
sp|O01498|STAM1_CAEEL Signal transducing adapter molecule 1 OS=Caenorhabditis elegans GN=stam-1 PE=1 SV=2 10 375 2.0E-21
sp|Q99LI8|HGS_MOUSE Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Mus musculus GN=Hgs PE=1 SV=2 6 139 5.0E-18
sp|Q9JJ50|HGS_RAT Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Rattus norvegicus GN=Hgs PE=1 SV=1 6 139 5.0E-18
sp|Q0V8S0|HGS_BOVIN Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Bos taurus GN=HGS PE=2 SV=1 6 139 8.0E-18
sp|O14964|HGS_HUMAN Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens GN=HGS PE=1 SV=1 6 139 8.0E-18
sp|Q5SRX1|TM1L2_MOUSE TOM1-like protein 2 OS=Mus musculus GN=Tom1l2 PE=1 SV=1 1 140 2.0E-17
sp|Q68FJ8|TM1L2_XENLA TOM1-like protein 2 OS=Xenopus laevis GN=tom1l2 PE=2 SV=1 1 140 5.0E-17
sp|Q6ZVM7|TM1L2_HUMAN TOM1-like protein 2 OS=Homo sapiens GN=TOM1L2 PE=1 SV=1 1 140 7.0E-17
sp|Q0U4Z8|VPS27_PHANO Vacuolar protein sorting-associated protein 27 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=VPS27 PE=3 SV=1 2 140 3.0E-16
sp|Q0CJV3|VPS27_ASPTN Vacuolar protein sorting-associated protein 27 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=vps27 PE=3 SV=1 5 140 1.0E-15
sp|O60784|TOM1_HUMAN Target of Myb protein 1 OS=Homo sapiens GN=TOM1 PE=1 SV=2 1 140 1.0E-15
sp|Q4WHN8|VPS27_ASPFU Vacuolar protein sorting-associated protein 27 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=vps27 PE=3 SV=1 5 140 2.0E-15
sp|O88746|TOM1_MOUSE Target of Myb protein 1 OS=Mus musculus GN=Tom1 PE=1 SV=1 1 140 6.0E-15
sp|A1DFP5|VPS27_NEOFI Vacuolar protein sorting-associated protein 27 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=vps27 PE=3 SV=1 10 139 6.0E-15
sp|O75674|TM1L1_HUMAN TOM1-like protein 1 OS=Homo sapiens GN=TOM1L1 PE=1 SV=2 2 138 8.0E-15
sp|A1CEK1|VPS27_ASPCL Vacuolar protein sorting-associated protein 27 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=vps27 PE=3 SV=1 5 139 3.0E-14
sp|O12940|TOM1_CHICK Target of Myb protein 1 OS=Gallus gallus GN=TOM1 PE=2 SV=2 1 140 4.0E-14
sp|O43125|CSH3_SCHPO Protein csh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csh3 PE=2 SV=1 208 270 1.0E-13
sp|Q6CFT4|VPS27_YARLI Vacuolar protein sorting-associated protein 27 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=VPS27 PE=3 SV=1 10 139 1.0E-13
sp|A2QWA2|VPS27_ASPNC Vacuolar protein sorting-associated protein 27 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=vps27 PE=3 SV=1 14 139 2.0E-13
sp|Q4P7Q1|VPS27_USTMA Vacuolar protein sorting-associated protein 27 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=VPS27 PE=3 SV=1 1 139 2.0E-13
sp|F1LM81|TM1L1_RAT TOM1-like protein 1 OS=Rattus norvegicus GN=Tom1l1 PE=1 SV=1 2 138 2.0E-13
sp|Q5BBK9|VPS27_EMENI Vacuolar protein sorting-associated protein 27 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=vps27 PE=3 SV=1 5 139 3.0E-13
sp|Q2GS33|VPS27_CHAGB Vacuolar protein sorting-associated protein 27 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=VPS27 PE=3 SV=2 2 140 3.0E-13
sp|Q923U0|TM1L1_MOUSE TOM1-like protein 1 OS=Mus musculus GN=Tom1l1 PE=1 SV=1 2 138 3.0E-13
sp|Q9UJY4|GGA2_HUMAN ADP-ribosylation factor-binding protein GGA2 OS=Homo sapiens GN=GGA2 PE=1 SV=3 16 151 8.0E-13
sp|P0CS26|VPS27_CRYNJ Vacuolar protein sorting-associated protein 27 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=VPS27 PE=3 SV=1 24 145 2.0E-12
sp|P0CS27|VPS27_CRYNB Vacuolar protein sorting-associated protein 27 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=VPS27 PE=3 SV=1 24 145 2.0E-12
sp|Q07883|GRB2_CHICK Growth factor receptor-bound protein 2 OS=Gallus gallus GN=GRB2 PE=1 SV=1 216 265 4.0E-12
sp|Q6P5E6|GGA2_MOUSE ADP-ribosylation factor-binding protein GGA2 OS=Mus musculus GN=Gga2 PE=1 SV=1 16 156 4.0E-12
sp|A4QTV1|VPS27_MAGO7 Vacuolar protein sorting-associated protein 27 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=VPS27 PE=3 SV=1 2 140 5.0E-12
sp|Q54GH3|TOM1_DICDI Target of Myb protein 1 OS=Dictyostelium discoideum GN=tom1 PE=1 SV=1 12 141 5.0E-12
sp|Q60631|GRB2_MOUSE Growth factor receptor-bound protein 2 OS=Mus musculus GN=Grb2 PE=1 SV=1 216 265 6.0E-12
sp|P62994|GRB2_RAT Growth factor receptor-bound protein 2 OS=Rattus norvegicus GN=Grb2 PE=1 SV=1 216 265 6.0E-12
sp|Q5R4J7|GRB2_PONAB Growth factor receptor-bound protein 2 OS=Pongo abelii GN=GRB2 PE=2 SV=1 216 265 6.0E-12
sp|P62993|GRB2_HUMAN Growth factor receptor-bound protein 2 OS=Homo sapiens GN=GRB2 PE=1 SV=1 216 265 6.0E-12
sp|Q6YKA8|DRK_DROSI Protein E(sev)2B OS=Drosophila simulans GN=drk PE=3 SV=1 216 265 7.0E-12
sp|Q08012|DRK_DROME Protein enhancer of sevenless 2B OS=Drosophila melanogaster GN=drk PE=1 SV=1 216 265 7.0E-12
sp|Q8AXV1|SH3G2_CHICK Endophilin-A1 OS=Gallus gallus GN=SH3GL2 PE=1 SV=1 216 274 8.0E-12
sp|Q66II3|GRB2_XENTR Growth factor receptor-bound protein 2 OS=Xenopus tropicalis GN=grb2 PE=2 SV=1 216 265 1.0E-11
sp|Q6GPJ9|GRB2B_XENLA Growth factor receptor-bound protein 2-B OS=Xenopus laevis GN=grb2-b PE=1 SV=1 216 265 1.0E-11
sp|P29355|SEM5_CAEEL Sex muscle abnormal protein 5 OS=Caenorhabditis elegans GN=sem-5 PE=1 SV=1 216 265 3.0E-11
sp|Q7RZJ2|VPS27_NEUCR Vacuolar protein sorting-associated protein 27 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vps27 PE=3 SV=2 2 140 3.0E-11
sp|O35180|SH3G3_RAT Endophilin-A3 OS=Rattus norvegicus GN=Sh3gl3 PE=1 SV=2 167 273 6.0E-11
sp|Q960X8|HRS_DROME Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Drosophila melanogaster GN=Hrs PE=1 SV=1 10 139 7.0E-11
sp|Q62420|SH3G2_MOUSE Endophilin-A1 OS=Mus musculus GN=Sh3gl2 PE=1 SV=2 216 269 9.0E-11
sp|O35179|SH3G2_RAT Endophilin-A1 OS=Rattus norvegicus GN=Sh3gl2 PE=1 SV=2 216 269 9.0E-11
sp|P87379|GRB2A_XENLA Growth factor receptor-bound protein 2-A OS=Xenopus laevis GN=grb2-a PE=1 SV=2 216 265 9.0E-11
sp|Q99962|SH3G2_HUMAN Endophilin-A1 OS=Homo sapiens GN=SH3GL2 PE=1 SV=1 216 269 1.0E-10
sp|A6QLK6|GRAP_BOVIN GRB2-related adapter protein OS=Bos taurus GN=GRAP PE=2 SV=1 218 265 1.0E-10
sp|Q8AXV0|SH3G1_CHICK Endophilin-A2 OS=Gallus gallus GN=SH3GL1 PE=1 SV=1 190 273 2.0E-10
sp|Q8I1C0|SH3G3_DROPS Endophilin-A OS=Drosophila pseudoobscura pseudoobscura GN=EndoA PE=3 SV=1 206 265 2.0E-10
sp|Q62421|SH3G3_MOUSE Endophilin-A3 OS=Mus musculus GN=Sh3gl3 PE=1 SV=1 216 273 3.0E-10
sp|Q99963|SH3G3_HUMAN Endophilin-A3 OS=Homo sapiens GN=SH3GL3 PE=1 SV=1 193 273 3.0E-10
sp|Q8I1A6|SH3G3_DROWI Endophilin-A OS=Drosophila willistoni GN=EndoA PE=3 SV=1 218 265 3.0E-10
sp|Q8MJ50|OSTF1_BOVIN Osteoclast-stimulating factor 1 OS=Bos taurus GN=OSTF1 PE=2 SV=1 213 265 4.0E-10
sp|Q5ZJJ9|OSTF1_CHICK Osteoclast-stimulating factor 1 OS=Gallus gallus GN=OSTF1 PE=2 SV=1 213 265 4.0E-10
sp|Q06449|PIN3_YEAST [PSI+] inducibility protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIN3 PE=1 SV=1 157 265 4.0E-10
sp|Q8BMI3|GGA3_MOUSE ADP-ribosylation factor-binding protein GGA3 OS=Mus musculus GN=Gga3 PE=1 SV=2 16 157 5.0E-10
sp|Q8I190|SH3G3_DROVI Endophilin-A OS=Drosophila virilis GN=EndoA PE=3 SV=1 216 265 5.0E-10
sp|Q6P686|OSTF1_RAT Osteoclast-stimulating factor 1 OS=Rattus norvegicus GN=Ostf1 PE=1 SV=1 213 265 6.0E-10
sp|Q62422|OSTF1_MOUSE Osteoclast-stimulating factor 1 OS=Mus musculus GN=Ostf1 PE=1 SV=2 213 265 6.0E-10
sp|Q8T390|SH3G3_DROME Endophilin-A OS=Drosophila melanogaster GN=EndoA PE=1 SV=1 218 265 7.0E-10
sp|Q8I1I3|SH3G3_DROER Endophilin-A OS=Drosophila erecta GN=EndoA PE=3 SV=1 218 265 7.0E-10
sp|Q9NZ52|GGA3_HUMAN ADP-ribosylation factor-binding protein GGA3 OS=Homo sapiens GN=GGA3 PE=1 SV=1 16 157 8.0E-10
sp|Q8MJ49|OSTF1_PIG Osteoclast-stimulating factor 1 OS=Sus scrofa GN=OSTF1 PE=2 SV=1 213 265 8.0E-10
sp|Q92882|OSTF1_HUMAN Osteoclast-stimulating factor 1 OS=Homo sapiens GN=OSTF1 PE=1 SV=2 213 265 9.0E-10
sp|Q3SZ01|SH3Y1_BOVIN SH3 domain-containing YSC84-like protein 1 OS=Bos taurus GN=SH3YL1 PE=2 SV=1 216 265 1.0E-09
sp|O35964|SH3G1_RAT Endophilin-A2 OS=Rattus norvegicus GN=Sh3gl1 PE=1 SV=1 216 273 1.0E-09
sp|Q62419|SH3G1_MOUSE Endophilin-A2 OS=Mus musculus GN=Sh3gl1 PE=1 SV=1 216 273 1.0E-09
sp|Q99961|SH3G1_HUMAN Endophilin-A2 OS=Homo sapiens GN=SH3GL1 PE=1 SV=1 216 273 1.0E-09
sp|Q99469|STAC_HUMAN SH3 and cysteine-rich domain-containing protein OS=Homo sapiens GN=STAC PE=1 SV=1 218 268 2.0E-09
sp|Q15080|NCF4_HUMAN Neutrophil cytosol factor 4 OS=Homo sapiens GN=NCF4 PE=1 SV=2 215 270 2.0E-09
sp|Q2KJA1|SH3G1_BOVIN Endophilin-A2 OS=Bos taurus GN=SH3GL1 PE=2 SV=1 216 273 2.0E-09
sp|Q4R729|SH321_MACFA SH3 domain-containing protein 21 OS=Macaca fascicularis GN=SH3D21 PE=2 SV=1 217 265 2.0E-09
sp|A4FU49|SH321_HUMAN SH3 domain-containing protein 21 OS=Homo sapiens GN=SH3D21 PE=2 SV=2 217 265 2.0E-09
sp|Q8AXU9|SH3G3_CHICK Endophilin-A3 OS=Gallus gallus GN=SH3GL3 PE=1 SV=1 216 273 3.0E-09
sp|Q9JLQ0|CD2AP_MOUSE CD2-associated protein OS=Mus musculus GN=Cd2ap PE=1 SV=3 215 286 3.0E-09
sp|Q6XJU9|OSTF1_MONAL Osteoclast-stimulating factor 1 OS=Monopterus albus GN=ostf1 PE=2 SV=1 213 265 3.0E-09
sp|Q7ZYG4|OSTF1_XENLA Osteoclast-stimulating factor 1 OS=Xenopus laevis GN=ostf1 PE=2 SV=1 213 265 3.0E-09
sp|Q3UTJ2|SRBS2_MOUSE Sorbin and SH3 domain-containing protein 2 OS=Mus musculus GN=Sorbs2 PE=1 SV=2 217 271 3.0E-09
sp|F1LRS8|CD2AP_RAT CD2-associated protein OS=Rattus norvegicus GN=Cd2ap PE=1 SV=2 215 286 4.0E-09
sp|Q6TGW5|OSTF1_DANRE Osteoclast-stimulating factor 1 OS=Danio rerio GN=ostf1 PE=2 SV=1 213 265 4.0E-09
sp|O35413|SRBS2_RAT Sorbin and SH3 domain-containing protein 2 OS=Rattus norvegicus GN=Sorbs2 PE=1 SV=2 217 271 4.0E-09
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 208 275 4.0E-09
sp|O94875|SRBS2_HUMAN Sorbin and SH3 domain-containing protein 2 OS=Homo sapiens GN=SORBS2 PE=1 SV=3 217 271 4.0E-09
sp|Q5RAQ2|SH3Y1_PONAB SH3 domain-containing YSC84-like protein 1 OS=Pongo abelii GN=SH3YL1 PE=2 SV=1 216 265 6.0E-09
sp|Q96HL8|SH3Y1_HUMAN SH3 domain-containing YSC84-like protein 1 OS=Homo sapiens GN=SH3YL1 PE=1 SV=1 216 265 6.0E-09
sp|P43603|LSB3_YEAST LAS seventeen-binding protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSB3 PE=1 SV=3 218 266 6.0E-09
sp|A7A261|LSB3_YEAS7 LAS seventeen-binding protein 3 OS=Saccharomyces cerevisiae (strain YJM789) GN=LSB3 PE=3 SV=2 218 266 6.0E-09
sp|P53281|LSB1_YEAST LAS seventeen-binding protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSB1 PE=1 SV=1 209 265 8.0E-09
sp|P32793|YSC84_YEAST Protein YSC84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSC84 PE=1 SV=2 208 265 9.0E-09
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 213 275 9.0E-09
sp|A0JNJ1|STAC_BOVIN SH3 and cysteine-rich domain-containing protein OS=Bos taurus GN=STAC PE=2 SV=1 218 268 9.0E-09
sp|O89100|GRAP2_MOUSE GRB2-related adaptor protein 2 OS=Mus musculus GN=Grap2 PE=1 SV=1 210 265 1.0E-08
sp|Q7TSG5|SH321_MOUSE SH3 domain-containing protein 21 OS=Mus musculus GN=Sh3d21 PE=1 SV=1 209 297 1.0E-08
sp|P97306|STAC_MOUSE SH3 and cysteine-rich domain-containing protein OS=Mus musculus GN=Stac PE=2 SV=1 218 268 1.0E-08
sp|Q5HYK7|SH319_HUMAN SH3 domain-containing protein 19 OS=Homo sapiens GN=SH3D19 PE=1 SV=2 215 268 1.0E-08
sp|Q13588|GRAP_HUMAN GRB2-related adapter protein OS=Homo sapiens GN=GRAP PE=1 SV=1 218 265 1.0E-08
sp|B0BNA1|SH3Y1_RAT SH3 domain-containing YSC84-like protein 1 OS=Rattus norvegicus GN=Sh3yl1 PE=2 SV=1 216 265 2.0E-08
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus GN=Itsn2 PE=1 SV=2 181 275 2.0E-08
sp|O08641|SH3Y1_MOUSE SH3 domain-containing YSC84-like protein 1 OS=Mus musculus GN=Sh3yl1 PE=1 SV=1 216 265 2.0E-08
sp|Q9URW6|YIE2_SCHPO SH3 domain-containing protein PJ696.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPJ696.02 PE=1 SV=1 217 265 3.0E-08
sp|P97369|NCF4_MOUSE Neutrophil cytosol factor 4 OS=Mus musculus GN=Ncf4 PE=1 SV=2 215 275 3.0E-08
sp|A3LX75|VPS27_PICST Vacuolar protein sorting-associated protein 27 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=VPS27 PE=3 SV=2 2 139 3.0E-08
sp|O75791|GRAP2_HUMAN GRB2-related adapter protein 2 OS=Homo sapiens GN=GRAP2 PE=1 SV=1 210 269 3.0E-08
sp|Q91X43|SH319_MOUSE SH3 domain-containing protein 19 OS=Mus musculus GN=Sh3d19 PE=1 SV=2 215 268 4.0E-08
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 213 275 5.0E-08
sp|Q9WVE9|ITSN1_RAT Intersectin-1 OS=Rattus norvegicus GN=Itsn1 PE=1 SV=1 213 275 5.0E-08
sp|Q6XZF7|DNMBP_HUMAN Dynamin-binding protein OS=Homo sapiens GN=DNMBP PE=1 SV=1 218 275 7.0E-08
sp|P10569|MYSC_ACACA Myosin IC heavy chain OS=Acanthamoeba castellanii GN=MIC PE=1 SV=1 217 268 7.0E-08
sp|P19878|NCF2_HUMAN Neutrophil cytosol factor 2 OS=Homo sapiens GN=NCF2 PE=1 SV=2 214 280 7.0E-08
sp|P38817|GGA2_YEAST ADP-ribosylation factor-binding protein GGA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GGA2 PE=1 SV=1 5 184 8.0E-08
sp|O42287|ITSN1_XENLA Intersectin-1 OS=Xenopus laevis GN=itsn1 PE=1 SV=1 208 275 1.0E-07
sp|Q5HYK7|SH319_HUMAN SH3 domain-containing protein 19 OS=Homo sapiens GN=SH3D19 PE=1 SV=2 214 270 2.0E-07
sp|P07751|SPTN1_CHICK Spectrin alpha chain, non-erythrocytic 1 OS=Gallus gallus GN=SPTAN1 PE=1 SV=3 216 348 2.0E-07
sp|O77775|NCF2_BOVIN Neutrophil cytosol factor 2 OS=Bos taurus GN=NCF2 PE=2 SV=1 214 274 2.0E-07
sp|Q14155|ARHG7_HUMAN Rho guanine nucleotide exchange factor 7 OS=Homo sapiens GN=ARHGEF7 PE=1 SV=2 216 265 2.0E-07
sp|Q6NRD3|SH3R1_XENLA E3 ubiquitin-protein ligase SH3RF1 OS=Xenopus laevis GN=sh3rf1 PE=1 SV=1 217 273 2.0E-07
sp|Q8C120|SH3R3_MOUSE SH3 domain-containing RING finger protein 3 OS=Mus musculus GN=Sh3rf3 PE=1 SV=2 209 392 2.0E-07
sp|Q9CX99|GRAP_MOUSE GRB2-related adapter protein OS=Mus musculus GN=Grap PE=1 SV=1 218 265 2.0E-07
sp|Q9Y5K6|CD2AP_HUMAN CD2-associated protein OS=Homo sapiens GN=CD2AP PE=1 SV=1 215 285 2.0E-07
sp|Q13813|SPTN1_HUMAN Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3 216 348 2.0E-07
sp|Q28E95|SH3R1_XENTR E3 ubiquitin-protein ligase SH3RF1 OS=Xenopus tropicalis GN=sh3rf1 PE=2 SV=1 217 273 3.0E-07
sp|P02549|SPTA1_HUMAN Spectrin alpha chain, erythrocytic 1 OS=Homo sapiens GN=SPTA1 PE=1 SV=5 200 268 3.0E-07
sp|P34109|MYOD_DICDI Myosin ID heavy chain OS=Dictyostelium discoideum GN=myoD PE=1 SV=2 217 273 3.0E-07
sp|Q6WKZ7|NOSTN_MOUSE Nostrin OS=Mus musculus GN=Nostrin PE=1 SV=2 216 268 3.0E-07
sp|Q69ZI1|SH3R1_MOUSE E3 ubiquitin-protein ligase SH3RF1 OS=Mus musculus GN=Sh3rf1 PE=1 SV=2 217 294 5.0E-07
sp|Q8R0H9|GGA1_MOUSE ADP-ribosylation factor-binding protein GGA1 OS=Mus musculus GN=Gga1 PE=1 SV=1 14 168 6.0E-07
sp|A5D7F8|SH3R1_BOVIN E3 ubiquitin-protein ligase SH3RF1 OS=Bos taurus GN=SH3RF1 PE=2 SV=1 217 294 6.0E-07
sp|Q7Z6J0|SH3R1_HUMAN E3 ubiquitin-protein ligase SH3RF1 OS=Homo sapiens GN=SH3RF1 PE=1 SV=2 217 294 6.0E-07
sp|Q71F54|SH3R1_RAT E3 ubiquitin-protein ligase SH3RF1 OS=Rattus norvegicus GN=Sh3rf1 PE=1 SV=1 217 294 6.0E-07
sp|P16546|SPTN1_MOUSE Spectrin alpha chain, non-erythrocytic 1 OS=Mus musculus GN=Sptan1 PE=1 SV=4 216 271 6.0E-07
sp|Q5RBR0|SH3R1_PONAB E3 ubiquitin-protein ligase SH3RF1 OS=Pongo abelii GN=SH3RF1 PE=2 SV=1 217 294 6.0E-07
sp|P16086|SPTN1_RAT Spectrin alpha chain, non-erythrocytic 1 OS=Rattus norvegicus GN=Sptan1 PE=1 SV=2 216 271 6.0E-07
sp|Q557J6|DBNL_DICDI Drebrin-like protein OS=Dictyostelium discoideum GN=abpE-1 PE=2 SV=1 215 268 6.0E-07
sp|Q9P7E8|APP1_SCHPO Protein app1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=app1 PE=2 SV=1 216 268 6.0E-07
sp|Q66HL2|SRC8_RAT Src substrate cortactin OS=Rattus norvegicus GN=Cttn PE=1 SV=1 218 266 7.0E-07
sp|Q8IVI9|NOSTN_HUMAN Nostrin OS=Homo sapiens GN=NOSTRIN PE=1 SV=2 193 268 7.0E-07
sp|A5D8S5|SH3R1_DANRE E3 ubiquitin-protein ligase SH3RF1 OS=Danio rerio GN=sh3rf1 PE=2 SV=2 217 294 8.0E-07
sp|Q01406|SRC8_CHICK Src substrate protein p85 OS=Gallus gallus GN=CTTN1 PE=1 SV=1 218 266 9.0E-07
sp|Q2KJB5|NOSTN_BOVIN Nostrin OS=Bos taurus GN=NOSTRIN PE=1 SV=1 191 268 9.0E-07
sp|Q14247|SRC8_HUMAN Src substrate cortactin OS=Homo sapiens GN=CTTN PE=1 SV=2 218 266 9.0E-07
sp|O70145|NCF2_MOUSE Neutrophil cytosol factor 2 OS=Mus musculus GN=Ncf2 PE=1 SV=1 214 280 1.0E-06
sp|O13821|VPS27_SCHPO Vacuolar protein sorting-associated protein 27 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sst4 PE=3 SV=1 10 149 1.0E-06
sp|Q60598|SRC8_MOUSE Src substrate cortactin OS=Mus musculus GN=Cttn PE=1 SV=2 218 266 1.0E-06
sp|Q96B97|SH3K1_HUMAN SH3 domain-containing kinase-binding protein 1 OS=Homo sapiens GN=SH3KBP1 PE=1 SV=2 220 276 1.0E-06
sp|Q925Q9|SH3K1_RAT SH3 domain-containing kinase-binding protein 1 OS=Rattus norvegicus GN=Sh3kbp1 PE=1 SV=2 220 276 1.0E-06
sp|Q8R550|SH3K1_MOUSE SH3 domain-containing kinase-binding protein 1 OS=Mus musculus GN=Sh3kbp1 PE=1 SV=1 220 276 1.0E-06
sp|Q5I0D6|NOSTN_RAT Nostrin OS=Rattus norvegicus GN=Nostrin PE=1 SV=1 216 268 2.0E-06
sp|Q6DTM3|AHI1_RAT Jouberin OS=Rattus norvegicus GN=Ahi1 PE=1 SV=1 216 265 2.0E-06
sp|Q16584|M3K11_HUMAN Mitogen-activated protein kinase kinase kinase 11 OS=Homo sapiens GN=MAP3K11 PE=1 SV=1 218 296 2.0E-06
sp|P13395|SPTCA_DROME Spectrin alpha chain OS=Drosophila melanogaster GN=alpha-Spec PE=1 SV=2 216 268 2.0E-06
sp|A7E3N2|NCF2_RAT Neutrophil cytosol factor 2 OS=Rattus norvegicus GN=Ncf2 PE=2 SV=1 214 266 2.0E-06
sp|Q54CL3|PEX13_DICDI Probable peroxisomal membrane protein PEX13 OS=Dictyostelium discoideum GN=pex13 PE=3 SV=1 215 269 3.0E-06
sp|Q6DFH5|SH3Y1_XENLA SH3 domain-containing YSC84-like protein 1 OS=Xenopus laevis GN=sh3yl1 PE=2 SV=1 218 265 3.0E-06
sp|P08032|SPTA1_MOUSE Spectrin alpha chain, erythrocytic 1 OS=Mus musculus GN=Spta1 PE=1 SV=3 210 276 3.0E-06
sp|Q80XI6|M3K11_MOUSE Mitogen-activated protein kinase kinase kinase 11 OS=Mus musculus GN=Map3k11 PE=1 SV=1 218 296 3.0E-06
sp|Q66HA1|M3K11_RAT Mitogen-activated protein kinase kinase kinase 11 OS=Rattus norvegicus GN=Map3k11 PE=1 SV=1 218 296 3.0E-06
sp|Q9UJY5|GGA1_HUMAN ADP-ribosylation factor-binding protein GGA1 OS=Homo sapiens GN=GGA1 PE=1 SV=1 14 166 3.0E-06
sp|Q555L8|Y4695_DICDI SH3 and F-BAR domain-containing protein DDB_G0274695 OS=Dictyostelium discoideum GN=DDB_G0274695 PE=3 SV=1 217 266 3.0E-06
sp|Q5U597|SKA2B_XENLA Src kinase-associated phosphoprotein 2-B OS=Xenopus laevis GN=skap2-b PE=2 SV=1 154 270 4.0E-06
sp|Q9QY17|PACN2_RAT Protein kinase C and casein kinase substrate in neurons 2 protein OS=Rattus norvegicus GN=Pacsin2 PE=1 SV=2 188 268 4.0E-06
sp|Q06336|GGA1_YEAST ADP-ribosylation factor-binding protein GGA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GGA1 PE=1 SV=1 14 171 5.0E-06
sp|Q8N157|AHI1_HUMAN Jouberin OS=Homo sapiens GN=AHI1 PE=1 SV=1 212 265 5.0E-06
sp|Q9WVE8|PACN2_MOUSE Protein kinase C and casein kinase substrate in neurons protein 2 OS=Mus musculus GN=Pacsin2 PE=1 SV=1 188 268 5.0E-06
sp|P46109|CRKL_HUMAN Crk-like protein OS=Homo sapiens GN=CRKL PE=1 SV=1 216 273 5.0E-06
sp|Q5U2U2|CRKL_RAT Crk-like protein OS=Rattus norvegicus GN=Crkl PE=1 SV=1 200 273 6.0E-06
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 187 273 8.0E-06
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 218 265 8.0E-06
sp|P47941|CRKL_MOUSE Crk-like protein OS=Mus musculus GN=Crkl PE=1 SV=2 208 273 8.0E-06
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus GN=Itsn2 PE=1 SV=2 177 268 9.0E-06
sp|Q9UNF0|PACN2_HUMAN Protein kinase C and casein kinase substrate in neurons protein 2 OS=Homo sapiens GN=PACSIN2 PE=1 SV=2 144 268 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0035091 phosphatidylinositol binding Yes
GO:0043130 ubiquitin binding Yes
GO:0003674 molecular_function No
GO:0005543 phospholipid binding No
GO:0005488 binding No
GO:0032182 ubiquitin-like protein binding No
GO:0008289 lipid binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2776
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7092
Ophiocordyceps australis map64 (Brazil) OphauB2|7046 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01163
Ophiocordyceps camponoti-rufipedis Ophun1|2201
Ophiocordyceps kimflemingae Ophio5|4640
Ophiocordyceps subramaniannii Hirsu2|4426

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7046
MFGAAAAGPFDQVVAKATDEKLTSEDWGAIMEVCDKVSGDGNGPKEAVQSMMKRLAHRNANVQLYTLELAHALCQ
NCGKPMHREVSSRAFTEALLKLANDRNTHTQVKGKILEKVKDWSDMFSDDADLGIMDDAYHRLKQSNPTLQAPSA
PQKQGLTASDRQKEEDELQMALKLSLQEEDRKKKAVAPWTATTSGEAARPSDGAVAGTTAATVSRVRALYDFSPS
EPGELEFRRGDVIAVLESVYKDWWRGSLKGRTGIFPLNYVDKLTDPTPDELQREAQIEAEVFAEIKNVEKLLTLL
SASNTAPREEDNEEISKLYHQTLAIRPKLIKLIEKYSQKKDDFTQLNEKFIKARRDYEALLESSMSHPPQHNYQQ
YALRPFYSSAGPGESYQTPSQQQTPPASAPFYVAGTEVPTQQQQQPEQATLPHQSPYAHHRPQSTYGAQELATSV
YDSPMPPASAPGRVASPPATNQYGAAYQGRVQPEHQQYKPYVPPSAPGPDDYYR*
Coding >OphauB2|7046
ATGTTCGGAGCAGCAGCGGCTGGGCCGTTTGACCAAGTCGTCGCCAAGGCGACGGACGAGAAGCTCACATCAGAG
GACTGGGGCGCCATCATGGAGGTGTGCGACAAGGTCTCGGGGGATGGCAACGGGCCCAAGGAGGCAGTGCAGAGC
ATGATGAAGCGGCTGGCACATCGCAACGCCAACGTGCAGCTCTACACACTCGAGCTGGCGCACGCGCTGTGCCAA
AACTGCGGCAAGCCCATGCACCGCGAAGTGTCGAGCCGGGCCTTTACCGAGGCGCTGCTCAAGCTGGCCAACGAC
CGCAACACGCATACGCAGGTCAAGGGCAAGATTCTGGAAAAGGTCAAGGACTGGAGCGACATGTTTAGCGACGAT
GCCGACCTGGGCATCATGGACGACGCCTACCACCGGCTCAAGCAGAGCAATCCGACGCTGCAGGCGCCGAGCGCG
CCGCAAAAACAGGGCCTGACAGCGTCGGACCGGCAAAAGGAAGAGGACGAGCTGCAGATGGCGCTCAAGCTGAGT
CTGCAGGAAGAGGACCGCAAGAAGAAAGCGGTGGCGCCCTGGACAGCCACGACGAGTGGCGAGGCGGCGCGGCCC
AGCGATGGGGCGGTGGCGGGCACGACGGCGGCAACCGTCAGCCGCGTGCGCGCCCTCTACGACTTCTCGCCCTCG
GAGCCGGGCGAGCTCGAGTTTCGGCGCGGCGACGTGATTGCAGTGCTGGAGAGCGTCTACAAGGACTGGTGGCGC
GGCTCGCTCAAGGGCCGCACCGGCATCTTTCCCCTCAACTACGTGGACAAGCTGACGGACCCTACGCCCGACGAG
CTGCAGCGCGAGGCGCAAATCGAGGCCGAGGTGTTTGCCGAGATCAAGAATGTGGAGAAGCTGCTGACGCTGCTG
AGCGCCTCCAACACGGCGCCGCGCGAAGAGGACAATGAGGAGATATCGAAGCTCTACCACCAAACACTGGCCATC
CGCCCAAAGCTCATCAAGCTGATTGAAAAGTACTCGCAAAAAAAGGACGACTTTACCCAGCTCAACGAAAAGTTC
ATCAAGGCGCGCAGGGACTACGAGGCGCTGCTCGAGTCGAGCATGTCGCATCCGCCCCAGCACAACTACCAGCAG
TACGCGCTGCGCCCCTTTTACTCGTCGGCCGGCCCGGGCGAGTCGTACCAGACACCCTCGCAGCAGCAGACGCCG
CCAGCTTCGGCCCCCTTTTACGTGGCCGGCACAGAGGTGCCCACGCAGCAGCAGCAGCAGCCAGAGCAAGCCACT
CTGCCCCATCAGTCGCCCTATGCTCACCACCGCCCGCAAAGCACCTATGGTGCCCAAGAGCTGGCCACGTCGGTC
TACGATTCGCCAATGCCACCCGCTTCTGCTCCCGGCCGTGTCGCCTCGCCCCCAGCCACCAACCAGTACGGCGCT
GCCTACCAGGGCCGCGTCCAGCCCGAGCACCAGCAGTACAAGCCATATGTGCCGCCCAGTGCGCCTGGGCCTGAT
GACTATTATCGATGA
Transcript >OphauB2|7046
ATGTTCGGAGCAGCAGCGGCTGGGCCGTTTGACCAAGTCGTCGCCAAGGCGACGGACGAGAAGCTCACATCAGAG
GACTGGGGCGCCATCATGGAGGTGTGCGACAAGGTCTCGGGGGATGGCAACGGGCCCAAGGAGGCAGTGCAGAGC
ATGATGAAGCGGCTGGCACATCGCAACGCCAACGTGCAGCTCTACACACTCGAGCTGGCGCACGCGCTGTGCCAA
AACTGCGGCAAGCCCATGCACCGCGAAGTGTCGAGCCGGGCCTTTACCGAGGCGCTGCTCAAGCTGGCCAACGAC
CGCAACACGCATACGCAGGTCAAGGGCAAGATTCTGGAAAAGGTCAAGGACTGGAGCGACATGTTTAGCGACGAT
GCCGACCTGGGCATCATGGACGACGCCTACCACCGGCTCAAGCAGAGCAATCCGACGCTGCAGGCGCCGAGCGCG
CCGCAAAAACAGGGCCTGACAGCGTCGGACCGGCAAAAGGAAGAGGACGAGCTGCAGATGGCGCTCAAGCTGAGT
CTGCAGGAAGAGGACCGCAAGAAGAAAGCGGTGGCGCCCTGGACAGCCACGACGAGTGGCGAGGCGGCGCGGCCC
AGCGATGGGGCGGTGGCGGGCACGACGGCGGCAACCGTCAGCCGCGTGCGCGCCCTCTACGACTTCTCGCCCTCG
GAGCCGGGCGAGCTCGAGTTTCGGCGCGGCGACGTGATTGCAGTGCTGGAGAGCGTCTACAAGGACTGGTGGCGC
GGCTCGCTCAAGGGCCGCACCGGCATCTTTCCCCTCAACTACGTGGACAAGCTGACGGACCCTACGCCCGACGAG
CTGCAGCGCGAGGCGCAAATCGAGGCCGAGGTGTTTGCCGAGATCAAGAATGTGGAGAAGCTGCTGACGCTGCTG
AGCGCCTCCAACACGGCGCCGCGCGAAGAGGACAATGAGGAGATATCGAAGCTCTACCACCAAACACTGGCCATC
CGCCCAAAGCTCATCAAGCTGATTGAAAAGTACTCGCAAAAAAAGGACGACTTTACCCAGCTCAACGAAAAGTTC
ATCAAGGCGCGCAGGGACTACGAGGCGCTGCTCGAGTCGAGCATGTCGCATCCGCCCCAGCACAACTACCAGCAG
TACGCGCTGCGCCCCTTTTACTCGTCGGCCGGCCCGGGCGAGTCGTACCAGACACCCTCGCAGCAGCAGACGCCG
CCAGCTTCGGCCCCCTTTTACGTGGCCGGCACAGAGGTGCCCACGCAGCAGCAGCAGCAGCCAGAGCAAGCCACT
CTGCCCCATCAGTCGCCCTATGCTCACCACCGCCCGCAAAGCACCTATGGTGCCCAAGAGCTGGCCACGTCGGTC
TACGATTCGCCAATGCCACCCGCTTCTGCTCCCGGCCGTGTCGCCTCGCCCCCAGCCACCAACCAGTACGGCGCT
GCCTACCAGGGCCGCGTCCAGCCCGAGCACCAGCAGTACAAGCCATATGTGCCGCCCAGTGCGCCTGGGCCTGAT
GACTATTATCGATGA
Gene >OphauB2|7046
ATGTTCGGAGCAGCAGCGGCTGGGCCGTTTGACCAAGTCGTCGGTAAGCGGGGCTGTGGCAAGACGAGGGAGATG
AGGGCTCGGGCGGCGCTGACGACGAAGCTGCAGCCAAGGCGACGGACGAGAAGCTCACATCAGAGGACTGGGGCG
CCATCATGGAGGTGTGCGACAAGGTCTCGGGGGATGGCAACGGGCCCAAGGAGGCAGTGCAGAGCATGATGAAGC
GGCTGGCACATCGCAACGCCAACGTGCAGCTCTACACACTCGAGGTGGGTGGGCGACGGGGCCAGGAGCAGGGCA
TGGCACGGGGACAGGCTGACGCAGAGACAGCTGGCGCACGCGCTGTGCCAAAACTGCGGCAAGCCCATGCACCGC
GAAGTGTCGAGCCGGGCCTTTACCGAGGCGCTGCTCAAGCTGGCCAACGACCGCAACACGCATACGCAGGTCAAG
GGCAAGATTCTGGAAAAGGTCAAGGACTGGAGCGACATGTTTAGCGACGATGCCGACCTGGGCATCATGGACGAC
GCCTACCACCGGCTCAAGCAGAGCAATCCGACGCTGCAGGCGCCGAGCGCGCCGCAAAAACAGGGCCTGACAGCG
TCGGACCGGCAAAAGGAAGAGGACGAGCTGCAGATGGCGCTCAAGCTGAGTCTGCAGGAAGAGGACCGCAAGAAG
AAAGCGGTGGCGCCCTGGACAGCCACGACGAGTGGCGAGGCGGCGCGGCCCAGCGATGGGGCGGTGGCGGGCACG
ACGGCGGCAACCGTCAGCCGCGTGCGCGCCCTCTACGACTTCTCGCCCTCGGAGCCGGGCGAGCTCGAGTTTCGG
CGCGGCGACGTGATTGCAGTGCTGGAGAGCGTCTACAAGGACTGGTGGCGCGGCTCGCTCAAGGGCCGCACCGGC
ATCTTTCCCCTCAACTACGTGGACAAGCTGACGGACCCTACGCCCGACGAGCTGCAGCGCGAGGCGCAAATCGAG
GCCGAGGTGTTTGCCGAGATCAAGAATGTGGAGAAGCTGCTGACGCTGCTGAGCGCCTCCAACACGGCGCCGCGC
GAAGAGGACAATGAGGAGATATCGGTAGGTGCCATTTATTATGCTGGCTGGCTGGCTGGCTGGAGAGGCTGGCTG
GCTGGCTGGAGAGGCTGGCTGGCTGACTGGATAGCAGAAGCTCTACCACCAAACACTGGCCATCCGCCCAAAGCT
CATCAAGCTGATTGAAAAGTACTCGCAAAAAAAGGGTATCGCCGCCGCCTGCCCCCTCGTGCTGGCCACAGGCTG
ACGCGGCCCTCTAGACGACTTTACCCAGCTCAACGAAAAGTTCATCAAGGCGCGCAGGGACTACGAGGCGCTGCT
CGAGTCGAGCATGTCGCATCCGCCCCAGCACAACTACCAGCAGTACGCGCTGCGCCCCTTTTACTCGTCGGCCGG
CCCGGGCGAGTCGTACCAGACACCCTCGCAGCAGCAGACGCCGCCAGCTTCGGCCCCCTTTTACGTGGCCGGCAC
AGAGGTGCCCACGCAGCAGCAGCAGCAGCCAGAGCAAGCCACTCTGCCCCATCAGTCGCCCTATGCTCACCACCG
CCCGCAAAGCACCTATGGTGCCCAAGAGCTGGCCACGTCGGTCTACGATTCGCCAATGCCACCCGCTTCTGCTCC
CGGCCGTGTCGCCTCGCCCCCAGCCACCAACCAGTACGGCGCTGCCTACCAGGGCCGCGTCCAGCCCGAGCACCA
GCAGTACAAGCCATATGTGCCGCCCAGTGCGCCTGGGCCTGATGACTATTATCGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail