Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7044
Gene name
LocationContig_7:246021..250816
Strand+
Gene length (bp)4795
Transcript length (bp)4740
Coding sequence length (bp)4740
Protein length (aa) 1580

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat 8.3E-05 383 439
PF00651 BTB BTB/POZ domain 2.7E-10 908 1026
PF13637 Ank_4 Ankyrin repeats (many copies) 7.5E-06 97 153
PF13540 RCC1_2 Regulator of chromosome condensation (RCC1) repeat 1.9E-05 366 395

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74881|BTB1_SCHPO BTB/POZ domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=btb1 PE=1 SV=1 1 1088 1.0E-77
sp|Q6NRS1|IBTK_XENLA Inhibitor of Bruton tyrosine kinase OS=Xenopus laevis GN=ibtk PE=2 SV=1 86 508 3.0E-28
sp|Q9P2D0|IBTK_HUMAN Inhibitor of Bruton tyrosine kinase OS=Homo sapiens GN=IBTK PE=1 SV=3 86 508 6.0E-25
sp|Q6ZPR6|IBTK_MOUSE Inhibitor of Bruton tyrosine kinase OS=Mus musculus GN=Ibtk PE=1 SV=3 123 508 1.0E-20
sp|Q6PAV2|HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus GN=Herc4 PE=1 SV=2 311 564 6.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74881|BTB1_SCHPO BTB/POZ domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=btb1 PE=1 SV=1 1 1088 1.0E-77
sp|Q6NRS1|IBTK_XENLA Inhibitor of Bruton tyrosine kinase OS=Xenopus laevis GN=ibtk PE=2 SV=1 86 508 3.0E-28
sp|Q9P2D0|IBTK_HUMAN Inhibitor of Bruton tyrosine kinase OS=Homo sapiens GN=IBTK PE=1 SV=3 86 508 6.0E-25
sp|Q6ZPR6|IBTK_MOUSE Inhibitor of Bruton tyrosine kinase OS=Mus musculus GN=Ibtk PE=1 SV=3 123 508 1.0E-20
sp|Q6PAV2|HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus GN=Herc4 PE=1 SV=2 311 564 6.0E-11
sp|Q5GLZ8|HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens GN=HERC4 PE=1 SV=1 311 564 9.0E-11
sp|Q15034|HERC3_HUMAN Probable E3 ubiquitin-protein ligase HERC3 OS=Homo sapiens GN=HERC3 PE=1 SV=1 311 564 4.0E-10
sp|Q5PQN1|HERC4_RAT Probable E3 ubiquitin-protein ligase HERC4 OS=Rattus norvegicus GN=Herc4 PE=2 SV=1 311 564 4.0E-10
sp|Q8NDN9|RCBT1_HUMAN RCC1 and BTB domain-containing protein 1 OS=Homo sapiens GN=RCBTB1 PE=2 SV=1 235 476 3.0E-09
sp|Q99LJ7|RCBT2_MOUSE RCC1 and BTB domain-containing protein 2 OS=Mus musculus GN=Rcbtb2 PE=2 SV=1 320 476 2.0E-08
sp|Q6P798|RCBT2_RAT RCC1 and BTB domain-containing protein 2 OS=Rattus norvegicus GN=Rcbtb2 PE=2 SV=1 320 476 2.0E-08
sp|Q9P2D0|IBTK_HUMAN Inhibitor of Bruton tyrosine kinase OS=Homo sapiens GN=IBTK PE=1 SV=3 893 1088 2.0E-08
sp|Q8IVU3|HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens GN=HERC6 PE=2 SV=2 298 505 2.0E-08
sp|Q6ZPR6|IBTK_MOUSE Inhibitor of Bruton tyrosine kinase OS=Mus musculus GN=Ibtk PE=1 SV=3 858 1088 6.0E-08
sp|Q1EBV6|BPM5_ARATH BTB/POZ and MATH domain-containing protein 5 OS=Arabidopsis thaliana GN=BPM5 PE=1 SV=1 829 1086 6.0E-08
sp|Q99LJ7|RCBT2_MOUSE RCC1 and BTB domain-containing protein 2 OS=Mus musculus GN=Rcbtb2 PE=2 SV=1 240 464 8.0E-08
sp|Q6NXM2|RCBT1_MOUSE RCC1 and BTB domain-containing protein 1 OS=Mus musculus GN=Rcbtb1 PE=2 SV=1 235 456 8.0E-08
sp|Q9N1T2|RPGR_CANLF X-linked retinitis pigmentosa GTPase regulator OS=Canis lupus familiaris GN=RPGR PE=2 SV=1 320 505 8.0E-08
sp|Q6P798|RCBT2_RAT RCC1 and BTB domain-containing protein 2 OS=Rattus norvegicus GN=Rcbtb2 PE=2 SV=1 240 464 1.0E-07
sp|O95199|RCBT2_HUMAN RCC1 and BTB domain-containing protein 2 OS=Homo sapiens GN=RCBTB2 PE=1 SV=1 240 476 2.0E-07
sp|Q5RCZ7|RCBT2_PONAB RCC1 and BTB domain-containing protein 2 OS=Pongo abelii GN=RCBTB2 PE=2 SV=1 240 476 2.0E-07
sp|Q80YD6|SRGEF_MOUSE Secretion-regulating guanine nucleotide exchange factor OS=Mus musculus GN=Sergef PE=2 SV=2 234 452 3.0E-07
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 312 465 3.0E-07
sp|F2Z461|HERC6_MOUSE E3 ISG15--protein ligase Herc6 OS=Mus musculus GN=Herc6 PE=2 SV=1 320 594 4.0E-07
sp|Q9FN03|UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana GN=UVR8 PE=1 SV=1 332 596 4.0E-07
sp|Q9UII4|HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens GN=HERC5 PE=1 SV=2 348 463 9.0E-07
sp|Q9FN03|UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana GN=UVR8 PE=1 SV=1 225 397 1.0E-06
sp|Q92834|RPGR_HUMAN X-linked retinitis pigmentosa GTPase regulator OS=Homo sapiens GN=RPGR PE=1 SV=2 320 505 1.0E-06
sp|Q9UGK8|SRGEF_HUMAN Secretion-regulating guanine nucleotide exchange factor OS=Homo sapiens GN=SERGEF PE=1 SV=2 297 563 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7044
MSHLLWKYYWENDVDRFRRLLAQAGPNAPGISRNSAIGSPAANYLPVSPGGLGTSPRATAGKSRKASAHPPTHAR
FKDGGATLGRNDVNARDHAGLTVLLRASSCTDPNARLFVSALLEHPLIDIYVQDLESGWNALHRSLYAGNASIAQ
MLLAKERSDLKNHAVSSIGKIGHLIKTKDHEGKSPFDVYNSTIATRASKSAPDTAHSDHGSDSEDSEHLETLPSI
SLDAHHDSNVSRGAELYVFGSNRNHSLGVGDEDDRQFPERIWLQRPEGLLHRLHELSVEHGHIKSCRSLPTLGHV
PNTIRSQPLIIQDVVMAKMHSAIITTDAVSNLYICGVGRGGRLGLGDENTRFKYLSVQGPFADRKVHHIALGQNH
SMAVVAGGELWTWGLNSDSQLGYLLPPPPRLDQEPMSTTPRQVFGCLKKEVVQGIAASAIHSVAHTGSSLYCWGR
NVGQLALMDADSRSLDVQQTPRKVAASLLSAPISMVSAIDKATACLLANGSVWIFTNYGYNLIKFPFPDAVPVPH
LEAISFARNPDPARRDIRYITSAGETIAAITSRGDLFTMVLNQNAETQQPVGSTTNPAKIKGAVTQPQCIWTSRS
DGVVSAGVADHGSVIICTESGAVWKRVKRNRGIKAGFASSTGAKNKDFKFERVPYITGGVMARSSAFGAFAAVRR
DNSIMSRDISTAEQSLPTHVGALLPLYEFTATEPPAKLKSARQSWYSTIGAAGSNMSSVSREIMRSVKIEDELLN
WITERSTEFVDVDTNVRTTLFPNLQIPVHGWILAGRSPVLRQALSDKLWQADSSQSDVFTVESTDRKRLVTFNGL
DLVTILNLILYVYQDCLIPVWKYTREAPSEAHRFRQIRLELMKVATKLQMPNLETAARLQVDPKPCMGADFRMAL
DDSTFFAHSDIVIQLDGAQAMAHSQLLCQRCPFFQGLFNGRSRGQWVSQRRAQTPSSQQVQVDLGHIDGEVFKYV
MEFLYADTGPEMFDHVALPTVDDFSELLLDVMSVANELMLDRLSQICQSIIGKLVTTRNIANLLNEISSCSVTEF
KNVGLEYICLQLENMLENHLLDGLEDHLLQELDQAVRENQLAKSPFVRSGRADLVLHQKYPELAKDMEEERQRRV
NVLASKVQRDENKKLSLSCKARVGSLDLPPAATPPPDKSRRRSKVGPNEPLSPRLHSKDPQNDMIFSMDDEQGTT
ALSPPSYLASPESSANKIIGVMPPSTDPAANNDGKMVAKDEEVPGLSNMESCKGEGANSAVSRLRTEPHRSWSGG
PWAPWTLSTTKLDLKTIMSEVTSTSALTAGIQAQGSSVAPSKPPTRMSQKERKKQRQQQADSQLSRQSAEYNSEN
WKTVPSKNQPSPWKVATAVSKMSLRDAISSEAGNKEVLRPQVQAVAASQVQGQLERKVMGSPDTRFSGQGRATTC
PGAVAGPAIQTQKTSTLLPHSRSYMAPVAKAEPALEASMADIIGQQKRERELAKEAVAKRSLQEIQQEQAFQEWW
DQESRRAQEEEARRAARGQAKEKQAGGSRRGRKGKGKAKGSESGGTESHGSTSHCAAAVEAGPSRGGSRVRTKGG
SSRL*
Coding >OphauB2|7044
ATGAGTCACCTCTTGTGGAAATACTATTGGGAAAATGATGTCGACAGGTTTCGGCGTCTACTGGCGCAAGCTGGC
CCCAACGCGCCTGGCATCTCCAGAAACTCGGCGATAGGATCGCCTGCTGCCAATTATTTGCCTGTGAGCCCCGGC
GGGCTCGGCACCTCTCCTCGGGCTACTGCTGGCAAGTCTCGCAAGGCATCCGCACACCCGCCCACGCATGCGAGA
TTTAAAGATGGCGGCGCAACTCTGGGCCGCAACGATGTCAACGCACGCGATCACGCCGGGCTTACCGTCCTCTTG
CGCGCTTCATCTTGCACGGACCCTAATGCGCGTCTTTTTGTCAGCGCTCTTCTCGAGCACCCTCTCATTGACATT
TACGTCCAGGACTTGGAGAGCGGCTGGAACGCCCTCCACAGGTCTCTGTACGCAGGGAATGCTTCCATTGCCCAA
ATGCTACTGGCCAAGGAACGTAGCGACCTGAAAAATCACGCCGTCTCTTCTATTGGAAAGATTGGGCACCTCATA
AAAACCAAAGATCATGAAGGCAAGAGCCCCTTTGACGTATACAACTCGACTATTGCAACAAGAGCGTCCAAATCT
GCGCCTGACACGGCTCACTCGGATCATGGATCCGACAGTGAGGATAGTGAACACTTGGAAACTCTGCCGTCCATT
TCCCTCGACGCCCACCACGATTCCAACGTCAGTCGAGGGGCCGAGCTTTACGTCTTTGGCAGCAATAGAAACCAC
TCGCTGGGAGTCGGAGATGAAGACGACCGTCAGTTTCCAGAACGCATTTGGTTACAGCGTCCGGAAGGGCTATTG
CACCGTCTCCACGAGTTGTCGGTCGAACATGGCCATATCAAGTCTTGTCGCTCGCTTCCGACCTTGGGCCACGTA
CCCAACACAATTCGCAGCCAGCCCTTGATTATTCAGGACGTTGTCATGGCTAAAATGCACAGTGCCATTATCACC
ACTGATGCAGTCTCGAATCTTTACATATGCGGCGTCGGAAGGGGAGGTCGGCTAGGCCTCGGTGACGAGAATACA
CGCTTCAAGTACCTTTCCGTTCAGGGCCCCTTTGCAGACCGCAAGGTTCACCACATTGCTCTCGGCCAGAACCAC
TCCATGGCTGTCGTTGCCGGCGGAGAGCTCTGGACCTGGGGCCTCAACTCTGACTCTCAACTTGGATATCTCCTG
CCGCCTCCTCCAAGGCTGGATCAGGAGCCCATGAGCACCACTCCAAGACAGGTATTTGGCTGTCTTAAAAAAGAA
GTCGTCCAGGGCATTGCTGCCTCTGCTATCCACTCGGTTGCCCACACCGGCTCATCTCTATACTGCTGGGGCAGA
AACGTCGGCCAGCTTGCACTCATGGACGCCGATTCGAGGTCTCTCGACGTCCAGCAAACACCCCGCAAGGTGGCC
GCGTCCCTTCTGTCAGCACCAATTTCAATGGTATCCGCCATTGATAAAGCCACGGCATGCTTGCTGGCAAACGGT
TCCGTGTGGATTTTTACAAACTATGGCTACAATCTTATCAAGTTCCCCTTTCCTGATGCTGTTCCAGTTCCGCAT
CTGGAAGCAATTTCCTTTGCCCGAAACCCAGATCCTGCCCGGAGAGATATTCGATACATCACCTCAGCAGGCGAA
ACAATTGCCGCCATCACATCTCGTGGTGACCTCTTCACCATGGTACTCAACCAAAATGCCGAGACGCAGCAGCCT
GTGGGCTCCACCACTAACCCGGCCAAGATCAAGGGAGCTGTCACACAACCACAGTGCATCTGGACTTCGAGGAGT
GACGGTGTTGTCTCGGCGGGTGTTGCTGACCACGGCTCTGTCATCATTTGCACTGAATCTGGCGCCGTATGGAAG
AGGGTCAAGCGAAACAGGGGCATCAAGGCAGGCTTTGCATCGTCCACGGGTGCCAAGAATAAAGACTTCAAGTTT
GAACGCGTTCCATACATTACTGGCGGCGTCATGGCCCGAAGCTCTGCTTTTGGTGCTTTTGCCGCTGTCAGGAGA
GACAACAGCATCATGTCTCGGGACATTTCCACAGCAGAGCAATCGTTGCCAACACATGTGGGAGCCCTCCTGCCT
TTGTACGAATTTACAGCCACTGAGCCTCCTGCGAAGCTCAAGTCGGCTCGTCAGTCATGGTACAGCACCATTGGA
GCAGCAGGTAGCAATATGAGCTCGGTATCGCGAGAGATTATGCGCTCTGTCAAAATTGAAGACGAGCTGTTGAAT
TGGATAACAGAAAGAAGCACAGAGTTTGTTGACGTCGATACAAATGTCCGAACAACCTTGTTTCCTAATTTACAG
ATACCAGTTCACGGCTGGATACTGGCTGGTCGAAGCCCCGTCCTACGCCAGGCTTTGTCAGATAAGCTTTGGCAG
GCCGATTCTAGTCAGTCGGACGTCTTCACCGTCGAATCGACGGATAGGAAACGGTTGGTGACCTTTAACGGCCTG
GATCTTGTCACCATTCTCAACCTGATCTTGTATGTCTACCAAGACTGTCTCATACCAGTCTGGAAATATACTCGG
GAAGCACCATCAGAAGCGCACCGGTTTCGTCAGATCAGGCTTGAGCTCATGAAGGTGGCGACAAAGCTCCAGATG
CCAAACTTGGAAACTGCGGCACGGCTACAGGTCGACCCAAAGCCTTGCATGGGCGCTGACTTTCGAATGGCCCTG
GACGATAGCACCTTCTTTGCCCACAGTGATATTGTCATTCAACTCGATGGCGCACAAGCCATGGCACACAGTCAA
CTCCTTTGTCAGAGATGCCCGTTTTTCCAAGGCCTCTTTAACGGGCGCTCTCGCGGCCAATGGGTGTCTCAACGT
CGGGCTCAAACTCCATCGTCTCAGCAAGTCCAAGTTGATCTTGGGCACATTGATGGCGAGGTATTCAAATACGTC
ATGGAATTCCTATATGCCGATACTGGGCCTGAAATGTTTGACCATGTGGCATTGCCGACAGTTGACGACTTCTCA
GAGCTACTTCTGGATGTTATGTCTGTGGCCAATGAGCTCATGCTGGACCGCCTATCTCAAATTTGCCAATCCATC
ATTGGCAAATTAGTGACAACCAGGAATATTGCCAACTTGCTCAACGAAATAAGTTCCTGCTCCGTGACTGAGTTC
AAAAATGTGGGACTTGAATACATTTGTCTGCAGCTGGAGAACATGCTAGAAAATCATCTTCTTGACGGCCTTGAA
GACCATCTCCTGCAAGAGTTGGACCAGGCCGTTCGTGAAAATCAACTCGCCAAGTCCCCCTTTGTACGCAGTGGG
AGAGCCGATCTTGTCTTGCATCAAAAATATCCAGAATTAGCCAAGGACATGGAAGAGGAGCGACAGCGGCGCGTC
AATGTGCTAGCATCAAAGGTGCAAAGAGATGAGAACAAGAAATTGTCTCTGTCTTGCAAGGCACGTGTCGGGAGC
CTAGACCTGCCTCCTGCGGCGACACCGCCACCAGATAAATCCCGTCGAAGATCCAAAGTAGGCCCCAACGAACCT
TTGAGCCCAAGGCTGCATTCCAAGGACCCTCAAAACGACATGATTTTTAGCATGGACGACGAGCAGGGGACTACA
GCCTTGAGTCCGCCCTCTTATCTGGCTTCACCGGAGTCGAGCGCGAATAAGATTATTGGCGTTATGCCGCCATCT
ACTGACCCGGCTGCAAATAATGACGGCAAAATGGTTGCGAAAGATGAAGAGGTGCCAGGTTTGTCTAATATGGAA
AGTTGTAAGGGGGAGGGAGCAAACAGTGCTGTTTCTCGCCTGCGAACCGAGCCGCATAGAAGTTGGTCAGGCGGC
CCTTGGGCACCTTGGACGCTGTCAACAACTAAGCTGGATCTCAAGACAATCATGTCTGAAGTGACGTCTACATCA
GCCTTGACGGCTGGTATACAGGCGCAGGGGAGTAGCGTGGCGCCGAGCAAACCGCCGACGCGAATGTCACAAAAG
GAACGCAAGAAACAACGGCAACAGCAAGCAGACTCGCAACTAAGCCGACAATCAGCAGAGTATAATTCTGAAAAT
TGGAAAACAGTGCCCTCGAAAAATCAGCCTTCGCCCTGGAAAGTGGCTACAGCAGTTTCCAAGATGTCGCTCCGA
GATGCCATATCGTCAGAGGCAGGCAACAAAGAGGTGCTGCGTCCACAAGTGCAAGCTGTTGCAGCTTCCCAAGTT
CAAGGACAGCTGGAGCGAAAGGTGATGGGGTCACCTGATACGAGGTTTTCGGGACAAGGACGCGCCACGACGTGT
CCTGGAGCGGTGGCAGGGCCAGCTATTCAAACTCAAAAGACGTCGACGTTGCTACCACACTCAAGGTCTTATATG
GCTCCTGTGGCAAAGGCAGAACCGGCGCTCGAAGCTAGCATGGCAGACATAATCGGACAACAGAAGCGCGAACGG
GAGCTGGCAAAGGAAGCCGTGGCGAAACGATCACTGCAGGAGATCCAGCAAGAGCAAGCTTTCCAAGAGTGGTGG
GACCAGGAAAGCCGGCGGGCGCAAGAGGAGGAGGCTCGACGAGCTGCCAGAGGACAGGCCAAGGAGAAGCAAGCA
GGTGGCAGCAGACGTGGCCGCAAGGGAAAAGGAAAGGCCAAGGGCAGTGAATCTGGGGGGACCGAGAGCCATGGG
AGCACAAGCCACTGCGCTGCAGCAGTGGAAGCAGGGCCGTCGCGGGGCGGTAGCAGAGTGCGAACAAAGGGTGGC
AGCAGCAGGCTGTGA
Transcript >OphauB2|7044
ATGAGTCACCTCTTGTGGAAATACTATTGGGAAAATGATGTCGACAGGTTTCGGCGTCTACTGGCGCAAGCTGGC
CCCAACGCGCCTGGCATCTCCAGAAACTCGGCGATAGGATCGCCTGCTGCCAATTATTTGCCTGTGAGCCCCGGC
GGGCTCGGCACCTCTCCTCGGGCTACTGCTGGCAAGTCTCGCAAGGCATCCGCACACCCGCCCACGCATGCGAGA
TTTAAAGATGGCGGCGCAACTCTGGGCCGCAACGATGTCAACGCACGCGATCACGCCGGGCTTACCGTCCTCTTG
CGCGCTTCATCTTGCACGGACCCTAATGCGCGTCTTTTTGTCAGCGCTCTTCTCGAGCACCCTCTCATTGACATT
TACGTCCAGGACTTGGAGAGCGGCTGGAACGCCCTCCACAGGTCTCTGTACGCAGGGAATGCTTCCATTGCCCAA
ATGCTACTGGCCAAGGAACGTAGCGACCTGAAAAATCACGCCGTCTCTTCTATTGGAAAGATTGGGCACCTCATA
AAAACCAAAGATCATGAAGGCAAGAGCCCCTTTGACGTATACAACTCGACTATTGCAACAAGAGCGTCCAAATCT
GCGCCTGACACGGCTCACTCGGATCATGGATCCGACAGTGAGGATAGTGAACACTTGGAAACTCTGCCGTCCATT
TCCCTCGACGCCCACCACGATTCCAACGTCAGTCGAGGGGCCGAGCTTTACGTCTTTGGCAGCAATAGAAACCAC
TCGCTGGGAGTCGGAGATGAAGACGACCGTCAGTTTCCAGAACGCATTTGGTTACAGCGTCCGGAAGGGCTATTG
CACCGTCTCCACGAGTTGTCGGTCGAACATGGCCATATCAAGTCTTGTCGCTCGCTTCCGACCTTGGGCCACGTA
CCCAACACAATTCGCAGCCAGCCCTTGATTATTCAGGACGTTGTCATGGCTAAAATGCACAGTGCCATTATCACC
ACTGATGCAGTCTCGAATCTTTACATATGCGGCGTCGGAAGGGGAGGTCGGCTAGGCCTCGGTGACGAGAATACA
CGCTTCAAGTACCTTTCCGTTCAGGGCCCCTTTGCAGACCGCAAGGTTCACCACATTGCTCTCGGCCAGAACCAC
TCCATGGCTGTCGTTGCCGGCGGAGAGCTCTGGACCTGGGGCCTCAACTCTGACTCTCAACTTGGATATCTCCTG
CCGCCTCCTCCAAGGCTGGATCAGGAGCCCATGAGCACCACTCCAAGACAGGTATTTGGCTGTCTTAAAAAAGAA
GTCGTCCAGGGCATTGCTGCCTCTGCTATCCACTCGGTTGCCCACACCGGCTCATCTCTATACTGCTGGGGCAGA
AACGTCGGCCAGCTTGCACTCATGGACGCCGATTCGAGGTCTCTCGACGTCCAGCAAACACCCCGCAAGGTGGCC
GCGTCCCTTCTGTCAGCACCAATTTCAATGGTATCCGCCATTGATAAAGCCACGGCATGCTTGCTGGCAAACGGT
TCCGTGTGGATTTTTACAAACTATGGCTACAATCTTATCAAGTTCCCCTTTCCTGATGCTGTTCCAGTTCCGCAT
CTGGAAGCAATTTCCTTTGCCCGAAACCCAGATCCTGCCCGGAGAGATATTCGATACATCACCTCAGCAGGCGAA
ACAATTGCCGCCATCACATCTCGTGGTGACCTCTTCACCATGGTACTCAACCAAAATGCCGAGACGCAGCAGCCT
GTGGGCTCCACCACTAACCCGGCCAAGATCAAGGGAGCTGTCACACAACCACAGTGCATCTGGACTTCGAGGAGT
GACGGTGTTGTCTCGGCGGGTGTTGCTGACCACGGCTCTGTCATCATTTGCACTGAATCTGGCGCCGTATGGAAG
AGGGTCAAGCGAAACAGGGGCATCAAGGCAGGCTTTGCATCGTCCACGGGTGCCAAGAATAAAGACTTCAAGTTT
GAACGCGTTCCATACATTACTGGCGGCGTCATGGCCCGAAGCTCTGCTTTTGGTGCTTTTGCCGCTGTCAGGAGA
GACAACAGCATCATGTCTCGGGACATTTCCACAGCAGAGCAATCGTTGCCAACACATGTGGGAGCCCTCCTGCCT
TTGTACGAATTTACAGCCACTGAGCCTCCTGCGAAGCTCAAGTCGGCTCGTCAGTCATGGTACAGCACCATTGGA
GCAGCAGGTAGCAATATGAGCTCGGTATCGCGAGAGATTATGCGCTCTGTCAAAATTGAAGACGAGCTGTTGAAT
TGGATAACAGAAAGAAGCACAGAGTTTGTTGACGTCGATACAAATGTCCGAACAACCTTGTTTCCTAATTTACAG
ATACCAGTTCACGGCTGGATACTGGCTGGTCGAAGCCCCGTCCTACGCCAGGCTTTGTCAGATAAGCTTTGGCAG
GCCGATTCTAGTCAGTCGGACGTCTTCACCGTCGAATCGACGGATAGGAAACGGTTGGTGACCTTTAACGGCCTG
GATCTTGTCACCATTCTCAACCTGATCTTGTATGTCTACCAAGACTGTCTCATACCAGTCTGGAAATATACTCGG
GAAGCACCATCAGAAGCGCACCGGTTTCGTCAGATCAGGCTTGAGCTCATGAAGGTGGCGACAAAGCTCCAGATG
CCAAACTTGGAAACTGCGGCACGGCTACAGGTCGACCCAAAGCCTTGCATGGGCGCTGACTTTCGAATGGCCCTG
GACGATAGCACCTTCTTTGCCCACAGTGATATTGTCATTCAACTCGATGGCGCACAAGCCATGGCACACAGTCAA
CTCCTTTGTCAGAGATGCCCGTTTTTCCAAGGCCTCTTTAACGGGCGCTCTCGCGGCCAATGGGTGTCTCAACGT
CGGGCTCAAACTCCATCGTCTCAGCAAGTCCAAGTTGATCTTGGGCACATTGATGGCGAGGTATTCAAATACGTC
ATGGAATTCCTATATGCCGATACTGGGCCTGAAATGTTTGACCATGTGGCATTGCCGACAGTTGACGACTTCTCA
GAGCTACTTCTGGATGTTATGTCTGTGGCCAATGAGCTCATGCTGGACCGCCTATCTCAAATTTGCCAATCCATC
ATTGGCAAATTAGTGACAACCAGGAATATTGCCAACTTGCTCAACGAAATAAGTTCCTGCTCCGTGACTGAGTTC
AAAAATGTGGGACTTGAATACATTTGTCTGCAGCTGGAGAACATGCTAGAAAATCATCTTCTTGACGGCCTTGAA
GACCATCTCCTGCAAGAGTTGGACCAGGCCGTTCGTGAAAATCAACTCGCCAAGTCCCCCTTTGTACGCAGTGGG
AGAGCCGATCTTGTCTTGCATCAAAAATATCCAGAATTAGCCAAGGACATGGAAGAGGAGCGACAGCGGCGCGTC
AATGTGCTAGCATCAAAGGTGCAAAGAGATGAGAACAAGAAATTGTCTCTGTCTTGCAAGGCACGTGTCGGGAGC
CTAGACCTGCCTCCTGCGGCGACACCGCCACCAGATAAATCCCGTCGAAGATCCAAAGTAGGCCCCAACGAACCT
TTGAGCCCAAGGCTGCATTCCAAGGACCCTCAAAACGACATGATTTTTAGCATGGACGACGAGCAGGGGACTACA
GCCTTGAGTCCGCCCTCTTATCTGGCTTCACCGGAGTCGAGCGCGAATAAGATTATTGGCGTTATGCCGCCATCT
ACTGACCCGGCTGCAAATAATGACGGCAAAATGGTTGCGAAAGATGAAGAGGTGCCAGGTTTGTCTAATATGGAA
AGTTGTAAGGGGGAGGGAGCAAACAGTGCTGTTTCTCGCCTGCGAACCGAGCCGCATAGAAGTTGGTCAGGCGGC
CCTTGGGCACCTTGGACGCTGTCAACAACTAAGCTGGATCTCAAGACAATCATGTCTGAAGTGACGTCTACATCA
GCCTTGACGGCTGGTATACAGGCGCAGGGGAGTAGCGTGGCGCCGAGCAAACCGCCGACGCGAATGTCACAAAAG
GAACGCAAGAAACAACGGCAACAGCAAGCAGACTCGCAACTAAGCCGACAATCAGCAGAGTATAATTCTGAAAAT
TGGAAAACAGTGCCCTCGAAAAATCAGCCTTCGCCCTGGAAAGTGGCTACAGCAGTTTCCAAGATGTCGCTCCGA
GATGCCATATCGTCAGAGGCAGGCAACAAAGAGGTGCTGCGTCCACAAGTGCAAGCTGTTGCAGCTTCCCAAGTT
CAAGGACAGCTGGAGCGAAAGGTGATGGGGTCACCTGATACGAGGTTTTCGGGACAAGGACGCGCCACGACGTGT
CCTGGAGCGGTGGCAGGGCCAGCTATTCAAACTCAAAAGACGTCGACGTTGCTACCACACTCAAGGTCTTATATG
GCTCCTGTGGCAAAGGCAGAACCGGCGCTCGAAGCTAGCATGGCAGACATAATCGGACAACAGAAGCGCGAACGG
GAGCTGGCAAAGGAAGCCGTGGCGAAACGATCACTGCAGGAGATCCAGCAAGAGCAAGCTTTCCAAGAGTGGTGG
GACCAGGAAAGCCGGCGGGCGCAAGAGGAGGAGGCTCGACGAGCTGCCAGAGGACAGGCCAAGGAGAAGCAAGCA
GGTGGCAGCAGACGTGGCCGCAAGGGAAAAGGAAAGGCCAAGGGCAGTGAATCTGGGGGGACCGAGAGCCATGGG
AGCACAAGCCACTGCGCTGCAGCAGTGGAAGCAGGGCCGTCGCGGGGCGGTAGCAGAGTGCGAACAAAGGGTGGC
AGCAGCAGGCTGTGA
Gene >OphauB2|7044
ATGAGTCACCTCTTGTGGAAATACTATTGGGAAAATGATGTCGACAGGTTTCGGCGTCTACTGGCGCAAGCTGGC
CCCAACGCGCCTGGCATCTCCAGAAACTCGGCGATAGGATCGCCTGCTGCCAATTATTTGCCTGTGAGCCCCGGC
GGGCTCGGCACCTCTCCTCGGGCTACTGCTGGCAAGTCTCGCAAGGCATCCGCACACCCGCCCACGCATGCGAGA
TTTAAAGATGGCGGCGCAACTCTGGGCCGCAACGATGTCAACGCACGCGATCACGCCGGGCTTACCGTCCTCTTG
CGCGCTTCATCTTGCACGGACCCTAATGCGCGTCTTTTTGTCAGCGCTCTTCTCGAGCACCCTCTCATTGACATT
TACGTCCAGGACTTGGAGAGCGGCTGGAACGCCCTCCACAGGTCTCTGTACGCAGGGAATGCTTCCATTGCCCAA
ATGCTACTGGCCAAGGAACGTAGCGACCTGAAAAATCACGCCGTCTCTTCTATTGGAAAGATTGGGCACCTCATA
AAAACCAAAGATCATGAAGGCAAGAGCCCCTTTGACGTATACAACTCGACTATTGCAACAAGAGCGTCCAAATCT
GCGCCTGACACGGCTCACTCGGATCATGGATCCGACAGTGAGGATAGTGAACACTTGGAAACTCTGCCGTCCATG
TATGCTCATTCTTCTCGTATATGGAATACAGAGAGTCTGACCCAGCCCTAACAGTTCCCTCGACGCCCACCACGA
TTCCAACGTCAGTCGAGGGGCCGAGCTTTACGTCTTTGGCAGCAATAGAAACCACTCGCTGGGAGTCGGAGATGA
AGACGACCGTCAGTTTCCAGAACGCATTTGGTTACAGCGTCCGGAAGGGCTATTGCACCGTCTCCACGAGTTGTC
GGTCGAACATGGCCATATCAAGTCTTGTCGCTCGCTTCCGACCTTGGGCCACGTACCCAACACAATTCGCAGCCA
GCCCTTGATTATTCAGGACGTTGTCATGGCTAAAATGCACAGTGCCATTATCACCACTGATGCAGTCTCGAATCT
TTACATATGCGGCGTCGGAAGGGGAGGTCGGCTAGGCCTCGGTGACGAGAATACACGCTTCAAGTACCTTTCCGT
TCAGGGCCCCTTTGCAGACCGCAAGGTTCACCACATTGCTCTCGGCCAGAACCACTCCATGGCTGTCGTTGCCGG
CGGAGAGCTCTGGACCTGGGGCCTCAACTCTGACTCTCAACTTGGATATCTCCTGCCGCCTCCTCCAAGGCTGGA
TCAGGAGCCCATGAGCACCACTCCAAGACAGGTATTTGGCTGTCTTAAAAAAGAAGTCGTCCAGGGCATTGCTGC
CTCTGCTATCCACTCGGTTGCCCACACCGGCTCATCTCTATACTGCTGGGGCAGAAACGTCGGCCAGCTTGCACT
CATGGACGCCGATTCGAGGTCTCTCGACGTCCAGCAAACACCCCGCAAGGTGGCCGCGTCCCTTCTGTCAGCACC
AATTTCAATGGTATCCGCCATTGATAAAGCCACGGCATGCTTGCTGGCAAACGGTTCCGTGTGGATTTTTACAAA
CTATGGCTACAATCTTATCAAGTTCCCCTTTCCTGATGCTGTTCCAGTTCCGCATCTGGAAGCAATTTCCTTTGC
CCGAAACCCAGATCCTGCCCGGAGAGATATTCGATACATCACCTCAGCAGGCGAAACAATTGCCGCCATCACATC
TCGTGGTGACCTCTTCACCATGGTACTCAACCAAAATGCCGAGACGCAGCAGCCTGTGGGCTCCACCACTAACCC
GGCCAAGATCAAGGGAGCTGTCACACAACCACAGTGCATCTGGACTTCGAGGAGTGACGGTGTTGTCTCGGCGGG
TGTTGCTGACCACGGCTCTGTCATCATTTGCACTGAATCTGGCGCCGTATGGAAGAGGGTCAAGCGAAACAGGGG
CATCAAGGCAGGCTTTGCATCGTCCACGGGTGCCAAGAATAAAGACTTCAAGTTTGAACGCGTTCCATACATTAC
TGGCGGCGTCATGGCCCGAAGCTCTGCTTTTGGTGCTTTTGCCGCTGTCAGGAGAGACAACAGCATCATGTCTCG
GGACATTTCCACAGCAGAGCAATCGTTGCCAACACATGTGGGAGCCCTCCTGCCTTTGTACGAATTTACAGCCAC
TGAGCCTCCTGCGAAGCTCAAGTCGGCTCGTCAGTCATGGTACAGCACCATTGGAGCAGCAGGTAGCAATATGAG
CTCGGTATCGCGAGAGATTATGCGCTCTGTCAAAATTGAAGACGAGCTGTTGAATTGGATAACAGAAAGAAGCAC
AGAGTTTGTTGACGTCGATACAAATGTCCGAACAACCTTGTTTCCTAATTTACAGATACCAGTTCACGGCTGGAT
ACTGGCTGGTCGAAGCCCCGTCCTACGCCAGGCTTTGTCAGATAAGCTTTGGCAGGCCGATTCTAGTCAGTCGGA
CGTCTTCACCGTCGAATCGACGGATAGGAAACGGTTGGTGACCTTTAACGGCCTGGATCTTGTCACCATTCTCAA
CCTGATCTTGTATGTCTACCAAGACTGTCTCATACCAGTCTGGAAATATACTCGGGAAGCACCATCAGAAGCGCA
CCGGTTTCGTCAGATCAGGCTTGAGCTCATGAAGGTGGCGACAAAGCTCCAGATGCCAAACTTGGAAACTGCGGC
ACGGCTACAGGTCGACCCAAAGCCTTGCATGGGCGCTGACTTTCGAATGGCCCTGGACGATAGCACCTTCTTTGC
CCACAGTGATATTGTCATTCAACTCGATGGCGCACAAGCCATGGCACACAGTCAACTCCTTTGTCAGAGATGCCC
GTTTTTCCAAGGCCTCTTTAACGGGCGCTCTCGCGGCCAATGGGTGTCTCAACGTCGGGCTCAAACTCCATCGTC
TCAGCAAGTCCAAGTTGATCTTGGGCACATTGATGGCGAGGTATTCAAATACGTCATGGAATTCCTATATGCCGA
TACTGGGCCTGAAATGTTTGACCATGTGGCATTGCCGACAGTTGACGACTTCTCAGAGCTACTTCTGGATGTTAT
GTCTGTGGCCAATGAGCTCATGCTGGACCGCCTATCTCAAATTTGCCAATCCATCATTGGCAAATTAGTGACAAC
CAGGAATATTGCCAACTTGCTCAACGAAATAAGTTCCTGCTCCGTGACTGAGTTCAAAAATGTGGGACTTGAATA
CATTTGTCTGCAGCTGGAGAACATGCTAGAAAATCATCTTCTTGACGGCCTTGAAGACCATCTCCTGCAAGAGTT
GGACCAGGCCGTTCGTGAAAATCAACTCGCCAAGTCCCCCTTTGTACGCAGTGGGAGAGCCGATCTTGTCTTGCA
TCAAAAATATCCAGAATTAGCCAAGGACATGGAAGAGGAGCGACAGCGGCGCGTCAATGTGCTAGCATCAAAGGT
GCAAAGAGATGAGAACAAGAAATTGTCTCTGTCTTGCAAGGCACGTGTCGGGAGCCTAGACCTGCCTCCTGCGGC
GACACCGCCACCAGATAAATCCCGTCGAAGATCCAAAGTAGGCCCCAACGAACCTTTGAGCCCAAGGCTGCATTC
CAAGGACCCTCAAAACGACATGATTTTTAGCATGGACGACGAGCAGGGGACTACAGCCTTGAGTCCGCCCTCTTA
TCTGGCTTCACCGGAGTCGAGCGCGAATAAGATTATTGGCGTTATGCCGCCATCTACTGACCCGGCTGCAAATAA
TGACGGCAAAATGGTTGCGAAAGATGAAGAGGTGCCAGGTTTGTCTAATATGGAAAGTTGTAAGGGGGAGGGAGC
AAACAGTGCTGTTTCTCGCCTGCGAACCGAGCCGCATAGAAGTTGGTCAGGCGGCCCTTGGGCACCTTGGACGCT
GTCAACAACTAAGCTGGATCTCAAGACAATCATGTCTGAAGTGACGTCTACATCAGCCTTGACGGCTGGTATACA
GGCGCAGGGGAGTAGCGTGGCGCCGAGCAAACCGCCGACGCGAATGTCACAAAAGGAACGCAAGAAACAACGGCA
ACAGCAAGCAGACTCGCAACTAAGCCGACAATCAGCAGAGTATAATTCTGAAAATTGGAAAACAGTGCCCTCGAA
AAATCAGCCTTCGCCCTGGAAAGTGGCTACAGCAGTTTCCAAGATGTCGCTCCGAGATGCCATATCGTCAGAGGC
AGGCAACAAAGAGGTGCTGCGTCCACAAGTGCAAGCTGTTGCAGCTTCCCAAGTTCAAGGACAGCTGGAGCGAAA
GGTGATGGGGTCACCTGATACGAGGTTTTCGGGACAAGGACGCGCCACGACGTGTCCTGGAGCGGTGGCAGGGCC
AGCTATTCAAACTCAAAAGACGTCGACGTTGCTACCACACTCAAGGTCTTATATGGCTCCTGTGGCAAAGGCAGA
ACCGGCGCTCGAAGCTAGCATGGCAGACATAATCGGACAACAGAAGCGCGAACGGGAGCTGGCAAAGGAAGCCGT
GGCGAAACGATCACTGCAGGAGATCCAGCAAGAGCAAGCTTTCCAAGAGTGGTGGGACCAGGAAAGCCGGCGGGC
GCAAGAGGAGGAGGCTCGACGAGCTGCCAGAGGACAGGCCAAGGAGAAGCAAGCAGGTGGCAGCAGACGTGGCCG
CAAGGGAAAAGGAAAGGCCAAGGGCAGTGAATCTGGGGGGACCGAGAGCCATGGGAGCACAAGCCACTGCGCTGC
AGCAGTGGAAGCAGGGCCGTCGCGGGGCGGTAGCAGAGTGCGAACAAAGGGTGGCAGCAGCAGGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail