Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7043
Gene name
LocationContig_7:243234..244536
Strand-
Gene length (bp)1302
Transcript length (bp)900
Coding sequence length (bp)900
Protein length (aa) 300

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00153 Mito_carr Mitochondrial carrier protein 1.3E-25 7 101
PF00153 Mito_carr Mitochondrial carrier protein 6.7E-19 113 195
PF00153 Mito_carr Mitochondrial carrier protein 8.6E-19 204 297

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P3T7|ODC_SCHPO Probable mitochondrial 2-oxodicarboxylate carrier OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.09 PE=3 SV=1 8 296 1.0E-131
sp|Q99297|ODC2_YEAST Mitochondrial 2-oxodicarboxylate carrier 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC2 PE=1 SV=1 6 298 4.0E-131
sp|Q03028|ODC1_YEAST Mitochondrial 2-oxodicarboxylate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC1 PE=1 SV=1 2 298 5.0E-123
sp|Q55GE2|ODC_DICDI Probable mitochondrial 2-oxodicarboxylate carrier OS=Dictyostelium discoideum GN=mcfT PE=3 SV=1 6 292 4.0E-101
sp|Q5RFB7|ODC_PONAB Mitochondrial 2-oxodicarboxylate carrier OS=Pongo abelii GN=SLC25A21 PE=2 SV=1 13 287 5.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P3T7|ODC_SCHPO Probable mitochondrial 2-oxodicarboxylate carrier OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.09 PE=3 SV=1 8 296 1.0E-131
sp|Q99297|ODC2_YEAST Mitochondrial 2-oxodicarboxylate carrier 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC2 PE=1 SV=1 6 298 4.0E-131
sp|Q03028|ODC1_YEAST Mitochondrial 2-oxodicarboxylate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC1 PE=1 SV=1 2 298 5.0E-123
sp|Q55GE2|ODC_DICDI Probable mitochondrial 2-oxodicarboxylate carrier OS=Dictyostelium discoideum GN=mcfT PE=3 SV=1 6 292 4.0E-101
sp|Q5RFB7|ODC_PONAB Mitochondrial 2-oxodicarboxylate carrier OS=Pongo abelii GN=SLC25A21 PE=2 SV=1 13 287 5.0E-60
sp|Q99JD3|ODC_RAT Mitochondrial 2-oxodicarboxylate carrier OS=Rattus norvegicus GN=Slc25a21 PE=2 SV=1 13 287 1.0E-59
sp|Q9BQT8|ODC_HUMAN Mitochondrial 2-oxodicarboxylate carrier OS=Homo sapiens GN=SLC25A21 PE=1 SV=1 13 287 3.0E-59
sp|Q8BZ09|ODC_MOUSE Mitochondrial 2-oxodicarboxylate carrier OS=Mus musculus GN=Slc25a21 PE=1 SV=1 13 287 2.0E-57
sp|A0JN87|ODC_BOVIN Mitochondrial 2-oxodicarboxylate carrier OS=Bos taurus GN=SLC25A21 PE=2 SV=1 13 287 9.0E-54
sp|Q86AV5|MCFX_DICDI Mitochondrial substrate carrier family protein X OS=Dictyostelium discoideum GN=mcfX PE=3 SV=1 3 287 1.0E-42
sp|Q75AH6|AGC1_ASHGO Mitochondrial aspartate-glutamate transporter AGC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGC1 PE=3 SV=2 11 298 5.0E-39
sp|Q9QXX4|CMC2_MOUSE Calcium-binding mitochondrial carrier protein Aralar2 OS=Mus musculus GN=Slc25a13 PE=1 SV=1 12 287 4.0E-36
sp|Q8BH59|CMC1_MOUSE Calcium-binding mitochondrial carrier protein Aralar1 OS=Mus musculus GN=Slc25a12 PE=1 SV=1 12 287 8.0E-36
sp|Q54RB9|CMC_DICDI Calcium-binding mitochondrial carrier protein OS=Dictyostelium discoideum GN=mcfO PE=3 SV=1 8 287 9.0E-36
sp|O75746|CMC1_HUMAN Calcium-binding mitochondrial carrier protein Aralar1 OS=Homo sapiens GN=SLC25A12 PE=1 SV=2 12 287 1.0E-35
sp|Q5RBC8|CMC1_PONAB Calcium-binding mitochondrial carrier protein Aralar1 OS=Pongo abelii GN=SLC25A12 PE=2 SV=1 12 287 1.0E-35
sp|Q9UJS0|CMC2_HUMAN Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens GN=SLC25A13 PE=1 SV=2 12 287 2.0E-35
sp|Q9VA73|CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster GN=aralar1 PE=2 SV=1 12 294 5.0E-35
sp|Q8HXW2|CMC2_MACFA Calcium-binding mitochondrial carrier protein Aralar2 OS=Macaca fascicularis GN=SLC25A13 PE=2 SV=1 12 287 2.0E-34
sp|P97521|MCAT_RAT Mitochondrial carnitine/acylcarnitine carrier protein OS=Rattus norvegicus GN=Slc25a20 PE=1 SV=1 1 291 3.0E-34
sp|Q9Z2Z6|MCAT_MOUSE Mitochondrial carnitine/acylcarnitine carrier protein OS=Mus musculus GN=Slc25a20 PE=1 SV=1 1 291 3.0E-34
sp|Q12482|AGC1_YEAST Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGC1 PE=3 SV=1 11 287 9.0E-34
sp|O43772|MCAT_HUMAN Mitochondrial carnitine/acylcarnitine carrier protein OS=Homo sapiens GN=SLC25A20 PE=1 SV=1 1 291 1.0E-33
sp|Q9VQG4|COLT_DROME Congested-like trachea protein OS=Drosophila melanogaster GN=colt PE=2 SV=1 1 278 2.0E-33
sp|A4QNX2|S247B_DANRE Solute carrier family 25 member 47-B OS=Danio rerio GN=slc25a47b PE=2 SV=1 14 295 2.0E-32
sp|Q8HXY2|MCAT_MACFA Mitochondrial carnitine/acylcarnitine carrier protein OS=Macaca fascicularis GN=SLC25A20 PE=2 SV=1 1 291 3.0E-32
sp|Q27238|ADT1_ANOGA ADP,ATP carrier protein 1 OS=Anopheles gambiae GN=AGAP006782 PE=2 SV=2 1 290 3.0E-32
sp|Q7PQV7|ADT2_ANOGA ADP,ATP carrier protein 2 OS=Anopheles gambiae GN=AGAP002358 PE=3 SV=2 1 290 1.0E-31
sp|Q54PY7|M2OM_DICDI Probable mitochondrial 2-oxoglutarate/malate carrier protein OS=Dictyostelium discoideum GN=ucpC PE=3 SV=1 13 287 1.0E-31
sp|Q02978|M2OM_HUMAN Mitochondrial 2-oxoglutarate/malate carrier protein OS=Homo sapiens GN=SLC25A11 PE=1 SV=3 13 292 1.0E-31
sp|Q54FE6|MCFS_DICDI Mitochondrial substrate carrier family protein S OS=Dictyostelium discoideum GN=mcfS PE=3 SV=1 16 291 1.0E-31
sp|Q9CR62|M2OM_MOUSE Mitochondrial 2-oxoglutarate/malate carrier protein OS=Mus musculus GN=Slc25a11 PE=1 SV=3 1 292 2.0E-31
sp|P48962|ADT1_MOUSE ADP/ATP translocase 1 OS=Mus musculus GN=Slc25a4 PE=1 SV=4 5 290 4.0E-31
sp|Q505J6|GHC2_RAT Mitochondrial glutamate carrier 2 OS=Rattus norvegicus GN=Slc25a18 PE=2 SV=2 1 282 7.0E-31
sp|Q26365|ADT_DROME ADP,ATP carrier protein OS=Drosophila melanogaster GN=sesB PE=2 SV=4 1 290 7.0E-31
sp|Q9H1K4|GHC2_HUMAN Mitochondrial glutamate carrier 2 OS=Homo sapiens GN=SLC25A18 PE=1 SV=1 1 282 8.0E-31
sp|Q9DB41|GHC2_MOUSE Mitochondrial glutamate carrier 2 OS=Mus musculus GN=Slc25a18 PE=1 SV=4 1 282 8.0E-31
sp|P79110|TXTP_BOVIN Tricarboxylate transport protein, mitochondrial OS=Bos taurus GN=SLC25A1 PE=2 SV=1 16 297 8.0E-31
sp|Q9M038|SFC1_ARATH Mitochondrial succinate-fumarate transporter 1 OS=Arabidopsis thaliana GN=SFC1 PE=2 SV=1 2 294 9.0E-31
sp|Q05962|ADT1_RAT ADP/ATP translocase 1 OS=Rattus norvegicus GN=Slc25a4 PE=1 SV=3 5 290 2.0E-30
sp|Q5HZE0|MCATL_RAT Mitochondrial basic amino acids transporter OS=Rattus norvegicus GN=Slc25a29 PE=2 SV=1 14 295 3.0E-30
sp|Q27257|DIF1_CAEEL Protein dif-1 OS=Caenorhabditis elegans GN=dif-1 PE=2 SV=1 11 295 4.0E-30
sp|Q8BL03|MCATL_MOUSE Mitochondrial basic amino acids transporter OS=Mus musculus GN=Slc25a29 PE=1 SV=1 14 295 4.0E-30
sp|Q54W11|MCFL_DICDI Mitochondrial substrate carrier family protein L OS=Dictyostelium discoideum GN=mcfL PE=3 SV=1 11 294 6.0E-30
sp|P33303|SFC1_YEAST Succinate/fumarate mitochondrial transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFC1 PE=1 SV=2 1 297 9.0E-30
sp|Q54BM3|MCFG_DICDI Mitochondrial substrate carrier family protein G OS=Dictyostelium discoideum GN=mcfG PE=2 SV=1 16 287 9.0E-30
sp|Q08DK7|MCATL_BOVIN Mitochondrial basic amino acids transporter OS=Bos taurus GN=SLC25A29 PE=2 SV=1 14 295 1.0E-29
sp|P12235|ADT1_HUMAN ADP/ATP translocase 1 OS=Homo sapiens GN=SLC25A4 PE=1 SV=4 5 290 2.0E-29
sp|Q8N8R3|MCATL_HUMAN Mitochondrial basic amino acids transporter OS=Homo sapiens GN=SLC25A29 PE=1 SV=2 13 295 2.0E-29
sp|Q3V132|ADT4_MOUSE ADP/ATP translocase 4 OS=Mus musculus GN=Slc25a31 PE=1 SV=1 7 292 2.0E-29
sp|P97700|M2OM_RAT Mitochondrial 2-oxoglutarate/malate carrier protein OS=Rattus norvegicus GN=Slc25a11 PE=1 SV=3 1 292 4.0E-29
sp|P22292|M2OM_BOVIN Mitochondrial 2-oxoglutarate/malate carrier protein OS=Bos taurus GN=SLC25A11 PE=1 SV=3 1 292 5.0E-29
sp|O46373|ADT1_RABIT ADP/ATP translocase 1 OS=Oryctolagus cuniculus GN=SLC25A4 PE=2 SV=3 5 290 5.0E-29
sp|B0G143|UCPB_DICDI Mitochondrial substrate carrier family protein ucpB OS=Dictyostelium discoideum GN=ucpB PE=3 SV=1 13 287 6.0E-29
sp|P02723|ADT_NEUCR ADP,ATP carrier protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aac PE=3 SV=1 1 285 8.0E-29
sp|P02722|ADT1_BOVIN ADP/ATP translocase 1 OS=Bos taurus GN=SLC25A4 PE=1 SV=3 5 290 1.0E-28
sp|P12236|ADT3_HUMAN ADP/ATP translocase 3 OS=Homo sapiens GN=SLC25A6 PE=1 SV=4 5 287 2.0E-28
sp|O97562|UCP2_PIG Mitochondrial uncoupling protein 2 OS=Sus scrofa GN=UCP2 PE=2 SV=1 7 287 3.0E-28
sp|P32007|ADT3_BOVIN ADP/ATP translocase 3 OS=Bos taurus GN=SLC25A6 PE=1 SV=3 5 287 4.0E-28
sp|Q8SQH5|ADT2_BOVIN ADP/ATP translocase 2 OS=Bos taurus GN=SLC25A5 PE=2 SV=3 5 290 4.0E-28
sp|Q9H0C2|ADT4_HUMAN ADP/ATP translocase 4 OS=Homo sapiens GN=SLC25A31 PE=2 SV=1 15 295 6.0E-28
sp|Q54QN2|MCFM_DICDI Mitochondrial substrate carrier family protein M OS=Dictyostelium discoideum GN=mcfM PE=3 SV=1 30 295 7.0E-28
sp|Q000K2|ADT2_TACAC ADP/ATP translocase 2 OS=Tachyglossus aculeatus aculeatus GN=SLC25A5 PE=2 SV=1 5 290 7.0E-28
sp|Q5R5A1|ADT2_PONAB ADP/ATP translocase 2 OS=Pongo abelii GN=SLC25A5 PE=2 SV=3 5 290 7.0E-28
sp|P51881|ADT2_MOUSE ADP/ATP translocase 2 OS=Mus musculus GN=Slc25a5 PE=1 SV=3 5 290 9.0E-28
sp|P05141|ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens GN=SLC25A5 PE=1 SV=7 5 290 1.0E-27
sp|Q09073|ADT2_RAT ADP/ATP translocase 2 OS=Rattus norvegicus GN=Slc25a5 PE=1 SV=3 5 290 1.0E-27
sp|Q4R8M0|ADT4_MACFA ADP/ATP translocase 4 OS=Macaca fascicularis GN=SLC25A31 PE=2 SV=1 15 295 2.0E-27
sp|P53007|TXTP_HUMAN Tricarboxylate transport protein, mitochondrial OS=Homo sapiens GN=SLC25A1 PE=1 SV=2 16 297 2.0E-27
sp|Q2YDD9|ADT4_BOVIN ADP/ATP translocase 4 OS=Bos taurus GN=SLC25A31 PE=2 SV=1 14 292 2.0E-27
sp|Q9P6L7|YKQ9_SCHPO Uncharacterized mitochondrial carrier C688.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC688.09 PE=3 SV=1 2 292 2.0E-27
sp|Q5RD81|GHC1_PONAB Mitochondrial glutamate carrier 1 OS=Pongo abelii GN=SLC25A22 PE=2 SV=1 1 287 3.0E-27
sp|Q6QRN9|ADT3_PIG ADP/ATP translocase 3 OS=Sus scrofa GN=SLC25A6 PE=2 SV=3 5 287 3.0E-27
sp|Q9H936|GHC1_HUMAN Mitochondrial glutamate carrier 1 OS=Homo sapiens GN=SLC25A22 PE=1 SV=1 1 287 5.0E-27
sp|Q6IS41|S2547_MOUSE Solute carrier family 25 member 47 OS=Mus musculus GN=Slc25a47 PE=2 SV=2 13 291 2.0E-26
sp|P27080|ADT_CHLRE ADP,ATP carrier protein OS=Chlamydomonas reinhardtii GN=ABT PE=2 SV=1 1 283 5.0E-26
sp|Q9D6M3|GHC1_MOUSE Mitochondrial glutamate carrier 1 OS=Mus musculus GN=Slc25a22 PE=1 SV=1 17 287 6.0E-26
sp|Q8JZU2|TXTP_MOUSE Tricarboxylate transport protein, mitochondrial OS=Mus musculus GN=Slc25a1 PE=1 SV=1 16 297 7.0E-26
sp|Q93XM7|MCAT_ARATH Mitochondrial carnitine/acylcarnitine carrier-like protein OS=Arabidopsis thaliana GN=BOU PE=2 SV=1 13 287 8.0E-26
sp|P70406|UCP2_MOUSE Mitochondrial uncoupling protein 2 OS=Mus musculus GN=Ucp2 PE=1 SV=1 7 287 8.0E-26
sp|O77792|UCP3_BOVIN Mitochondrial uncoupling protein 3 OS=Bos taurus GN=UCP3 PE=2 SV=1 5 287 1.0E-25
sp|Q08DK4|GHC1_BOVIN Mitochondrial glutamate carrier 1 OS=Bos taurus GN=SLC25A22 PE=2 SV=1 1 287 1.0E-25
sp|Q9ZWG1|PUMP2_ARATH Mitochondrial uncoupling protein 2 OS=Arabidopsis thaliana GN=PUMP2 PE=2 SV=1 8 296 1.0E-25
sp|P56500|UCP2_RAT Mitochondrial uncoupling protein 2 OS=Rattus norvegicus GN=Ucp2 PE=2 SV=1 7 287 1.0E-25
sp|Q9SUV1|BRT1_ARATH Adenine nucleotide transporter BT1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=BT1 PE=1 SV=1 4 195 1.0E-25
sp|P32089|TXTP_RAT Tricarboxylate transport protein, mitochondrial OS=Rattus norvegicus GN=Slc25a1 PE=1 SV=1 16 297 2.0E-25
sp|Q10248|YD1K_SCHPO Uncharacterized mitochondrial carrier C4G9.20c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.20c PE=3 SV=2 13 297 2.0E-25
sp|Q6J329|S2547_RAT Solute carrier family 25 member 47 OS=Rattus norvegicus GN=Slc25a47 PE=2 SV=1 13 291 3.0E-25
sp|P55851|UCP2_HUMAN Mitochondrial uncoupling protein 2 OS=Homo sapiens GN=UCP2 PE=1 SV=1 7 287 3.0E-25
sp|Q9N2J1|UCP2_CANLF Mitochondrial uncoupling protein 2 OS=Canis lupus familiaris GN=UCP2 PE=2 SV=1 7 287 3.0E-25
sp|O97649|UCP3_PIG Mitochondrial uncoupling protein 3 OS=Sus scrofa GN=UCP3 PE=2 SV=1 7 298 3.0E-25
sp|Q9SUV1|BRT1_ARATH Adenine nucleotide transporter BT1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=BT1 PE=1 SV=1 9 287 5.0E-25
sp|Q5R5A8|UCP2_PONAB Mitochondrial uncoupling protein 2 OS=Pongo abelii GN=UCP2 PE=2 SV=1 7 287 5.0E-25
sp|P18238|ADT3_YEAST ADP,ATP carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AAC3 PE=1 SV=1 4 283 5.0E-25
sp|Q6Q0C1|S2547_HUMAN Solute carrier family 25 member 47 OS=Homo sapiens GN=SLC25A47 PE=2 SV=1 13 297 6.0E-25
sp|Q66L49|SCMC1_DANRE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Danio rerio GN=slc25a24 PE=2 SV=1 13 287 7.0E-25
sp|Q21153|CMC1_CAEEL Probable calcium-binding mitochondrial carrier K02F3.2 OS=Caenorhabditis elegans GN=K02F3.2 PE=3 SV=3 12 294 1.0E-24
sp|Q3SZI5|UCP2_BOVIN Mitochondrial uncoupling protein 2 OS=Bos taurus GN=UCP2 PE=2 SV=1 7 287 1.0E-24
sp|Q29RM1|TPC_BOVIN Mitochondrial thiamine pyrophosphate carrier OS=Bos taurus GN=SLC25A19 PE=2 SV=1 16 298 2.0E-24
sp|O97470|ADT_DICDI Mitochondrial substrate carrier family protein ancA OS=Dictyostelium discoideum GN=ancA PE=1 SV=1 1 290 3.0E-24
sp|Q84UC7|BAC1_ARATH Mitochondrial arginine transporter BAC1 OS=Arabidopsis thaliana GN=BAC1 PE=1 SV=1 10 291 4.0E-24
sp|P18239|ADT2_YEAST ADP,ATP carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET9 PE=1 SV=2 10 283 8.0E-24
sp|P38152|TXTP_YEAST Tricarboxylate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTP1 PE=2 SV=3 11 291 1.0E-23
sp|Q54S10|MCFU_DICDI Mitochondrial substrate carrier family protein U OS=Dictyostelium discoideum GN=mcfU PE=3 SV=1 13 282 1.0E-23
sp|Q552L9|S2540_DICDI Mitochondrial substrate carrier family protein H OS=Dictyostelium discoideum GN=mcfH PE=3 SV=1 16 287 1.0E-23
sp|Q9W725|UCP2_CYPCA Mitochondrial uncoupling protein 2 OS=Cyprinus carpio GN=ucp2 PE=2 SV=1 7 287 1.0E-23
sp|P56499|UCP3_RAT Mitochondrial uncoupling protein 3 OS=Rattus norvegicus GN=Ucp3 PE=2 SV=1 1 287 1.0E-23
sp|P56501|UCP3_MOUSE Mitochondrial uncoupling protein 3 OS=Mus musculus GN=Ucp3 PE=1 SV=1 1 298 1.0E-23
sp|O81845|PUMP1_ARATH Mitochondrial uncoupling protein 1 OS=Arabidopsis thaliana GN=PUMP1 PE=1 SV=1 14 299 2.0E-23
sp|Q54VX4|MCFJ_DICDI Mitochondrial substrate carrier family protein J OS=Dictyostelium discoideum GN=mcfJ PE=2 SV=1 10 290 3.0E-23
sp|P04709|ADT1_MAIZE ADP,ATP carrier protein 1, mitochondrial OS=Zea mays GN=ANT1 PE=2 SV=3 10 283 4.0E-23
sp|P25874|UCP1_HUMAN Mitochondrial brown fat uncoupling protein 1 OS=Homo sapiens GN=UCP1 PE=2 SV=3 14 298 4.0E-23
sp|Q6NUK1|SCMC1_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens GN=SLC25A24 PE=1 SV=2 13 294 4.0E-23
sp|P38087|YMC2_YEAST Carrier protein YMC2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMC2 PE=1 SV=1 16 291 5.0E-23
sp|O95258|UCP5_HUMAN Brain mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A14 PE=2 SV=1 9 287 5.0E-23
sp|Q94AG6|SAMC1_ARATH S-adenosylmethionine carrier 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SAMC1 PE=1 SV=1 2 298 5.0E-23
sp|Q9CR58|KMCP1_MOUSE Kidney mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a30 PE=1 SV=1 9 287 7.0E-23
sp|Q8BMD8|SCMC1_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Mus musculus GN=Slc25a24 PE=1 SV=1 13 294 8.0E-23
sp|Q9Z2B2|UCP5_MOUSE Brain mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a14 PE=1 SV=2 9 287 9.0E-23
sp|P31692|ADT_PARKE ADP,ATP carrier protein OS=Parachlorella kessleri PE=3 SV=1 4 290 9.0E-23
sp|P04633|UCP1_RAT Mitochondrial brown fat uncoupling protein 1 OS=Rattus norvegicus GN=Ucp1 PE=1 SV=2 14 298 9.0E-23
sp|Q18P97|UCP1_SUNMU Mitochondrial brown fat uncoupling protein 1 OS=Suncus murinus GN=UCP1 PE=2 SV=1 7 298 1.0E-22
sp|P12857|ADT2_MAIZE ADP,ATP carrier protein 2, mitochondrial OS=Zea mays GN=ANT2 PE=2 SV=2 10 283 1.0E-22
sp|P32331|YMC1_YEAST Carrier protein YMC1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMC1 PE=3 SV=2 16 291 1.0E-22
sp|P34519|TXTP_CAEEL Putative tricarboxylate transport protein, mitochondrial OS=Caenorhabditis elegans GN=K11H3.3 PE=3 SV=1 29 292 1.0E-22
sp|Q9ER18|UCP1_PHOSU Mitochondrial brown fat uncoupling protein 1 OS=Phodopus sungorus GN=UCP1 PE=2 SV=1 14 298 1.0E-22
sp|Q7XA87|FOLT1_ARATH Folate transporter 1, chloroplastic OS=Arabidopsis thaliana GN=FOLT1 PE=2 SV=1 16 296 1.0E-22
sp|Q6P316|S2540_XENTR Solute carrier family 25 member 40 OS=Xenopus tropicalis GN=slc25a40 PE=2 SV=1 13 299 2.0E-22
sp|A0PC02|UCP1_OCHDA Mitochondrial brown fat uncoupling protein 1 OS=Ochotona dauurica GN=UCP1 PE=2 SV=1 14 298 2.0E-22
sp|Q9XI74|PUMP3_ARATH Mitochondrial uncoupling protein 3 OS=Arabidopsis thaliana GN=PUMP3 PE=2 SV=1 27 278 2.0E-22
sp|P12242|UCP1_MOUSE Mitochondrial brown fat uncoupling protein 1 OS=Mus musculus GN=Ucp1 PE=1 SV=2 14 298 2.0E-22
sp|Q54B67|MCFZ_DICDI Mitochondrial substrate carrier family protein Z OS=Dictyostelium discoideum GN=mcfZ PE=2 SV=1 2 291 2.0E-22
sp|Q8HXE3|KMCP1_MACFA Kidney mitochondrial carrier protein 1 OS=Macaca fascicularis GN=SLC25A30 PE=2 SV=1 9 287 2.0E-22
sp|O95847|UCP4_HUMAN Mitochondrial uncoupling protein 4 OS=Homo sapiens GN=SLC25A27 PE=2 SV=1 2 297 2.0E-22
sp|Q9N2I9|UCP3_CANLF Mitochondrial uncoupling protein 3 OS=Canis lupus familiaris GN=UCP3 PE=2 SV=1 1 287 2.0E-22
sp|A5PJZ1|SCMC1_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Bos taurus GN=SLC25A24 PE=2 SV=1 13 294 2.0E-22
sp|Q5XGI1|KMCP1_XENTR Kidney mitochondrial carrier protein 1 OS=Xenopus tropicalis GN=slc25a30 PE=2 SV=1 9 287 3.0E-22
sp|P55916|UCP3_HUMAN Mitochondrial uncoupling protein 3 OS=Homo sapiens GN=UCP3 PE=1 SV=1 13 287 3.0E-22
sp|Q8K404|UCP1_DICGR Mitochondrial brown fat uncoupling protein 1 OS=Dicrostonyx groenlandicus GN=UCP1 PE=2 SV=1 2 298 3.0E-22
sp|P04575|UCP1_MESAU Mitochondrial brown fat uncoupling protein 1 OS=Mesocricetus auratus GN=UCP1 PE=1 SV=3 14 298 4.0E-22
sp|Q03829|YM39_YEAST Uncharacterized mitochondrial carrier YMR166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR166C PE=1 SV=1 9 291 5.0E-22
sp|Q5PQM9|KMCP1_RAT Kidney mitochondrial carrier protein 1 OS=Rattus norvegicus GN=Slc25a30 PE=2 SV=1 9 287 5.0E-22
sp|Q9WVD5|ORNT1_MOUSE Mitochondrial ornithine transporter 1 OS=Mus musculus GN=Slc25a15 PE=1 SV=1 13 287 5.0E-22
sp|Q55E45|MCFE_DICDI Mitochondrial substrate carrier family protein E OS=Dictyostelium discoideum GN=mcfE PE=3 SV=1 2 297 6.0E-22
sp|Q5SVS4|KMCP1_HUMAN Kidney mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A30 PE=1 SV=1 9 287 6.0E-22
sp|Q8N5S1|S2541_HUMAN Solute carrier family 25 member 41 OS=Homo sapiens GN=SLC25A41 PE=2 SV=2 16 294 8.0E-22
sp|P14271|UCP1_RABIT Mitochondrial brown fat uncoupling protein 1 OS=Oryctolagus cuniculus GN=UCP1 PE=2 SV=1 14 287 9.0E-22
sp|F4HT41|SAMC2_ARATH Probable S-adenosylmethionine carrier 2, chloroplastic OS=Arabidopsis thaliana GN=SAMC2 PE=2 SV=1 3 287 1.0E-21
sp|Q9W720|UCP2_DANRE Mitochondrial uncoupling protein 2 OS=Danio rerio GN=ucp2 PE=2 SV=1 7 287 1.0E-21
sp|Q55DY8|MFRN_DICDI Mitoferrin OS=Dictyostelium discoideum GN=mcfF PE=3 SV=1 10 287 1.0E-21
sp|Q5NVC1|TPC_PONAB Mitochondrial thiamine pyrophosphate carrier OS=Pongo abelii GN=SLC25A19 PE=2 SV=1 16 297 1.0E-21
sp|Q55E85|MCFD_DICDI Mitochondrial substrate carrier family protein D OS=Dictyostelium discoideum GN=mcfD PE=3 SV=1 13 289 1.0E-21
sp|Q8CFJ7|S2545_MOUSE Solute carrier family 25 member 45 OS=Mus musculus GN=Slc25a45 PE=1 SV=1 11 295 1.0E-21
sp|Q9HC21|TPC_HUMAN Mitochondrial thiamine pyrophosphate carrier OS=Homo sapiens GN=SLC25A19 PE=1 SV=1 16 297 1.0E-21
sp|Q5IS35|TPC_MACFA Mitochondrial thiamine pyrophosphate carrier OS=Macaca fascicularis GN=SLC25A19 PE=2 SV=1 16 297 2.0E-21
sp|Q6CQR3|TPC1_KLULA Mitochondrial thiamine pyrophosphate carrier 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TPC1 PE=3 SV=1 16 294 2.0E-21
sp|O18757|SCMC1_RABIT Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Oryctolagus cuniculus GN=SLC25A24 PE=1 SV=1 13 294 2.0E-21
sp|Q6DFK2|S2540_XENLA Solute carrier family 25 member 40 OS=Xenopus laevis GN=slc25a40 PE=2 SV=1 13 299 2.0E-21
sp|A4RF23|TPC1_MAGO7 Mitochondrial thiamine pyrophosphate carrier 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TPC1 PE=3 SV=2 16 291 2.0E-21
sp|Q7ZY36|SCM1A_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-A OS=Xenopus laevis GN=slc25a24-a PE=2 SV=2 2 287 2.0E-21
sp|Q5HZE0|MCATL_RAT Mitochondrial basic amino acids transporter OS=Rattus norvegicus GN=Slc25a29 PE=2 SV=1 4 188 3.0E-21
sp|Q08DK7|MCATL_BOVIN Mitochondrial basic amino acids transporter OS=Bos taurus GN=SLC25A29 PE=2 SV=1 13 188 3.0E-21
sp|Q9Y619|ORNT1_HUMAN Mitochondrial ornithine transporter 1 OS=Homo sapiens GN=SLC25A15 PE=1 SV=1 13 287 3.0E-21
sp|Q8BVN7|S2541_MOUSE Solute carrier family 25 member 41 OS=Mus musculus GN=Slc25a41 PE=2 SV=1 16 294 3.0E-21
sp|P31691|ADT_ORYSJ ADP,ATP carrier protein, mitochondrial OS=Oryza sativa subsp. japonica GN=Os02g0718900 PE=2 SV=1 10 283 3.0E-21
sp|O14281|YETC_SCHPO Uncharacterized mitochondrial carrier C8C9.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC8C9.12c PE=3 SV=1 9 282 3.0E-21
sp|Q5XHA0|SCMC1_XENTR Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Xenopus tropicalis GN=slc25a24 PE=2 SV=1 2 287 4.0E-21
sp|Q6DHC3|S2540_DANRE Solute carrier family 25 member 40 OS=Danio rerio GN=slc25a40 PE=2 SV=1 9 296 6.0E-21
sp|Q9GMZ1|UCP1_CANLF Mitochondrial brown fat uncoupling protein 1 OS=Canis lupus familiaris GN=UCP1 PE=2 SV=1 26 287 6.0E-21
sp|Q8N413|S2545_HUMAN Solute carrier family 25 member 45 OS=Homo sapiens GN=SLC25A45 PE=2 SV=2 11 268 7.0E-21
sp|P0CAT2|S238B_DANRE Solute carrier family 25 member 38-B OS=Danio rerio GN=slc25a38b PE=3 SV=2 9 275 7.0E-21
sp|Q8BL03|MCATL_MOUSE Mitochondrial basic amino acids transporter OS=Mus musculus GN=Slc25a29 PE=1 SV=1 4 188 8.0E-21
sp|Q6DJ08|S2538_XENTR Solute carrier family 25 member 38 OS=Xenopus tropicalis GN=slc25a38 PE=2 SV=1 9 275 8.0E-21
sp|Q01356|ARG13_NEUCR Amino-acid transporter arg-13 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arg-13 PE=2 SV=1 17 294 9.0E-21
sp|Q7T0U6|SCM1B_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-B OS=Xenopus laevis GN=slc25a24-b PE=2 SV=1 2 287 1.0E-20
sp|Q9DAM5|TPC_MOUSE Mitochondrial thiamine pyrophosphate carrier OS=Mus musculus GN=Slc25a19 PE=1 SV=1 16 298 1.0E-20
sp|O22342|ADT1_GOSHI ADP,ATP carrier protein 1, mitochondrial OS=Gossypium hirsutum GN=ANT1 PE=2 SV=1 10 283 1.0E-20
sp|Q41629|ADT1_WHEAT ADP,ATP carrier protein 1, mitochondrial OS=Triticum aestivum GN=ANT-G1 PE=3 SV=1 10 283 1.0E-20
sp|Q6DE75|S2538_XENLA Solute carrier family 25 member 38 OS=Xenopus laevis GN=slc25a38 PE=2 SV=1 9 275 1.0E-20
sp|Q86HN8|MCFY_DICDI Mitochondrial substrate carrier family protein Y OS=Dictyostelium discoideum GN=mcfY PE=3 SV=1 20 292 1.0E-20
sp|Q52KK3|S2551_RAT Solute carrier family 25 member 51 OS=Rattus norvegicus GN=Slc25a51 PE=2 SV=1 11 268 1.0E-20
sp|Q1E7P0|TPC1_COCIM Mitochondrial thiamine pyrophosphate carrier 1 OS=Coccidioides immitis (strain RS) GN=TPC1 PE=3 SV=1 15 297 2.0E-20
sp|Q6GQ22|KMCP1_XENLA Kidney mitochondrial carrier protein 1 OS=Xenopus laevis GN=slc25a30 PE=2 SV=1 9 287 2.0E-20
sp|Q08CI8|S238A_DANRE Solute carrier family 25 member 38-A OS=Danio rerio GN=slc25a38a PE=2 SV=2 9 275 2.0E-20
sp|Q1ECW7|S247A_DANRE Solute carrier family 25 member 47-A OS=Danio rerio GN=slc25a47a PE=2 SV=1 13 299 2.0E-20
sp|O13844|YFG5_SCHPO Uncharacterized mitochondrial carrier C19G12.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19G12.05 PE=3 SV=1 3 295 2.0E-20
sp|P39953|YEA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEA6 PE=1 SV=1 16 287 2.0E-20
sp|Q5HZI9|S2551_MOUSE Solute carrier family 25 member 51 OS=Mus musculus GN=Slc25a51 PE=1 SV=1 13 235 3.0E-20
sp|P04710|ADT1_YEAST ADP,ATP carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AAC1 PE=1 SV=1 4 283 4.0E-20
sp|Q0VCH6|S2540_BOVIN Solute carrier family 25 member 40 OS=Bos taurus GN=SLC25A40 PE=2 SV=1 13 299 5.0E-20
sp|P49382|ADT_KLULA ADP,ATP carrier protein OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=AAC PE=3 SV=1 1 283 7.0E-20
sp|Q9SJY5|PUMP5_ARATH Mitochondrial uncoupling protein 5 OS=Arabidopsis thaliana GN=PUMP5 PE=2 SV=1 14 295 8.0E-20
sp|Q05AQ3|S2542_XENTR Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus tropicalis GN=slc25a42 PE=2 SV=1 16 269 1.0E-19
sp|P10861|UCP1_BOVIN Mitochondrial brown fat uncoupling protein 1 (Fragment) OS=Bos taurus GN=UCP1 PE=2 SV=2 14 298 1.0E-19
sp|O49447|ADT3_ARATH ADP,ATP carrier protein 3, mitochondrial OS=Arabidopsis thaliana GN=AAC3 PE=2 SV=1 10 283 1.0E-19
sp|P38988|GGC1_YEAST Mitochondrial GTP/GDP carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GGC1 PE=1 SV=1 1 278 1.0E-19
sp|A1DI57|TPC1_NEOFI Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tpc1 PE=3 SV=1 16 298 1.0E-19
sp|Q9SB52|PUMP4_ARATH Mitochondrial uncoupling protein 4 OS=Arabidopsis thaliana GN=PUMP4 PE=2 SV=1 11 295 2.0E-19
sp|Q10442|YDE9_SCHPO Uncharacterized mitochondrial carrier C12B10.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12B10.09 PE=3 SV=1 2 292 2.0E-19
sp|A2R5A0|TPC1_ASPNC Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tpc1 PE=3 SV=1 16 297 2.0E-19
sp|P53320|MTM1_YEAST Mitochondrial carrier protein MTM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTM1 PE=1 SV=1 51 294 2.0E-19
sp|Q5PQ27|S2542_XENLA Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus laevis GN=slc25a42 PE=2 SV=1 14 269 3.0E-19
sp|Q9H1U9|S2551_HUMAN Solute carrier family 25 member 51 OS=Homo sapiens GN=SLC25A51 PE=2 SV=1 13 268 3.0E-19
sp|Q76PC3|YQ73_SCHPO Uncharacterized mitochondrial carrier C1442.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1442.03 PE=3 SV=1 5 296 3.0E-19
sp|Q922G0|S2536_MOUSE Solute carrier family 25 member 36 OS=Mus musculus GN=Slc25a36 PE=2 SV=1 1 291 3.0E-19
sp|Q09188|ADT_SCHPO ADP,ATP carrier protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=anc1 PE=2 SV=1 4 285 4.0E-19
sp|Q8BW66|S2548_MOUSE Solute carrier family 25 member 48 OS=Mus musculus GN=Slc25a48 PE=1 SV=2 13 295 4.0E-19
sp|Q54MZ4|MCFB_DICDI Mitochondrial substrate carrier family protein B OS=Dictyostelium discoideum GN=mcfB PE=3 SV=1 16 299 4.0E-19
sp|P40941|ADT2_ARATH ADP,ATP carrier protein 2, mitochondrial OS=Arabidopsis thaliana GN=AAC2 PE=2 SV=2 10 283 4.0E-19
sp|Q4X022|TPC1_ASPFU Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tpc1 PE=3 SV=3 16 298 4.0E-19
sp|A7ER02|TPC1_SCLS1 Mitochondrial thiamine pyrophosphate carrier 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tpc1 PE=3 SV=1 16 296 5.0E-19
sp|Q41630|ADT2_WHEAT ADP,ATP carrier protein 2, mitochondrial OS=Triticum aestivum GN=ANT-G2 PE=3 SV=1 10 283 5.0E-19
sp|Q287T7|MFRN1_DANRE Mitoferrin-1 OS=Danio rerio GN=slc25a37 PE=1 SV=1 13 287 5.0E-19
sp|Q2UCW8|TPC1_ASPOR Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tpc1 PE=3 SV=1 16 297 6.0E-19
sp|B0G159|MCFC_DICDI Mitochondrial substrate carrier family protein C OS=Dictyostelium discoideum GN=mcfC PE=2 SV=1 16 287 6.0E-19
sp|Q9BV35|SCMC3_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Homo sapiens GN=SLC25A23 PE=1 SV=2 2 290 7.0E-19
sp|Q6KCM7|SCMC2_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Homo sapiens GN=SLC25A25 PE=1 SV=1 13 294 7.0E-19
sp|Q54EV4|MCFA_DICDI Mitochondrial substrate carrier family protein A OS=Dictyostelium discoideum GN=mcfA PE=3 SV=1 13 296 7.0E-19
sp|Q8TBP6|S2540_HUMAN Solute carrier family 25 member 40 OS=Homo sapiens GN=SLC25A40 PE=1 SV=1 13 287 7.0E-19
sp|Q12251|YP011_YEAST Uncharacterized mitochondrial carrier YPR011C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR011C PE=1 SV=1 14 296 8.0E-19
sp|Q6GQS1|SCMC3_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Mus musculus GN=Slc25a23 PE=1 SV=1 2 290 8.0E-19
sp|Q0V7M4|SCMC2_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Bos taurus GN=SLC25A25 PE=2 SV=1 13 294 8.0E-19
sp|A2ASZ8|SCMC2_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Mus musculus GN=Slc25a25 PE=1 SV=1 13 294 1.0E-18
sp|P27081|ADT2_SOLTU ADP,ATP carrier protein, mitochondrial (Fragment) OS=Solanum tuberosum GN=ANT1 PE=2 SV=1 4 283 1.0E-18
sp|Q8K3P6|SCMC2_RAT Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Rattus norvegicus GN=Slc25a25 PE=1 SV=1 13 294 1.0E-18
sp|Q93XM7|MCAT_ARATH Mitochondrial carnitine/acylcarnitine carrier-like protein OS=Arabidopsis thaliana GN=BOU PE=2 SV=1 2 185 2.0E-18
sp|Q498U3|S2540_RAT Solute carrier family 25 member 40 OS=Rattus norvegicus GN=Slc25a40 PE=2 SV=2 13 284 2.0E-18
sp|Q6ZT89|S2548_HUMAN Solute carrier family 25 member 48 OS=Homo sapiens GN=SLC25A48 PE=1 SV=2 13 295 2.0E-18
sp|Q9BXI2|ORNT2_HUMAN Mitochondrial ornithine transporter 2 OS=Homo sapiens GN=SLC25A2 PE=1 SV=3 16 287 2.0E-18
sp|Q5ZKP7|S2536_CHICK Solute carrier family 25 member 36 OS=Gallus gallus GN=SLC25A36 PE=2 SV=1 1 291 2.0E-18
sp|P25083|ADT1_SOLTU ADP,ATP carrier protein, mitochondrial OS=Solanum tuberosum GN=ANT PE=2 SV=1 4 283 2.0E-18
sp|P31167|ADT1_ARATH ADP,ATP carrier protein 1, mitochondrial OS=Arabidopsis thaliana GN=AAC1 PE=1 SV=2 10 283 2.0E-18
sp|Q09461|YQ51_CAEEL Uncharacterized mitochondrial carrier C16C10.1 OS=Caenorhabditis elegans GN=C16C10.1 PE=3 SV=2 13 296 3.0E-18
sp|Q96CQ1|S2536_HUMAN Solute carrier family 25 member 36 OS=Homo sapiens GN=SLC25A36 PE=1 SV=1 1 291 3.0E-18
sp|Q0P483|S2542_DANRE Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio GN=slc25a42 PE=2 SV=1 16 269 3.0E-18
sp|Q6FTN2|DIC1_CANGA Mitochondrial dicarboxylate transporter OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DIC1 PE=3 SV=1 1 298 4.0E-18
sp|P40556|YIA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIA6 PE=1 SV=1 16 287 4.0E-18
sp|Q5U3V7|S2543_DANRE Solute carrier family 25 member 43 OS=Danio rerio GN=slc25a43 PE=2 SV=1 16 194 4.0E-18
sp|Q7SXW0|S2539_DANRE Solute carrier family 25 member 39 OS=Danio rerio GN=slc25a39 PE=2 SV=1 48 287 6.0E-18
sp|A6SL61|TPC1_BOTFB Mitochondrial thiamine pyrophosphate carrier 1 OS=Botryotinia fuckeliana (strain B05.10) GN=tpc1 PE=3 SV=1 16 296 6.0E-18
sp|F4HT41|SAMC2_ARATH Probable S-adenosylmethionine carrier 2, chloroplastic OS=Arabidopsis thaliana GN=SAMC2 PE=2 SV=1 8 204 7.0E-18
sp|A3KPP4|S2535_DANRE Solute carrier family 25 member 35 OS=Danio rerio GN=slc25a35 PE=2 SV=1 14 278 7.0E-18
sp|Q7S2H8|TPC1_NEUCR Mitochondrial thiamine pyrophosphate carrier 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tpc-1 PE=3 SV=1 15 297 7.0E-18
sp|O04619|ADNT1_ARATH Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana GN=ADNT1 PE=2 SV=1 14 294 8.0E-18
sp|Q12375|ORT1_YEAST Mitochondrial ornithine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ORT1 PE=1 SV=2 17 290 9.0E-18
sp|P10566|MRS3_YEAST Mitochondrial RNA-splicing protein MRS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS3 PE=1 SV=4 9 234 9.0E-18
sp|O81845|PUMP1_ARATH Mitochondrial uncoupling protein 1 OS=Arabidopsis thaliana GN=PUMP1 PE=1 SV=1 8 202 1.0E-17
sp|Q55E45|MCFE_DICDI Mitochondrial substrate carrier family protein E OS=Dictyostelium discoideum GN=mcfE PE=3 SV=1 112 299 1.0E-17
sp|Q6DHS9|S2548_DANRE Solute carrier family 25 member 48 OS=Danio rerio GN=slc25a48 PE=2 SV=1 13 297 1.0E-17
sp|A2CEQ0|SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio GN=slc25a25b PE=3 SV=2 13 294 1.0E-17
sp|O60029|PET8_ASHGO Putative mitochondrial carrier protein PET8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PET8 PE=3 SV=1 10 294 1.0E-17
sp|Q6DG32|S2536_DANRE Solute carrier family 25 member 36-A OS=Danio rerio GN=slc25a36a PE=2 SV=1 1 291 1.0E-17
sp|P0C582|M2OM_NEUCR Putative mitochondrial 2-oxoglutarate/malate carrier protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mic-33 PE=3 SV=1 8 286 2.0E-17
sp|Q96DW6|S2538_HUMAN Solute carrier family 25 member 38 OS=Homo sapiens GN=SLC25A38 PE=1 SV=1 9 275 2.0E-17
sp|P38921|PET8_YEAST Putative mitochondrial carrier protein PET8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET8 PE=1 SV=1 10 296 2.0E-17
sp|Q9QZD8|DIC_MOUSE Mitochondrial dicarboxylate carrier OS=Mus musculus GN=Slc25a10 PE=1 SV=2 17 278 2.0E-17
sp|Q8LB08|ADT4_ARATH ADP,ATP carrier protein ER-ANT1 OS=Arabidopsis thaliana GN=ER-ANT1 PE=2 SV=2 6 283 2.0E-17
sp|Q8BGP6|S2540_MOUSE Solute carrier family 25 member 40 OS=Mus musculus GN=Slc25a40 PE=1 SV=1 7 296 2.0E-17
sp|Q9NYZ2|MFRN1_HUMAN Mitoferrin-1 OS=Homo sapiens GN=SLC25A37 PE=2 SV=2 13 287 3.0E-17
sp|B2MVX9|S2538_SHEEP Solute carrier family 25 member 38 OS=Ovis aries GN=SLC25A38 PE=2 SV=1 9 275 3.0E-17
sp|Q9D8K8|S2539_MOUSE Solute carrier family 25 member 39 OS=Mus musculus GN=Slc25a39 PE=2 SV=1 51 297 3.0E-17
sp|Q06143|DIC1_YEAST Mitochondrial dicarboxylate transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIC1 PE=1 SV=1 12 278 3.0E-17
sp|Q9VQG4|COLT_DROME Congested-like trachea protein OS=Drosophila melanogaster GN=colt PE=2 SV=1 4 185 4.0E-17
sp|Q27257|DIF1_CAEEL Protein dif-1 OS=Caenorhabditis elegans GN=dif-1 PE=2 SV=1 3 185 4.0E-17
sp|Q54VS7|TPC_DICDI Probable mitochondrial thiamine pyrophosphate carrier OS=Dictyostelium discoideum GN=mcfK PE=3 SV=1 2 287 4.0E-17
sp|Q6P036|S2533_DANRE Solute carrier family 25 member 33 OS=Danio rerio GN=slc25a33 PE=2 SV=1 1 292 4.0E-17
sp|Q6NYZ6|SCM2A_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-A OS=Danio rerio GN=slc25a25a PE=2 SV=1 13 294 4.0E-17
sp|P29518|BT1_MAIZE Adenine nucleotide transporter BT1, chloroplastic/amyloplastic/mitochondrial OS=Zea mays GN=BT1 PE=1 SV=1 3 287 4.0E-17
sp|Q54DU1|MCFP_DICDI Mitochondrial substrate carrier family protein P OS=Dictyostelium discoideum GN=mcfP PE=3 SV=1 13 297 4.0E-17
sp|Q0CEN9|TPC1_ASPTN Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tpc1 PE=3 SV=1 16 297 5.0E-17
sp|Q9C5M0|DTC_ARATH Mitochondrial dicarboxylate/tricarboxylate transporter DTC OS=Arabidopsis thaliana GN=DTC PE=1 SV=1 4 278 5.0E-17
sp|Q7ZYD5|SCMC2_XENLA Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus laevis GN=slc25a25 PE=2 SV=1 13 294 5.0E-17
sp|Q5XH95|SCMC2_XENTR Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus tropicalis GN=slc25a25 PE=2 SV=1 13 294 5.0E-17
sp|Q91XD8|S2538_MOUSE Solute carrier family 25 member 38 OS=Mus musculus GN=Slc25a38 PE=2 SV=1 9 275 5.0E-17
sp|P23641|MPCP_YEAST Mitochondrial phosphate carrier protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIR1 PE=1 SV=1 16 242 6.0E-17
sp|Q9P7X9|YH66_SCHPO Uncharacterized mitochondrial carrier P23A10.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP23A10.06 PE=3 SV=1 11 296 6.0E-17
sp|Q9CA93|BAC2_ARATH Mitochondrial arginine transporter BAC2 OS=Arabidopsis thaliana GN=BAC2 PE=1 SV=1 29 275 7.0E-17
sp|Q96A46|MFRN2_HUMAN Mitoferrin-2 OS=Homo sapiens GN=SLC25A28 PE=2 SV=1 13 287 7.0E-17
sp|Q05AQ3|S2542_XENTR Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus tropicalis GN=slc25a42 PE=2 SV=1 113 290 9.0E-17
sp|Q9H2D1|MFTC_HUMAN Mitochondrial folate transporter/carrier OS=Homo sapiens GN=SLC25A32 PE=1 SV=2 16 299 9.0E-17
sp|Q6BPW0|TPC1_DEBHA Mitochondrial thiamine pyrophosphate carrier 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TPC1 PE=3 SV=3 16 299 9.0E-17
sp|P79110|TXTP_BOVIN Tricarboxylate transport protein, mitochondrial OS=Bos taurus GN=SLC25A1 PE=2 SV=1 113 295 1.0E-16
sp|Q4V9P0|SAMC_DANRE S-adenosylmethionine mitochondrial carrier protein OS=Danio rerio GN=slc25a26 PE=2 SV=1 10 294 1.0E-16
sp|A5DIS9|TPC1_PICGU Mitochondrial thiamine pyrophosphate carrier 1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TPC1 PE=3 SV=3 12 292 1.0E-16
sp|Q55BF4|UCPA_DICDI Mitochondrial substrate carrier family protein ucpA OS=Dictyostelium discoideum GN=ucpA PE=3 SV=1 14 299 1.0E-16
sp|Q9UBX3|DIC_HUMAN Mitochondrial dicarboxylate carrier OS=Homo sapiens GN=SLC25A10 PE=1 SV=2 17 294 2.0E-16
sp|Q95J75|MFTC_MACFA Mitochondrial folate transporter/carrier OS=Macaca fascicularis GN=SLC25A32 PE=2 SV=1 13 299 2.0E-16
sp|Q59Q36|TPC1_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TPC1 PE=3 SV=1 14 298 2.0E-16
sp|A3LVX1|TPC1_PICST Mitochondrial thiamine pyrophosphate carrier 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TPC1 PE=3 SV=2 16 287 2.0E-16
sp|Q5EAC0|S2538_BOVIN Solute carrier family 25 member 38 OS=Bos taurus GN=SLC25A38 PE=2 SV=2 9 275 2.0E-16
sp|P32332|OAC1_YEAST Mitochondrial oxaloacetate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OAC1 PE=1 SV=1 14 278 3.0E-16
sp|Q76P23|PM34_DICDI Mitochondrial substrate carrier family protein Q OS=Dictyostelium discoideum GN=mcfQ PE=2 SV=1 3 185 3.0E-16
sp|Q17QI7|S2539_BOVIN Solute carrier family 25 member 39 OS=Bos taurus GN=SLC25A39 PE=2 SV=2 51 297 5.0E-16
sp|Q20799|CMC2_CAEEL Putative calcium-binding mitochondrial carrier F55A11.4 OS=Caenorhabditis elegans GN=F55A11.4 PE=5 SV=1 13 290 8.0E-16
sp|Q628Z2|CMC3_CAEBR Probable calcium-binding mitochondrial carrier CBG00135 OS=Caenorhabditis briggsae GN=CBG00135 PE=3 SV=1 13 290 9.0E-16
sp|Q9H0C2|ADT4_HUMAN ADP/ATP translocase 4 OS=Homo sapiens GN=SLC25A31 PE=2 SV=1 10 176 1.0E-15
sp|Q4R8M0|ADT4_MACFA ADP/ATP translocase 4 OS=Macaca fascicularis GN=SLC25A31 PE=2 SV=1 10 176 1.0E-15
sp|Q8RWA5|NDT2_ARATH Nicotinamide adenine dinucleotide transporter 2, mitochondrial OS=Arabidopsis thaliana GN=NDT2 PE=1 SV=1 30 297 1.0E-15
sp|Q3MHI3|S2548_BOVIN Solute carrier family 25 member 48 OS=Bos taurus GN=SLC25A48 PE=2 SV=1 13 295 1.0E-15
sp|Q66H23|MFRN1_RAT Mitoferrin-1 OS=Rattus norvegicus GN=Slc25a37 PE=2 SV=1 13 287 1.0E-15
sp|P38127|RIM2_YEAST Mitochondrial carrier protein RIM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM2 PE=3 SV=1 26 291 1.0E-15
sp|Q54BF6|MCFN_DICDI Mitochondrial substrate carrier family protein N OS=Dictyostelium discoideum GN=mcfN PE=1 SV=2 12 277 1.0E-15
sp|Q8WUT9|S2543_HUMAN Solute carrier family 25 member 43 OS=Homo sapiens GN=SLC25A43 PE=2 SV=2 16 189 1.0E-15
sp|P40614|MPCP_CAEEL Phosphate carrier protein, mitochondrial OS=Caenorhabditis elegans GN=F01G4.6 PE=2 SV=1 14 277 1.0E-15
sp|Q3SY17|S2552_HUMAN Solute carrier family 25 member 52 OS=Homo sapiens GN=SLC25A52 PE=2 SV=2 13 268 1.0E-15
sp|A5DX39|TPC1_LODEL Mitochondrial thiamine pyrophosphate carrier 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=TPC1 PE=3 SV=1 16 298 1.0E-15
sp|Q8CFJ7|S2545_MOUSE Solute carrier family 25 member 45 OS=Mus musculus GN=Slc25a45 PE=1 SV=1 2 185 2.0E-15
sp|Q5U3V7|S2543_DANRE Solute carrier family 25 member 43 OS=Danio rerio GN=slc25a43 PE=2 SV=1 19 287 2.0E-15
sp|Q8R0Z5|MFRN2_MOUSE Mitoferrin-2 OS=Mus musculus GN=Slc25a28 PE=2 SV=1 13 287 2.0E-15
sp|Q19529|CMC3_CAEEL Probable calcium-binding mitochondrial carrier F17E5.2 OS=Caenorhabditis elegans GN=F17E5.2 PE=3 SV=4 13 290 2.0E-15
sp|Q4V8K4|S2539_RAT Solute carrier family 25 member 39 OS=Rattus norvegicus GN=Slc25a39 PE=2 SV=1 51 297 2.0E-15
sp|Q9BZJ4|S2539_HUMAN Solute carrier family 25 member 39 OS=Homo sapiens GN=SLC25A39 PE=2 SV=2 51 297 2.0E-15
sp|Q920G8|MFRN1_MOUSE Mitoferrin-1 OS=Mus musculus GN=Slc25a37 PE=1 SV=1 13 287 2.0E-15
sp|P53007|TXTP_HUMAN Tricarboxylate transport protein, mitochondrial OS=Homo sapiens GN=SLC25A1 PE=1 SV=2 113 295 3.0E-15
sp|Q9VAY3|MFRN_DROME Mitoferrin OS=Drosophila melanogaster GN=mfrn PE=2 SV=1 16 231 3.0E-15
sp|Q2YDD9|ADT4_BOVIN ADP/ATP translocase 4 OS=Bos taurus GN=SLC25A31 PE=2 SV=1 10 176 4.0E-15
sp|O94370|YG04_SCHPO Uncharacterized mitochondrial carrier C1604.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1604.04 PE=3 SV=2 3 299 4.0E-15
sp|Q7DNC3|MPCP1_ARATH Mitochondrial phosphate carrier protein 1, mitochondrial OS=Arabidopsis thaliana GN=MPT1 PE=2 SV=1 3 235 4.0E-15
sp|A2A3V2|S2543_MOUSE Solute carrier family 25 member 43 OS=Mus musculus GN=Slc25a43 PE=2 SV=1 17 191 5.0E-15
sp|Q7T292|MFRN2_DANRE Mitoferrin-2 OS=Danio rerio GN=slc25a28 PE=2 SV=1 16 287 5.0E-15
sp|Q7XA87|FOLT1_ARATH Folate transporter 1, chloroplastic OS=Arabidopsis thaliana GN=FOLT1 PE=2 SV=1 3 178 6.0E-15
sp|Q5PQ27|S2542_XENLA Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus laevis GN=slc25a42 PE=2 SV=1 113 290 6.0E-15
sp|P53257|TPC1_YEAST Mitochondrial thiamine pyrophosphate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPC1 PE=1 SV=1 16 278 6.0E-15
sp|Q8BMG8|MFTC_MOUSE Mitochondrial folate transporter/carrier OS=Mus musculus GN=Slc25a32 PE=1 SV=1 13 299 6.0E-15
sp|A6ZV78|TPC1_YEAS7 Mitochondrial thiamine pyrophosphate carrier 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=TPC1 PE=3 SV=1 16 278 6.0E-15
sp|A6RF73|TPC1_AJECN Mitochondrial thiamine pyrophosphate carrier 1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=TPC1 PE=3 SV=1 15 297 7.0E-15
sp|Q8N413|S2545_HUMAN Solute carrier family 25 member 45 OS=Homo sapiens GN=SLC25A45 PE=2 SV=2 2 185 8.0E-15
sp|P32332|OAC1_YEAST Mitochondrial oxaloacetate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OAC1 PE=1 SV=1 113 296 8.0E-15
sp|Q54QN2|MCFM_DICDI Mitochondrial substrate carrier family protein M OS=Dictyostelium discoideum GN=mcfM PE=3 SV=1 13 170 9.0E-15
sp|Q9QXX4|CMC2_MOUSE Calcium-binding mitochondrial carrier protein Aralar2 OS=Mus musculus GN=Slc25a13 PE=1 SV=1 3 176 1.0E-14
sp|Q6C6I3|S2538_YARLI Solute carrier family 25 member 38 homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E09284g PE=3 SV=1 16 297 1.0E-14
sp|P23500|MRS4_YEAST Mitochondrial RNA-splicing protein MRS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS4 PE=1 SV=1 9 234 1.0E-14
sp|Q0II44|S2541_BOVIN Solute carrier family 25 member 41 OS=Bos taurus GN=SLC25A41 PE=2 SV=1 16 259 1.0E-14
sp|Q9FY68|PUMP6_ARATH Mitochondrial uncoupling protein 6 OS=Arabidopsis thaliana GN=PUMP6 PE=2 SV=1 60 298 1.0E-14
sp|A6QR09|SAMC_BOVIN S-adenosylmethionine mitochondrial carrier protein OS=Bos taurus GN=SLC25A26 PE=2 SV=1 10 287 1.0E-14
sp|Q54QI8|MCFR_DICDI Mitochondrial substrate carrier family protein R OS=Dictyostelium discoideum GN=mcfR PE=3 SV=1 16 295 1.0E-14
sp|Q499U1|S2538_RAT Solute carrier family 25 member 38 OS=Rattus norvegicus GN=Slc25a38 PE=2 SV=2 9 275 1.0E-14
sp|Q9FM86|ADT5_ARATH Probable ADP,ATP carrier protein At5g56450 OS=Arabidopsis thaliana GN=At5g56450 PE=2 SV=1 10 290 1.0E-14
sp|Q8JZU2|TXTP_MOUSE Tricarboxylate transport protein, mitochondrial OS=Mus musculus GN=Slc25a1 PE=1 SV=1 113 295 2.0E-14
sp|P32089|TXTP_RAT Tricarboxylate transport protein, mitochondrial OS=Rattus norvegicus GN=Slc25a1 PE=1 SV=1 113 295 2.0E-14
sp|Q9CA93|BAC2_ARATH Mitochondrial arginine transporter BAC2 OS=Arabidopsis thaliana GN=BAC2 PE=1 SV=1 17 189 2.0E-14
sp|Q86I81|MCFI_DICDI Mitochondrial substrate carrier family protein I OS=Dictyostelium discoideum GN=mcfI PE=2 SV=1 13 294 2.0E-14
sp|O65023|EAAC_ARATH Probable envelope ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana GN=EAAC PE=2 SV=2 27 290 2.0E-14
sp|O94502|YBT5_SCHPO Uncharacterized mitochondrial carrier C12D12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12D12.05c PE=3 SV=2 2 176 2.0E-14
sp|Q5U680|SAMC_MOUSE S-adenosylmethionine mitochondrial carrier protein OS=Mus musculus GN=Slc25a26 PE=1 SV=2 10 284 2.0E-14
sp|Q8N413|S2545_HUMAN Solute carrier family 25 member 45 OS=Homo sapiens GN=SLC25A45 PE=2 SV=2 115 287 3.0E-14
sp|Q6PIV7|S2534_HUMAN Solute carrier family 25 member 34 OS=Homo sapiens GN=SLC25A34 PE=2 SV=1 17 297 5.0E-14
sp|A6RAY2|S2538_AJECN Solute carrier family 25 member 38 homolog OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_06120 PE=3 SV=1 1 269 5.0E-14
sp|Q9BXI2|ORNT2_HUMAN Mitochondrial ornithine transporter 2 OS=Homo sapiens GN=SLC25A2 PE=1 SV=3 30 195 6.0E-14
sp|Q86VD7|S2542_HUMAN Mitochondrial coenzyme A transporter SLC25A42 OS=Homo sapiens GN=SLC25A42 PE=2 SV=2 16 299 6.0E-14
sp|B0G159|MCFC_DICDI Mitochondrial substrate carrier family protein C OS=Dictyostelium discoideum GN=mcfC PE=2 SV=1 13 178 7.0E-14
sp|Q0P483|S2542_DANRE Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio GN=slc25a42 PE=2 SV=1 113 293 7.0E-14
sp|O74439|YJE9_SCHPO Uncharacterized mitochondrial carrier C1682.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1682.09c PE=3 SV=1 18 297 9.0E-14
sp|Q12375|ORT1_YEAST Mitochondrial ornithine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ORT1 PE=1 SV=2 112 299 1.0E-13
sp|Q1LZB3|S2533_BOVIN Solute carrier family 25 member 33 OS=Bos taurus GN=SLC25A33 PE=2 SV=1 4 291 1.0E-13
sp|Q9UJS0|CMC2_HUMAN Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens GN=SLC25A13 PE=1 SV=2 3 176 2.0E-13
sp|Q8BL03|MCATL_MOUSE Mitochondrial basic amino acids transporter OS=Mus musculus GN=Slc25a29 PE=1 SV=1 111 287 2.0E-13
sp|Q9W725|UCP2_CYPCA Mitochondrial uncoupling protein 2 OS=Cyprinus carpio GN=ucp2 PE=2 SV=1 16 198 2.0E-13
sp|Q0P483|S2542_DANRE Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio GN=slc25a42 PE=2 SV=1 4 171 2.0E-13
sp|Q9FHX2|MFL1_ARATH Protein MITOFERRINLIKE 1, chloroplastic OS=Arabidopsis thaliana GN=MFL1 PE=2 SV=1 26 289 2.0E-13
sp|Q70HW3|SAMC_HUMAN S-adenosylmethionine mitochondrial carrier protein OS=Homo sapiens GN=SLC25A26 PE=2 SV=1 10 284 3.0E-13
sp|Q3TZX3|S2533_MOUSE Solute carrier family 25 member 33 OS=Mus musculus GN=Slc25a33 PE=2 SV=1 4 287 3.0E-13
sp|Q5RD67|S2544_PONAB Solute carrier family 25 member 44 OS=Pongo abelii GN=SLC25A44 PE=2 SV=2 28 290 3.0E-13
sp|Q8BGF9|S2544_MOUSE Solute carrier family 25 member 44 OS=Mus musculus GN=Slc25a44 PE=1 SV=1 28 290 4.0E-13
sp|Q54FE6|MCFS_DICDI Mitochondrial substrate carrier family protein S OS=Dictyostelium discoideum GN=mcfS PE=3 SV=1 115 295 5.0E-13
sp|Q6PH61|S2534_DANRE Solute carrier family 25 member 34 OS=Danio rerio GN=slc25a34 PE=2 SV=1 14 278 5.0E-13
sp|Q01888|GDC_BOVIN Graves disease carrier protein OS=Bos taurus GN=SLC25A16 PE=2 SV=1 13 295 5.0E-13
sp|Q54FU9|MCFW_DICDI Mitochondrial substrate carrier family protein W OS=Dictyostelium discoideum GN=mcfW PE=3 SV=1 13 289 5.0E-13
sp|Q8HXW2|CMC2_MACFA Calcium-binding mitochondrial carrier protein Aralar2 OS=Macaca fascicularis GN=SLC25A13 PE=2 SV=1 3 169 6.0E-13
sp|Q5HZE0|MCATL_RAT Mitochondrial basic amino acids transporter OS=Rattus norvegicus GN=Slc25a29 PE=2 SV=1 111 287 6.0E-13
sp|Q9ER18|UCP1_PHOSU Mitochondrial brown fat uncoupling protein 1 OS=Phodopus sungorus GN=UCP1 PE=2 SV=1 107 275 6.0E-13
sp|Q9M024|TAAC_ARATH Thylakoid ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana GN=TAAC PE=1 SV=1 27 290 6.0E-13
sp|Q8R0Y8|S2542_MOUSE Mitochondrial coenzyme A transporter SLC25A42 OS=Mus musculus GN=Slc25a42 PE=1 SV=1 16 299 6.0E-13
sp|Q1DRJ3|S2538_COCIM Solute carrier family 25 member 38 homolog OS=Coccidioides immitis (strain RS) GN=CIMG_07070 PE=3 SV=1 12 269 7.0E-13
sp|Q54DU1|MCFP_DICDI Mitochondrial substrate carrier family protein P OS=Dictyostelium discoideum GN=mcfP PE=3 SV=1 112 287 8.0E-13
sp|Q9BSK2|S2533_HUMAN Solute carrier family 25 member 33 OS=Homo sapiens GN=SLC25A33 PE=1 SV=1 4 291 8.0E-13
sp|Q5PQ27|S2542_XENLA Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus laevis GN=slc25a42 PE=2 SV=1 7 171 9.0E-13
sp|P0C546|S2542_RAT Mitochondrial coenzyme A transporter SLC25A42 OS=Rattus norvegicus GN=Slc25a42 PE=2 SV=1 16 299 9.0E-13
sp|Q08DK7|MCATL_BOVIN Mitochondrial basic amino acids transporter OS=Bos taurus GN=SLC25A29 PE=2 SV=1 111 287 1.0E-12
sp|Q05AQ3|S2542_XENTR Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus tropicalis GN=slc25a42 PE=2 SV=1 7 171 1.0E-12
sp|O04619|ADNT1_ARATH Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana GN=ADNT1 PE=2 SV=1 3 170 1.0E-12
sp|Q6C107|TPC1_YARLI Mitochondrial thiamine pyrophosphate carrier 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TPC1 PE=3 SV=1 16 295 1.0E-12
sp|Q96H78|S2544_HUMAN Solute carrier family 25 member 44 OS=Homo sapiens GN=SLC25A44 PE=2 SV=1 28 290 1.0E-12
sp|Q8C0K5|GDC_MOUSE Graves disease carrier protein homolog OS=Mus musculus GN=Slc25a16 PE=1 SV=1 13 295 1.0E-12
sp|Q9LJX5|BRTL1_ARATH Probable mitochondrial adenine nucleotide transporter BTL1 OS=Arabidopsis thaliana GN=At3g20240 PE=2 SV=1 13 294 1.0E-12
sp|Q00325|MPCP_HUMAN Phosphate carrier protein, mitochondrial OS=Homo sapiens GN=SLC25A3 PE=1 SV=2 10 295 2.0E-12
sp|P16260|GDC_HUMAN Graves disease carrier protein OS=Homo sapiens GN=SLC25A16 PE=1 SV=3 13 295 2.0E-12
sp|Q9FMU6|MPCP3_ARATH Mitochondrial phosphate carrier protein 3, mitochondrial OS=Arabidopsis thaliana GN=MPT3 PE=2 SV=1 26 235 2.0E-12
sp|Q5AVW1|TPC1_EMENI Mitochondrial thiamine pyrophosphate carrier 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tpc1 PE=3 SV=1 16 296 2.0E-12
sp|O59674|YB8B_SCHPO Uncharacterized mitochondrial carrier C29A3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A3.11c PE=3 SV=1 14 265 2.0E-12
sp|Q5R7W2|MPCP_PONAB Phosphate carrier protein, mitochondrial OS=Pongo abelii GN=SLC25A3 PE=2 SV=1 30 295 2.0E-12
sp|Q9H0C2|ADT4_HUMAN ADP/ATP translocase 4 OS=Homo sapiens GN=SLC25A31 PE=2 SV=1 97 269 3.0E-12
sp|Q4R8M0|ADT4_MACFA ADP/ATP translocase 4 OS=Macaca fascicularis GN=SLC25A31 PE=2 SV=1 97 269 3.0E-12
sp|P34519|TXTP_CAEEL Putative tricarboxylate transport protein, mitochondrial OS=Caenorhabditis elegans GN=K11H3.3 PE=3 SV=1 11 179 3.0E-12
sp|P55916|UCP3_HUMAN Mitochondrial uncoupling protein 3 OS=Homo sapiens GN=UCP3 PE=1 SV=1 111 275 3.0E-12
sp|Q9W720|UCP2_DANRE Mitochondrial uncoupling protein 2 OS=Danio rerio GN=ucp2 PE=2 SV=1 16 198 3.0E-12
sp|P12234|MPCP_BOVIN Phosphate carrier protein, mitochondrial OS=Bos taurus GN=SLC25A3 PE=1 SV=1 10 295 3.0E-12
sp|Q8VEM8|MPCP_MOUSE Phosphate carrier protein, mitochondrial OS=Mus musculus GN=Slc25a3 PE=1 SV=1 30 295 3.0E-12
sp|Q5SWT3|S2535_MOUSE Solute carrier family 25 member 35 OS=Mus musculus GN=Slc25a35 PE=1 SV=2 14 278 3.0E-12
sp|Q6GLA2|SAMC_XENTR S-adenosylmethionine mitochondrial carrier protein OS=Xenopus tropicalis GN=slc25a26 PE=2 SV=1 10 290 3.0E-12
sp|P25874|UCP1_HUMAN Mitochondrial brown fat uncoupling protein 1 OS=Homo sapiens GN=UCP1 PE=2 SV=3 112 275 4.0E-12
sp|A2A3V2|S2543_MOUSE Solute carrier family 25 member 43 OS=Mus musculus GN=Slc25a43 PE=2 SV=1 16 287 5.0E-12
sp|Q8TFH2|YIKC_SCHPO Uncharacterized mitochondrial carrier PB17E12.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.12c PE=3 SV=1 16 290 6.0E-12
sp|Q8BH59|CMC1_MOUSE Calcium-binding mitochondrial carrier protein Aralar1 OS=Mus musculus GN=Slc25a12 PE=1 SV=1 1 176 7.0E-12
sp|Q505J6|GHC2_RAT Mitochondrial glutamate carrier 2 OS=Rattus norvegicus GN=Slc25a18 PE=2 SV=2 102 275 8.0E-12
sp|Q86VD7|S2542_HUMAN Mitochondrial coenzyme A transporter SLC25A42 OS=Homo sapiens GN=SLC25A42 PE=2 SV=2 113 296 8.0E-12
sp|Q5XIF9|S2534_RAT Solute carrier family 25 member 34 OS=Rattus norvegicus GN=Slc25a34 PE=2 SV=2 17 297 8.0E-12
sp|Q9N2J1|UCP2_CANLF Mitochondrial uncoupling protein 2 OS=Canis lupus familiaris GN=UCP2 PE=2 SV=1 16 202 9.0E-12
sp|O04619|ADNT1_ARATH Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana GN=ADNT1 PE=2 SV=1 113 292 9.0E-12
sp|Q9ER18|UCP1_PHOSU Mitochondrial brown fat uncoupling protein 1 OS=Phodopus sungorus GN=UCP1 PE=2 SV=1 2 193 1.0E-11
sp|P12242|UCP1_MOUSE Mitochondrial brown fat uncoupling protein 1 OS=Mus musculus GN=Ucp1 PE=1 SV=2 107 275 1.0E-11
sp|Q9N2I9|UCP3_CANLF Mitochondrial uncoupling protein 3 OS=Canis lupus familiaris GN=UCP3 PE=2 SV=1 16 195 1.0E-11
sp|Q5IS35|TPC_MACFA Mitochondrial thiamine pyrophosphate carrier OS=Macaca fascicularis GN=SLC25A19 PE=2 SV=1 10 179 1.0E-11
sp|Q9H2D1|MFTC_HUMAN Mitochondrial folate transporter/carrier OS=Homo sapiens GN=SLC25A32 PE=1 SV=2 90 271 1.0E-11
sp|Q3SZK0|S2534_BOVIN Solute carrier family 25 member 34 OS=Bos taurus GN=SLC25A34 PE=2 SV=1 17 297 1.0E-11
sp|Q8N8R3|MCATL_HUMAN Mitochondrial basic amino acids transporter OS=Homo sapiens GN=SLC25A29 PE=1 SV=2 111 290 2.0E-11
sp|Q2YDD9|ADT4_BOVIN ADP/ATP translocase 4 OS=Bos taurus GN=SLC25A31 PE=2 SV=1 81 269 2.0E-11
sp|Q9D6M3|GHC1_MOUSE Mitochondrial glutamate carrier 1 OS=Mus musculus GN=Slc25a22 PE=1 SV=1 107 278 2.0E-11
sp|Q21153|CMC1_CAEEL Probable calcium-binding mitochondrial carrier K02F3.2 OS=Caenorhabditis elegans GN=K02F3.2 PE=3 SV=3 4 176 2.0E-11
sp|Q9CR58|KMCP1_MOUSE Kidney mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a30 PE=1 SV=1 16 194 2.0E-11
sp|P04575|UCP1_MESAU Mitochondrial brown fat uncoupling protein 1 OS=Mesocricetus auratus GN=UCP1 PE=1 SV=3 112 275 2.0E-11
sp|Q8N5S1|S2541_HUMAN Solute carrier family 25 member 41 OS=Homo sapiens GN=SLC25A41 PE=2 SV=2 9 176 2.0E-11
sp|O18757|SCMC1_RABIT Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Oryctolagus cuniculus GN=SLC25A24 PE=1 SV=1 1 170 2.0E-11
sp|Q9GMZ1|UCP1_CANLF Mitochondrial brown fat uncoupling protein 1 OS=Canis lupus familiaris GN=UCP1 PE=2 SV=1 125 275 2.0E-11
sp|P40556|YIA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIA6 PE=1 SV=1 10 178 2.0E-11
sp|Q6NYZ6|SCM2A_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-A OS=Danio rerio GN=slc25a25a PE=2 SV=1 1 170 2.0E-11
sp|Q95J75|MFTC_MACFA Mitochondrial folate transporter/carrier OS=Macaca fascicularis GN=SLC25A32 PE=2 SV=1 90 271 2.0E-11
sp|O94502|YBT5_SCHPO Uncharacterized mitochondrial carrier C12D12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12D12.05c PE=3 SV=2 4 97 2.0E-11
sp|Q9DB41|GHC2_MOUSE Mitochondrial glutamate carrier 2 OS=Mus musculus GN=Slc25a18 PE=1 SV=4 102 275 3.0E-11
sp|A5PJZ1|SCMC1_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Bos taurus GN=SLC25A24 PE=2 SV=1 1 170 3.0E-11
sp|P04575|UCP1_MESAU Mitochondrial brown fat uncoupling protein 1 OS=Mesocricetus auratus GN=UCP1 PE=1 SV=3 2 207 3.0E-11
sp|P39953|YEA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEA6 PE=1 SV=1 9 178 3.0E-11
sp|Q12482|AGC1_YEAST Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGC1 PE=3 SV=1 1 201 4.0E-11
sp|O97562|UCP2_PIG Mitochondrial uncoupling protein 2 OS=Sus scrofa GN=UCP2 PE=2 SV=1 16 202 4.0E-11
sp|P55916|UCP3_HUMAN Mitochondrial uncoupling protein 3 OS=Homo sapiens GN=UCP3 PE=1 SV=1 16 195 4.0E-11
sp|Q6GQ22|KMCP1_XENLA Kidney mitochondrial carrier protein 1 OS=Xenopus laevis GN=slc25a30 PE=2 SV=1 16 194 4.0E-11
sp|A3LVX1|TPC1_PICST Mitochondrial thiamine pyrophosphate carrier 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TPC1 PE=3 SV=2 106 294 4.0E-11
sp|Q9FY68|PUMP6_ARATH Mitochondrial uncoupling protein 6 OS=Arabidopsis thaliana GN=PUMP6 PE=2 SV=1 8 195 4.0E-11
sp|Q9VBN7|SAMC_DROME S-adenosylmethionine mitochondrial carrier protein homolog OS=Drosophila melanogaster GN=CG4743 PE=2 SV=2 8 284 4.0E-11
sp|Q08DK4|GHC1_BOVIN Mitochondrial glutamate carrier 1 OS=Bos taurus GN=SLC25A22 PE=2 SV=1 107 295 5.0E-11
sp|P56500|UCP2_RAT Mitochondrial uncoupling protein 2 OS=Rattus norvegicus GN=Ucp2 PE=2 SV=1 16 202 5.0E-11
sp|O75746|CMC1_HUMAN Calcium-binding mitochondrial carrier protein Aralar1 OS=Homo sapiens GN=SLC25A12 PE=1 SV=2 1 176 6.0E-11
sp|Q5RBC8|CMC1_PONAB Calcium-binding mitochondrial carrier protein Aralar1 OS=Pongo abelii GN=SLC25A12 PE=2 SV=1 1 176 6.0E-11
sp|Q54BM3|MCFG_DICDI Mitochondrial substrate carrier family protein G OS=Dictyostelium discoideum GN=mcfG PE=2 SV=1 30 195 6.0E-11
sp|Q8BMD8|SCMC1_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Mus musculus GN=Slc25a24 PE=1 SV=1 1 170 6.0E-11
sp|Q9XI74|PUMP3_ARATH Mitochondrial uncoupling protein 3 OS=Arabidopsis thaliana GN=PUMP3 PE=2 SV=1 2 180 6.0E-11
sp|Q5SVS4|KMCP1_HUMAN Kidney mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A30 PE=1 SV=1 4 194 6.0E-11
sp|Q5NVC1|TPC_PONAB Mitochondrial thiamine pyrophosphate carrier OS=Pongo abelii GN=SLC25A19 PE=2 SV=1 10 179 6.0E-11
sp|P40035|PIC2_YEAST Mitochondrial phosphate carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIC2 PE=1 SV=1 30 235 6.0E-11
sp|O13660|YBC9_SCHPO Uncharacterized mitochondrial carrier C27B12.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi069 PE=3 SV=1 13 299 6.0E-11
sp|Q0UUH1|TPC1_PHANO Mitochondrial thiamine pyrophosphate carrier 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=TPC1 PE=3 SV=3 16 291 6.0E-11
sp|Q3SZI5|UCP2_BOVIN Mitochondrial uncoupling protein 2 OS=Bos taurus GN=UCP2 PE=2 SV=1 16 202 7.0E-11
sp|Q0II44|S2541_BOVIN Solute carrier family 25 member 41 OS=Bos taurus GN=SLC25A41 PE=2 SV=1 4 151 7.0E-11
sp|P16036|MPCP_RAT Phosphate carrier protein, mitochondrial OS=Rattus norvegicus GN=Slc25a3 PE=1 SV=1 30 295 7.0E-11
sp|Q9UTN1|OAC1_SCHPO Mitochondrial oxaloacetate transport protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oac1 PE=3 SV=1 4 278 7.0E-11
sp|P55851|UCP2_HUMAN Mitochondrial uncoupling protein 2 OS=Homo sapiens GN=UCP2 PE=1 SV=1 16 202 8.0E-11
sp|Q5R5A8|UCP2_PONAB Mitochondrial uncoupling protein 2 OS=Pongo abelii GN=UCP2 PE=2 SV=1 16 202 8.0E-11
sp|P04633|UCP1_RAT Mitochondrial brown fat uncoupling protein 1 OS=Rattus norvegicus GN=Ucp1 PE=1 SV=2 107 275 8.0E-11
sp|A2ADF7|S2534_MOUSE Solute carrier family 25 member 34 OS=Mus musculus GN=Slc25a34 PE=1 SV=1 17 297 9.0E-11
sp|O43808|PM34_HUMAN Peroxisomal membrane protein PMP34 OS=Homo sapiens GN=SLC25A17 PE=1 SV=1 17 198 9.0E-11
sp|Q66L49|SCMC1_DANRE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Danio rerio GN=slc25a24 PE=2 SV=1 117 294 1.0E-10
sp|Q6NUK1|SCMC1_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens GN=SLC25A24 PE=1 SV=2 1 170 1.0E-10
sp|P32331|YMC1_YEAST Carrier protein YMC1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMC1 PE=3 SV=2 14 185 1.0E-10
sp|A0PC02|UCP1_OCHDA Mitochondrial brown fat uncoupling protein 1 OS=Ochotona dauurica GN=UCP1 PE=2 SV=1 114 275 1.0E-10
sp|Q8HXE3|KMCP1_MACFA Kidney mitochondrial carrier protein 1 OS=Macaca fascicularis GN=SLC25A30 PE=2 SV=1 16 194 1.0E-10
sp|Q5XGI1|KMCP1_XENTR Kidney mitochondrial carrier protein 1 OS=Xenopus tropicalis GN=slc25a30 PE=2 SV=1 16 194 1.0E-10
sp|Q9HC21|TPC_HUMAN Mitochondrial thiamine pyrophosphate carrier OS=Homo sapiens GN=SLC25A19 PE=1 SV=1 10 179 1.0E-10
sp|Q287T7|MFRN1_DANRE Mitoferrin-1 OS=Danio rerio GN=slc25a37 PE=1 SV=1 117 298 1.0E-10
sp|Q641C8|SAMC_XENLA S-adenosylmethionine mitochondrial carrier protein OS=Xenopus laevis GN=slc25a26 PE=2 SV=1 16 294 1.0E-10
sp|A1CIF6|S2538_ASPCL Solute carrier family 25 member 38 homolog OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_051330 PE=3 SV=1 12 275 1.0E-10
sp|Q6FTE5|TPC1_CANGA Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TPC1 PE=3 SV=1 13 292 1.0E-10
sp|Q9LV81|BRTL3_ARATH Probable mitochondrial adenine nucleotide transporter BTL3 OS=Arabidopsis thaliana GN=At5g64970 PE=2 SV=1 26 170 1.0E-10
sp|Q9VQG4|COLT_DROME Congested-like trachea protein OS=Drosophila melanogaster GN=colt PE=2 SV=1 107 292 2.0E-10
sp|P70406|UCP2_MOUSE Mitochondrial uncoupling protein 2 OS=Mus musculus GN=Ucp2 PE=1 SV=1 16 202 2.0E-10
sp|Q8WUT9|S2543_HUMAN Solute carrier family 25 member 43 OS=Homo sapiens GN=SLC25A43 PE=2 SV=2 16 287 2.0E-10
sp|B0DK57|S2538_LACBS Solute carrier family 25 member 38 homolog OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_191230 PE=3 SV=1 13 268 2.0E-10
sp|Q54W11|MCFL_DICDI Mitochondrial substrate carrier family protein L OS=Dictyostelium discoideum GN=mcfL PE=3 SV=1 2 196 3.0E-10
sp|Q9SJY5|PUMP5_ARATH Mitochondrial uncoupling protein 5 OS=Arabidopsis thaliana GN=PUMP5 PE=2 SV=1 4 199 3.0E-10
sp|P10861|UCP1_BOVIN Mitochondrial brown fat uncoupling protein 1 (Fragment) OS=Bos taurus GN=UCP1 PE=2 SV=2 114 273 3.0E-10
sp|B2MVX9|S2538_SHEEP Solute carrier family 25 member 38 OS=Ovis aries GN=SLC25A38 PE=2 SV=1 115 288 3.0E-10
sp|Q5AVW1|TPC1_EMENI Mitochondrial thiamine pyrophosphate carrier 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tpc1 PE=3 SV=1 114 287 3.0E-10
sp|A1CWA4|S2538_NEOFI Solute carrier family 25 member 38 homolog OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_103940 PE=3 SV=1 12 275 3.0E-10
sp|Q0CT66|S2538_ASPTN Solute carrier family 25 member 38 homolog OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_03118 PE=3 SV=1 12 275 3.0E-10
sp|Q944H5|MTM1_ARATH Mitochondrial carrier protein MTM1 OS=Arabidopsis thaliana GN=MTM1 PE=2 SV=1 4 290 3.0E-10
sp|Q5XHA0|SCMC1_XENTR Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Xenopus tropicalis GN=slc25a24 PE=2 SV=1 114 290 4.0E-10
sp|Q9GMZ1|UCP1_CANLF Mitochondrial brown fat uncoupling protein 1 OS=Canis lupus familiaris GN=UCP1 PE=2 SV=1 13 193 4.0E-10
sp|Q86HN8|MCFY_DICDI Mitochondrial substrate carrier family protein Y OS=Dictyostelium discoideum GN=mcfY PE=3 SV=1 16 182 4.0E-10
sp|P40464|FLX1_YEAST Mitochondrial FAD carrier protein FLX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLX1 PE=3 SV=1 114 298 4.0E-10
sp|Q19529|CMC3_CAEEL Probable calcium-binding mitochondrial carrier F17E5.2 OS=Caenorhabditis elegans GN=F17E5.2 PE=3 SV=4 114 296 5.0E-10
sp|Q9FM86|ADT5_ARATH Probable ADP,ATP carrier protein At5g56450 OS=Arabidopsis thaliana GN=At5g56450 PE=2 SV=1 113 294 5.0E-10
sp|Q4WQC5|S2538_ASPFU Solute carrier family 25 member 38 homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G12340 PE=3 SV=1 12 275 5.0E-10
sp|B0Y4J4|S2538_ASPFC Solute carrier family 25 member 38 homolog OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_069300 PE=3 SV=1 12 275 5.0E-10
sp|Q8BVN7|S2541_MOUSE Solute carrier family 25 member 41 OS=Mus musculus GN=Slc25a41 PE=2 SV=1 10 176 6.0E-10
sp|Q9CA93|BAC2_ARATH Mitochondrial arginine transporter BAC2 OS=Arabidopsis thaliana GN=BAC2 PE=1 SV=1 16 93 6.0E-10
sp|Q9M2Z8|MPCP2_ARATH Mitochondrial phosphate carrier protein 2, mitochondrial OS=Arabidopsis thaliana GN=MPT2 PE=2 SV=1 14 236 6.0E-10
sp|O22261|NDT1_ARATH Nicotinamide adenine dinucleotide transporter 1, chloroplastic OS=Arabidopsis thaliana GN=NDT1 PE=1 SV=2 30 290 6.0E-10
sp|Q4X022|TPC1_ASPFU Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tpc1 PE=3 SV=3 114 290 7.0E-10
sp|A7TDX5|TPC1_VANPO Mitochondrial thiamine pyrophosphate carrier 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=TPC1 PE=3 SV=1 13 291 7.0E-10
sp|Q8C0K5|GDC_MOUSE Graves disease carrier protein homolog OS=Mus musculus GN=Slc25a16 PE=1 SV=1 11 139 9.0E-10
sp|P16260|GDC_HUMAN Graves disease carrier protein OS=Homo sapiens GN=SLC25A16 PE=1 SV=3 11 139 9.0E-10
sp|Q3KQZ1|S2535_HUMAN Solute carrier family 25 member 35 OS=Homo sapiens GN=SLC25A35 PE=2 SV=1 14 278 9.0E-10
sp|Q6NUK1|SCMC1_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens GN=SLC25A24 PE=1 SV=2 114 296 1.0E-09
sp|Q5PQM9|KMCP1_RAT Kidney mitochondrial carrier protein 1 OS=Rattus norvegicus GN=Slc25a30 PE=2 SV=1 16 194 1.0E-09
sp|Q01356|ARG13_NEUCR Amino-acid transporter arg-13 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arg-13 PE=2 SV=1 114 275 1.0E-09
sp|A1DI57|TPC1_NEOFI Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tpc1 PE=3 SV=1 114 290 1.0E-09
sp|O94502|YBT5_SCHPO Uncharacterized mitochondrial carrier C12D12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12D12.05c PE=3 SV=2 14 287 1.0E-09
sp|Q2HFL6|TPC1_CHAGB Mitochondrial thiamine pyrophosphate carrier 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TPC1 PE=3 SV=2 15 294 1.0E-09
sp|P0CI40|CMC1_YEASX Calcium-binding mitochondrial carrier SAL1 OS=Saccharomyces cerevisiae GN=SAL1 PE=3 SV=1 3 176 1.0E-09
sp|Q74Z23|S2538_ASHGO Solute carrier family 25 member 38 homolog OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGR383W PE=3 SV=1 1 234 1.0E-09
sp|Q9VA73|CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster GN=aralar1 PE=2 SV=1 108 287 2.0E-09
sp|Q10248|YD1K_SCHPO Uncharacterized mitochondrial carrier C4G9.20c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.20c PE=3 SV=2 1 195 2.0E-09
sp|P34519|TXTP_CAEEL Putative tricarboxylate transport protein, mitochondrial OS=Caenorhabditis elegans GN=K11H3.3 PE=3 SV=1 130 295 2.0E-09
sp|P12242|UCP1_MOUSE Mitochondrial brown fat uncoupling protein 1 OS=Mus musculus GN=Ucp1 PE=1 SV=2 2 193 2.0E-09
sp|Q7T0U6|SCM1B_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-B OS=Xenopus laevis GN=slc25a24-b PE=2 SV=1 114 290 2.0E-09
sp|A2CEQ0|SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio GN=slc25a25b PE=3 SV=2 2 170 2.0E-09
sp|P0C582|M2OM_NEUCR Putative mitochondrial 2-oxoglutarate/malate carrier protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mic-33 PE=3 SV=1 11 96 2.0E-09
sp|Q96DW6|S2538_HUMAN Solute carrier family 25 member 38 OS=Homo sapiens GN=SLC25A38 PE=1 SV=1 113 287 2.0E-09
sp|Q499U1|S2538_RAT Solute carrier family 25 member 38 OS=Rattus norvegicus GN=Slc25a38 PE=2 SV=2 115 288 2.0E-09
sp|Q8R0Y8|S2542_MOUSE Mitochondrial coenzyme A transporter SLC25A42 OS=Mus musculus GN=Slc25a42 PE=1 SV=1 113 296 2.0E-09
sp|P0C546|S2542_RAT Mitochondrial coenzyme A transporter SLC25A42 OS=Rattus norvegicus GN=Slc25a42 PE=2 SV=1 113 296 2.0E-09
sp|A7A285|YFL5_YEAS7 Uncharacterized mitochondrial carrier SCY_1795 OS=Saccharomyces cerevisiae (strain YJM789) GN=SCY_1795 PE=3 SV=2 13 290 2.0E-09
sp|A4RF23|TPC1_MAGO7 Mitochondrial thiamine pyrophosphate carrier 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TPC1 PE=3 SV=2 114 290 3.0E-09
sp|Q7ZY36|SCM1A_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-A OS=Xenopus laevis GN=slc25a24-a PE=2 SV=2 113 290 3.0E-09
sp|Q91XD8|S2538_MOUSE Solute carrier family 25 member 38 OS=Mus musculus GN=Slc25a38 PE=2 SV=1 113 288 3.0E-09
sp|Q01888|GDC_BOVIN Graves disease carrier protein OS=Bos taurus GN=SLC25A16 PE=2 SV=1 11 139 3.0E-09
sp|A7TIQ0|S2538_VANPO Solute carrier family 25 member 38 homolog OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1043p32 PE=3 SV=1 13 282 3.0E-09
sp|Q75EP3|TPC1_ASHGO Mitochondrial thiamine pyrophosphate carrier 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TPC1 PE=3 SV=1 11 299 3.0E-09
sp|Q9VA73|CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster GN=aralar1 PE=2 SV=1 1 176 4.0E-09
sp|P14271|UCP1_RABIT Mitochondrial brown fat uncoupling protein 1 OS=Oryctolagus cuniculus GN=UCP1 PE=2 SV=1 112 275 4.0E-09
sp|O14281|YETC_SCHPO Uncharacterized mitochondrial carrier C8C9.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC8C9.12c PE=3 SV=1 114 292 4.0E-09
sp|Q20799|CMC2_CAEEL Putative calcium-binding mitochondrial carrier F55A11.4 OS=Caenorhabditis elegans GN=F55A11.4 PE=5 SV=1 103 294 4.0E-09
sp|A6SL61|TPC1_BOTFB Mitochondrial thiamine pyrophosphate carrier 1 OS=Botryotinia fuckeliana (strain B05.10) GN=tpc1 PE=3 SV=1 109 290 5.0E-09
sp|Q76P23|PM34_DICDI Mitochondrial substrate carrier family protein Q OS=Dictyostelium discoideum GN=mcfQ PE=2 SV=1 16 286 5.0E-09
sp|O65023|EAAC_ARATH Probable envelope ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana GN=EAAC PE=2 SV=2 4 208 5.0E-09
sp|O43808|PM34_HUMAN Peroxisomal membrane protein PMP34 OS=Homo sapiens GN=SLC25A17 PE=1 SV=1 117 274 5.0E-09
sp|P16261|GDC_RAT Graves disease carrier protein (Fragment) OS=Rattus norvegicus GN=Slc25a16 PE=2 SV=1 13 234 5.0E-09
sp|P04633|UCP1_RAT Mitochondrial brown fat uncoupling protein 1 OS=Rattus norvegicus GN=Ucp1 PE=1 SV=2 2 193 6.0E-09
sp|P39953|YEA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEA6 PE=1 SV=1 112 274 6.0E-09
sp|A7ER02|TPC1_SCLS1 Mitochondrial thiamine pyrophosphate carrier 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tpc1 PE=3 SV=1 109 290 6.0E-09
sp|Q06497|ANT1_YEAST Peroxisomal adenine nucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ANT1 PE=1 SV=1 17 275 6.0E-09
sp|Q5B717|S2538_EMENI Solute carrier family 25 member 38 homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN3663 PE=3 SV=2 12 269 6.0E-09
sp|A2Q9F0|S2538_ASPNC Solute carrier family 25 member 38 homolog OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An01g07650 PE=3 SV=1 12 275 6.0E-09
sp|Q5IS35|TPC_MACFA Mitochondrial thiamine pyrophosphate carrier OS=Macaca fascicularis GN=SLC25A19 PE=2 SV=1 109 295 7.0E-09
sp|Q54MZ4|MCFB_DICDI Mitochondrial substrate carrier family protein B OS=Dictyostelium discoideum GN=mcfB PE=3 SV=1 114 294 8.0E-09
sp|P16261|GDC_RAT Graves disease carrier protein (Fragment) OS=Rattus norvegicus GN=Slc25a16 PE=2 SV=1 113 290 8.0E-09
sp|Q68F18|MFN2B_XENLA Mitoferrin-2B OS=Xenopus laevis GN=slc25a28-b PE=2 SV=1 16 103 8.0E-09
sp|A0PC02|UCP1_OCHDA Mitochondrial brown fat uncoupling protein 1 OS=Ochotona dauurica GN=UCP1 PE=2 SV=1 13 193 9.0E-09
sp|Q0CEN9|TPC1_ASPTN Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tpc1 PE=3 SV=1 114 290 9.0E-09
sp|Q6GLJ0|MFN2A_XENLA Mitoferrin-2A OS=Xenopus laevis GN=slc25a28-a PE=2 SV=1 16 103 9.0E-09
sp|A5PJZ1|SCMC1_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Bos taurus GN=SLC25A24 PE=2 SV=1 114 296 1.0E-08
sp|A4RF23|TPC1_MAGO7 Mitochondrial thiamine pyrophosphate carrier 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TPC1 PE=3 SV=2 4 174 1.0E-08
sp|A2R5A0|TPC1_ASPNC Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tpc1 PE=3 SV=1 9 176 1.0E-08
sp|Q54EV4|MCFA_DICDI Mitochondrial substrate carrier family protein A OS=Dictyostelium discoideum GN=mcfA PE=3 SV=1 2 178 1.0E-08
sp|Q6GQS1|SCMC3_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Mus musculus GN=Slc25a23 PE=1 SV=1 114 294 1.0E-08
sp|O04619|ADNT1_ARATH Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana GN=ADNT1 PE=2 SV=1 4 89 1.0E-08
sp|Q9M024|TAAC_ARATH Thylakoid ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana GN=TAAC PE=1 SV=1 8 208 1.0E-08
sp|Q9UTN1|OAC1_SCHPO Mitochondrial oxaloacetate transport protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oac1 PE=3 SV=1 115 288 1.0E-08
sp|O13805|YE08_SCHPO Uncharacterized mitochondrial carrier C17H9.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.08 PE=3 SV=1 113 298 1.0E-08
sp|Q18P97|UCP1_SUNMU Mitochondrial brown fat uncoupling protein 1 OS=Suncus murinus GN=UCP1 PE=2 SV=1 2 181 2.0E-08
sp|Q9HC21|TPC_HUMAN Mitochondrial thiamine pyrophosphate carrier OS=Homo sapiens GN=SLC25A19 PE=1 SV=1 115 295 2.0E-08
sp|A1DI57|TPC1_NEOFI Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tpc1 PE=3 SV=1 9 176 2.0E-08
sp|Q4X022|TPC1_ASPFU Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tpc1 PE=3 SV=3 9 176 2.0E-08
sp|Q9UBX3|DIC_HUMAN Mitochondrial dicarboxylate carrier OS=Homo sapiens GN=SLC25A10 PE=1 SV=2 5 170 2.0E-08
sp|Q1E7P0|TPC1_COCIM Mitochondrial thiamine pyrophosphate carrier 1 OS=Coccidioides immitis (strain RS) GN=TPC1 PE=3 SV=1 114 290 3.0E-08
sp|Q2UCW8|TPC1_ASPOR Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tpc1 PE=3 SV=1 114 290 3.0E-08
sp|Q9VAY3|MFRN_DROME Mitoferrin OS=Drosophila melanogaster GN=mfrn PE=2 SV=1 112 269 3.0E-08
sp|A6RF73|TPC1_AJECN Mitochondrial thiamine pyrophosphate carrier 1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=TPC1 PE=3 SV=1 109 284 3.0E-08
sp|Q23125|MFRN_CAEEL Mitoferrin OS=Caenorhabditis elegans GN=W02B12.9 PE=3 SV=1 13 287 3.0E-08
sp|Q6FR88|S2538_CANGA Solute carrier family 25 member 38 homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0H10538g PE=3 SV=1 17 294 3.0E-08
sp|Q5NVC1|TPC_PONAB Mitochondrial thiamine pyrophosphate carrier OS=Pongo abelii GN=SLC25A19 PE=2 SV=1 115 295 4.0E-08
sp|Q2UCW8|TPC1_ASPOR Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tpc1 PE=3 SV=1 9 176 4.0E-08
sp|Q7S2H8|TPC1_NEUCR Mitochondrial thiamine pyrophosphate carrier 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tpc-1 PE=3 SV=1 3 176 4.0E-08
sp|Q9C5M0|DTC_ARATH Mitochondrial dicarboxylate/tricarboxylate transporter DTC OS=Arabidopsis thaliana GN=DTC PE=1 SV=1 2 170 4.0E-08
sp|Q9P6N6|S2538_SCHPO Solute carrier family 25 member 38 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC823.10c PE=3 SV=1 13 275 4.0E-08
sp|Q551X6|MCFV_DICDI Mitochondrial substrate carrier family protein V OS=Dictyostelium discoideum GN=mcfV PE=3 SV=1 16 102 4.0E-08
sp|Q9DAM5|TPC_MOUSE Mitochondrial thiamine pyrophosphate carrier OS=Mus musculus GN=Slc25a19 PE=1 SV=1 10 179 5.0E-08
sp|P38702|LEU5_YEAST Mitochondrial carrier protein LEU5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEU5 PE=3 SV=1 113 295 5.0E-08
sp|O95258|UCP5_HUMAN Brain mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A14 PE=2 SV=1 16 194 6.0E-08
sp|Q59Q36|TPC1_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TPC1 PE=3 SV=1 113 284 6.0E-08
sp|A5DX39|TPC1_LODEL Mitochondrial thiamine pyrophosphate carrier 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=TPC1 PE=3 SV=1 1 169 6.0E-08
sp|Q6IS41|S2547_MOUSE Solute carrier family 25 member 47 OS=Mus musculus GN=Slc25a47 PE=2 SV=2 112 277 7.0E-08
sp|A2R5A0|TPC1_ASPNC Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tpc1 PE=3 SV=1 114 287 7.0E-08
sp|Q54PY7|M2OM_DICDI Probable mitochondrial 2-oxoglutarate/malate carrier protein OS=Dictyostelium discoideum GN=ucpC PE=3 SV=1 1 176 8.0E-08
sp|Q29RM1|TPC_BOVIN Mitochondrial thiamine pyrophosphate carrier OS=Bos taurus GN=SLC25A19 PE=2 SV=1 10 179 8.0E-08
sp|Q8BMD8|SCMC1_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Mus musculus GN=Slc25a24 PE=1 SV=1 114 296 8.0E-08
sp|Q55E85|MCFD_DICDI Mitochondrial substrate carrier family protein D OS=Dictyostelium discoideum GN=mcfD PE=3 SV=1 26 199 8.0E-08
sp|Q86HN8|MCFY_DICDI Mitochondrial substrate carrier family protein Y OS=Dictyostelium discoideum GN=mcfY PE=3 SV=1 119 296 8.0E-08
sp|Q6CNY8|S2538_KLULA Solute carrier family 25 member 38 homolog OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0E08911g PE=3 SV=1 1 294 8.0E-08
sp|Q54S10|MCFU_DICDI Mitochondrial substrate carrier family protein U OS=Dictyostelium discoideum GN=mcfU PE=3 SV=1 3 98 9.0E-08
sp|Q3ZBJ8|MFRN1_BOVIN Mitoferrin-1 OS=Bos taurus GN=SLC25A37 PE=2 SV=1 13 103 9.0E-08
sp|Q9Z2B2|UCP5_MOUSE Brain mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a14 PE=1 SV=2 16 194 1.0E-07
sp|O18757|SCMC1_RABIT Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Oryctolagus cuniculus GN=SLC25A24 PE=1 SV=1 114 296 1.0E-07
sp|P0CAT2|S238B_DANRE Solute carrier family 25 member 38-B OS=Danio rerio GN=slc25a38b PE=3 SV=2 113 288 1.0E-07
sp|Q0VCH6|S2540_BOVIN Solute carrier family 25 member 40 OS=Bos taurus GN=SLC25A40 PE=2 SV=1 105 278 1.0E-07
sp|Q12251|YP011_YEAST Uncharacterized mitochondrial carrier YPR011C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR011C PE=1 SV=1 107 278 1.0E-07
sp|Q628Z2|CMC3_CAEBR Probable calcium-binding mitochondrial carrier CBG00135 OS=Caenorhabditis briggsae GN=CBG00135 PE=3 SV=1 114 294 1.0E-07
sp|Q6C107|TPC1_YARLI Mitochondrial thiamine pyrophosphate carrier 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TPC1 PE=3 SV=1 106 294 1.0E-07
sp|Q54RB9|CMC_DICDI Calcium-binding mitochondrial carrier protein OS=Dictyostelium discoideum GN=mcfO PE=3 SV=1 204 294 2.0E-07
sp|Q920G8|MFRN1_MOUSE Mitoferrin-1 OS=Mus musculus GN=Slc25a37 PE=1 SV=1 111 287 2.0E-07
sp|A1CIF6|S2538_ASPCL Solute carrier family 25 member 38 homolog OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_051330 PE=3 SV=1 13 182 2.0E-07
sp|Q620A6|MFRN_CAEBR Mitoferrin OS=Caenorhabditis briggsae GN=CBG02884 PE=3 SV=1 24 287 2.0E-07
sp|Q6Q0C1|S2547_HUMAN Solute carrier family 25 member 47 OS=Homo sapiens GN=SLC25A47 PE=2 SV=1 112 277 3.0E-07
sp|P14271|UCP1_RABIT Mitochondrial brown fat uncoupling protein 1 OS=Oryctolagus cuniculus GN=UCP1 PE=2 SV=1 13 192 3.0E-07
sp|A7ER02|TPC1_SCLS1 Mitochondrial thiamine pyrophosphate carrier 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tpc1 PE=3 SV=1 14 176 3.0E-07
sp|Q6J329|S2547_RAT Solute carrier family 25 member 47 OS=Rattus norvegicus GN=Slc25a47 PE=2 SV=1 112 277 4.0E-07
sp|Q0UUH1|TPC1_PHANO Mitochondrial thiamine pyrophosphate carrier 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=TPC1 PE=3 SV=3 104 290 4.0E-07
sp|Q2UU67|S2538_ASPOR Solute carrier family 25 member 38 homolog OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090009000436 PE=3 SV=1 12 275 4.0E-07
sp|Q1E7P0|TPC1_COCIM Mitochondrial thiamine pyrophosphate carrier 1 OS=Coccidioides immitis (strain RS) GN=TPC1 PE=3 SV=1 14 176 5.0E-07
sp|Q0CEN9|TPC1_ASPTN Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tpc1 PE=3 SV=1 7 176 5.0E-07
sp|Q9C9R4|BRTL2_ARATH Probable mitochondrial adenine nucleotide transporter BTL2 OS=Arabidopsis thaliana GN=At1g78180 PE=2 SV=1 16 287 5.0E-07
sp|Q66H23|MFRN1_RAT Mitoferrin-1 OS=Rattus norvegicus GN=Slc25a37 PE=2 SV=1 111 287 6.0E-07
sp|O43808|PM34_HUMAN Peroxisomal membrane protein PMP34 OS=Homo sapiens GN=SLC25A17 PE=1 SV=1 16 287 6.0E-07
sp|Q8BH59|CMC1_MOUSE Calcium-binding mitochondrial carrier protein Aralar1 OS=Mus musculus GN=Slc25a12 PE=1 SV=1 212 296 7.0E-07
sp|Q21153|CMC1_CAEEL Probable calcium-binding mitochondrial carrier K02F3.2 OS=Caenorhabditis elegans GN=K02F3.2 PE=3 SV=3 104 287 7.0E-07
sp|O70579|PM34_MOUSE Peroxisomal membrane protein PMP34 OS=Mus musculus GN=Slc25a17 PE=1 SV=1 117 274 7.0E-07
sp|A6ZXL1|S2538_YEAS7 Solute carrier family 25 member 38 homolog OS=Saccharomyces cerevisiae (strain YJM789) GN=SCY_0799 PE=3 SV=1 17 294 7.0E-07
sp|B3LH09|S2538_YEAS1 Solute carrier family 25 member 38 homolog OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SCRG_00613 PE=3 SV=1 17 294 7.0E-07
sp|Q9H0C2|ADT4_HUMAN ADP/ATP translocase 4 OS=Homo sapiens GN=SLC25A31 PE=2 SV=1 6 79 8.0E-07
sp|O70579|PM34_MOUSE Peroxisomal membrane protein PMP34 OS=Mus musculus GN=Slc25a17 PE=1 SV=1 13 198 9.0E-07
sp|Q07534|S2538_YEAST Solute carrier family 25 member 38 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEM25 PE=1 SV=1 17 294 9.0E-07
sp|Q54RB9|CMC_DICDI Calcium-binding mitochondrial carrier protein OS=Dictyostelium discoideum GN=mcfO PE=3 SV=1 86 282 1.0E-06
sp|Q9D6M3|GHC1_MOUSE Mitochondrial glutamate carrier 1 OS=Mus musculus GN=Slc25a22 PE=1 SV=1 2 83 1.0E-06
sp|P10861|UCP1_BOVIN Mitochondrial brown fat uncoupling protein 1 (Fragment) OS=Bos taurus GN=UCP1 PE=2 SV=2 13 193 1.0E-06
sp|Q54EV4|MCFA_DICDI Mitochondrial substrate carrier family protein A OS=Dictyostelium discoideum GN=mcfA PE=3 SV=1 9 89 1.0E-06
sp|Q9BXI2|ORNT2_HUMAN Mitochondrial ornithine transporter 2 OS=Homo sapiens GN=SLC25A2 PE=1 SV=3 115 279 1.0E-06
sp|A3KPP4|S2535_DANRE Solute carrier family 25 member 35 OS=Danio rerio GN=slc25a35 PE=2 SV=1 14 84 1.0E-06
sp|Q06497|ANT1_YEAST Peroxisomal adenine nucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ANT1 PE=1 SV=1 113 269 1.0E-06
sp|Q9P7V8|MPCP_SCHPO Probable mitochondrial phosphate carrier protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1703.13c PE=3 SV=1 30 297 1.0E-06
sp|Q4PDL5|S2538_USTMA Solute carrier family 25 member 38 homolog OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_10880 PE=3 SV=2 8 237 1.0E-06
sp|Q4R8M0|ADT4_MACFA ADP/ATP translocase 4 OS=Macaca fascicularis GN=SLC25A31 PE=2 SV=1 6 79 2.0E-06
sp|A6SL61|TPC1_BOTFB Mitochondrial thiamine pyrophosphate carrier 1 OS=Botryotinia fuckeliana (strain B05.10) GN=tpc1 PE=3 SV=1 14 176 2.0E-06
sp|Q6BPW0|TPC1_DEBHA Mitochondrial thiamine pyrophosphate carrier 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TPC1 PE=3 SV=3 113 284 2.0E-06
sp|A3LVX1|TPC1_PICST Mitochondrial thiamine pyrophosphate carrier 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TPC1 PE=3 SV=2 12 170 2.0E-06
sp|A5DX39|TPC1_LODEL Mitochondrial thiamine pyrophosphate carrier 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=TPC1 PE=3 SV=1 113 284 2.0E-06
sp|Q3SZK0|S2534_BOVIN Solute carrier family 25 member 34 OS=Bos taurus GN=SLC25A34 PE=2 SV=1 3 111 2.0E-06
sp|Q3V132|ADT4_MOUSE ADP/ATP translocase 4 OS=Mus musculus GN=Slc25a31 PE=1 SV=1 4 79 3.0E-06
sp|Q6CQR3|TPC1_KLULA Mitochondrial thiamine pyrophosphate carrier 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TPC1 PE=3 SV=1 113 233 3.0E-06
sp|P40556|YIA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIA6 PE=1 SV=1 112 276 3.0E-06
sp|Q7SXW0|S2539_DANRE Solute carrier family 25 member 39 OS=Danio rerio GN=slc25a39 PE=2 SV=1 16 139 3.0E-06
sp|Q8RWA5|NDT2_ARATH Nicotinamide adenine dinucleotide transporter 2, mitochondrial OS=Arabidopsis thaliana GN=NDT2 PE=1 SV=1 16 102 3.0E-06
sp|B2VSU4|S2538_PYRTR Solute carrier family 25 member 38 homolog OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_00728 PE=3 SV=1 1 275 3.0E-06
sp|P79110|TXTP_BOVIN Tricarboxylate transport protein, mitochondrial OS=Bos taurus GN=SLC25A1 PE=2 SV=1 5 73 4.0E-06
sp|P0CI40|CMC1_YEASX Calcium-binding mitochondrial carrier SAL1 OS=Saccharomyces cerevisiae GN=SAL1 PE=3 SV=1 14 290 4.0E-06
sp|Q9Z2Z6|MCAT_MOUSE Mitochondrial carnitine/acylcarnitine carrier protein OS=Mus musculus GN=Slc25a20 PE=1 SV=1 113 294 5.0E-06
sp|Q8BVN7|S2541_MOUSE Solute carrier family 25 member 41 OS=Mus musculus GN=Slc25a41 PE=2 SV=1 114 297 5.0E-06
sp|Q5AVW1|TPC1_EMENI Mitochondrial thiamine pyrophosphate carrier 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tpc1 PE=3 SV=1 1 174 5.0E-06
sp|Q620A6|MFRN_CAEBR Mitoferrin OS=Caenorhabditis briggsae GN=CBG02884 PE=3 SV=1 15 172 5.0E-06
sp|Q8JZU2|TXTP_MOUSE Tricarboxylate transport protein, mitochondrial OS=Mus musculus GN=Slc25a1 PE=1 SV=1 2 73 6.0E-06
sp|P38087|YMC2_YEAST Carrier protein YMC2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMC2 PE=1 SV=1 8 185 6.0E-06
sp|Q9SUV1|BRT1_ARATH Adenine nucleotide transporter BT1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=BT1 PE=1 SV=1 114 297 7.0E-06
sp|P0C582|M2OM_NEUCR Putative mitochondrial 2-oxoglutarate/malate carrier protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mic-33 PE=3 SV=1 111 275 7.0E-06
sp|Q54QI8|MCFR_DICDI Mitochondrial substrate carrier family protein R OS=Dictyostelium discoideum GN=mcfR PE=3 SV=1 102 233 7.0E-06
sp|Q551X6|MCFV_DICDI Mitochondrial substrate carrier family protein V OS=Dictyostelium discoideum GN=mcfV PE=3 SV=1 2 90 7.0E-06
sp|O04200|PXN_ARATH Peroxisomal nicotinamide adenine dinucleotide carrier OS=Arabidopsis thaliana GN=PXN PE=1 SV=1 14 97 7.0E-06
sp|P97521|MCAT_RAT Mitochondrial carnitine/acylcarnitine carrier protein OS=Rattus norvegicus GN=Slc25a20 PE=1 SV=1 113 294 8.0E-06
sp|Q6CQR3|TPC1_KLULA Mitochondrial thiamine pyrophosphate carrier 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TPC1 PE=3 SV=1 201 271 8.0E-06
sp|Q19529|CMC3_CAEEL Probable calcium-binding mitochondrial carrier F17E5.2 OS=Caenorhabditis elegans GN=F17E5.2 PE=3 SV=4 8 170 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7043
MSQQEKPLPFIYQFAAGAIAGVSEILVMYPLDVVKTRVQLQTGKGTGAESYNGMLDCFRKIIKNEGFSRLYRGIS
APILMEAPKRATKFAANDEWGKVYRKMFGVSQMNQSLSVLTGATAGATESFVVVPFELVKIRLQDKASAGKYNGM
VDCVVKTVRNEGLLALYQGLESTMWRHILWNAGYFGCIFQVRQMIPAADSKRGQMVNDLISGSVGGTVGTMVNTP
MDVVKSRIQNTPRVPGQVPKYNWAWPSIFTVLREEGVSALYKGFLPKVLRLGPGGGILLVVFTTVMDTFRKMRS*
Coding >OphauB2|7043
ATGTCGCAGCAGGAGAAACCCCTCCCCTTCATCTACCAATTCGCCGCAGGCGCAATTGCTGGTGTCTCCGAGATC
CTGGTCATGTACCCGCTAGATGTTGTCAAGACTAGAGTTCAGCTTCAAACCGGAAAAGGCACAGGCGCCGAATCG
TACAACGGCATGCTCGACTGTTTTCGGAAAATTATCAAGAATGAGGGATTCTCTCGTCTCTACCGCGGCATCTCG
GCCCCCATCCTCATGGAGGCTCCCAAGAGGGCTACCAAGTTTGCCGCCAACGACGAATGGGGCAAGGTCTACCGC
AAAATGTTTGGAGTCTCGCAGATGAATCAGTCGCTCTCTGTCTTGACAGGGGCCACGGCTGGCGCCACCGAGTCG
TTTGTTGTTGTTCCCTTTGAGCTGGTCAAGATCCGACTACAGGACAAAGCCTCGGCTGGCAAATACAACGGCATG
GTAGACTGTGTTGTCAAGACGGTCCGAAATGAGGGACTTCTGGCTCTCTACCAGGGCCTTGAGAGCACCATGTGG
CGGCACATTCTATGGAATGCTGGCTATTTTGGCTGCATTTTCCAGGTCCGCCAGATGATTCCCGCGGCCGATTCC
AAGCGGGGCCAAATGGTCAATGACCTCATCTCGGGCTCCGTTGGTGGCACCGTTGGCACCATGGTCAATACTCCC
ATGGACGTTGTCAAGAGCCGTATCCAAAACACGCCCCGTGTTCCTGGCCAAGTGCCCAAGTACAATTGGGCCTGG
CCCTCCATCTTCACCGTCCTTAGAGAAGAGGGGGTTTCGGCACTGTACAAGGGATTTTTACCCAAGGTGCTGCGG
CTCGGACCGGGAGGAGGCATTCTTCTCGTCGTTTTTACCACTGTCATGGATACGTTTCGCAAGATGCGTTCCTAG
Transcript >OphauB2|7043
ATGTCGCAGCAGGAGAAACCCCTCCCCTTCATCTACCAATTCGCCGCAGGCGCAATTGCTGGTGTCTCCGAGATC
CTGGTCATGTACCCGCTAGATGTTGTCAAGACTAGAGTTCAGCTTCAAACCGGAAAAGGCACAGGCGCCGAATCG
TACAACGGCATGCTCGACTGTTTTCGGAAAATTATCAAGAATGAGGGATTCTCTCGTCTCTACCGCGGCATCTCG
GCCCCCATCCTCATGGAGGCTCCCAAGAGGGCTACCAAGTTTGCCGCCAACGACGAATGGGGCAAGGTCTACCGC
AAAATGTTTGGAGTCTCGCAGATGAATCAGTCGCTCTCTGTCTTGACAGGGGCCACGGCTGGCGCCACCGAGTCG
TTTGTTGTTGTTCCCTTTGAGCTGGTCAAGATCCGACTACAGGACAAAGCCTCGGCTGGCAAATACAACGGCATG
GTAGACTGTGTTGTCAAGACGGTCCGAAATGAGGGACTTCTGGCTCTCTACCAGGGCCTTGAGAGCACCATGTGG
CGGCACATTCTATGGAATGCTGGCTATTTTGGCTGCATTTTCCAGGTCCGCCAGATGATTCCCGCGGCCGATTCC
AAGCGGGGCCAAATGGTCAATGACCTCATCTCGGGCTCCGTTGGTGGCACCGTTGGCACCATGGTCAATACTCCC
ATGGACGTTGTCAAGAGCCGTATCCAAAACACGCCCCGTGTTCCTGGCCAAGTGCCCAAGTACAATTGGGCCTGG
CCCTCCATCTTCACCGTCCTTAGAGAAGAGGGGGTTTCGGCACTGTACAAGGGATTTTTACCCAAGGTGCTGCGG
CTCGGACCGGGAGGAGGCATTCTTCTCGTCGTTTTTACCACTGTCATGGATACGTTTCGCAAGATGCGTTCCTAG
Gene >OphauB2|7043
ATGTCGCAGCAGGAGAAACCCCTCCCCTTCATCTACCAATTCGCCGCAGGTGCGTCGTCAGCCTATTCGCTGTCA
ACCTCCGTTTTGCTGACATGCCGTTTCAGGCGCAATTGCTGGTGTCTCCGAGGTGTGATGTGCACATGTGGCCTA
CCAGCCCATGACATTTCAGTTGCTGATAGACCTGCGCTGGAGCCCTCAGATCCTGGTCATGTGAGTTGCTTCTTG
TCAAAACAAGCAAGACGATGGAATGGTATAAAGAAACGGCTGATGTTGACGCGTGCTCTGATATAGGTACCCGCT
AGATGTTGTCAAGACTAGAGTGTGCGACTCTTTTCCTACTCTTCACGCCAATGGCGGCCAAAGACGTATAAGCTG
ACACAGGGCCTCCAAACAGTCAGCTTCAAACCGGAAAAGGCACAGGCGCCGAATCGTACAACGGCATGCTCGACT
GTTTTCGGAAAATTATCAAGAATGAGGGGTGAGCAGCTGCTCTTGCCCCTCATCACATCTCTGACCCCAGGGCTC
ATGCACAGCGCTCAGATTCTCTCGTCTCTACCGCGGCATCTCGGCCCCCATCCTCATGGAGGCTCCCAAGAGGGC
TACCAAGTTTGCCGCCAACGACGAATGGGGCAAGGTCTACCGCAAAATGTTTGGAGTCTCGCAGATGAATCAGTC
GCTCTCTGTCTTGACAGGGGCCACGGCTGGCGCCACCGAGTCGTTTGTTGTTGTTCCCTTTGAGCTGGTCAAGAT
CCGACTACAGGACAAAGCCTCGGCTGGCAAATACAACGGCATGGTAGACTGTGTTGTCAAGACGGTCCGAAATGA
GGGACTTCTGGCTCTCTACCAGGGCCTTGAGAGCACCATGTGGCGGCACATTCTATGGAATGCTGGCTATTTTGG
CTGCATTTTCCAGGTCCGCCAGATGATTCCCGCGGCCGATTCCAAGCGGGGCCAAATGGTCAATGACCTCATCTC
GGGCTCCGTTGGTGGCACCGTTGGCACCATGGTCAATACTCCCATGGACGTTGTCAAGAGCCGTATCCAAAACAC
GCCCCGTGTTCCTGGCCAAGTGCCCAAGTACAATTGGGCCTGGCCCTCCATCTTCACCGTCCTTAGAGAAGAGGG
GGTTTCGGCACTGTACAAGGGATTTTTACCCAAGGTACCATTTGCCATTTTGCTATCAGGAACTGAATCGCGAAG
CTGAATGCAGATTTCTAGGTGCTGCGGCTCGGACCGGGAGGAGGCATTCTTCTCGTCGTTTTTACCACTGTCATG
GATACGTTTCGCAAGATGCGTTCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail