Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|703
Gene name
LocationContig_113:36482..38165
Strand-
Gene length (bp)1683
Transcript length (bp)1413
Coding sequence length (bp)1413
Protein length (aa) 471

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.7E-32 35 392

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 4 459 1.0E-125
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 18 436 1.0E-111
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 18 457 4.0E-51
sp|P53241|VHT1_YEAST Vitamin H transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHT1 PE=1 SV=1 11 322 6.0E-33
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 10 279 4.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 4 459 1.0E-125
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 18 436 1.0E-111
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 18 457 4.0E-51
sp|P53241|VHT1_YEAST Vitamin H transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHT1 PE=1 SV=1 11 322 6.0E-33
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 10 279 4.0E-27
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 3 229 1.0E-21
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 18 229 1.0E-20
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 21 201 5.0E-20
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 15 234 3.0E-19
sp|Q88FY6|NICT_PSEPK Putative metabolite transport protein NicT OS=Pseudomonas putida (strain KT2440) GN=nicT PE=2 SV=1 7 228 9.0E-19
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 19 235 1.0E-18
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 18 234 3.0E-18
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 18 235 3.0E-16
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 19 235 7.0E-16
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 21 251 1.0E-15
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 23 235 2.0E-15
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 24 251 3.0E-14
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 15 208 1.0E-13
sp|Q9C0U9|YQD3_SCHPO Uncharacterized transporter PB1C11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.03 PE=1 SV=1 29 235 5.0E-13
sp|O13880|VHT1_SCHPO Vitamin H transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vht1 PE=2 SV=1 2 205 3.0E-12
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 15 259 9.0E-12
sp|P39398|LGOT_ECOLI Probable L-galactonate transporter OS=Escherichia coli (strain K12) GN=lgoT PE=1 SV=2 22 216 3.0E-11
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 21 235 8.0E-11
sp|Q12235|YCT1_YEAST High affinity cysteine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCT1 PE=1 SV=1 18 251 2.0E-10
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 1 235 3.0E-10
sp|Q0K843|SAUU_CUPNH Probable sulfoacetate transporter SauU OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauU PE=2 SV=1 24 236 6.0E-09
sp|P0AA76|DGOT_ECOLI D-galactonate transporter OS=Escherichia coli (strain K12) GN=dgoT PE=1 SV=1 15 201 7.0E-08
sp|P0AA77|DGOT_ECOL6 D-galactonate transporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dgoT PE=3 SV=1 15 201 7.0E-08
sp|P42237|GUDP_BACSU Probable glucarate transporter OS=Bacillus subtilis (strain 168) GN=gudP PE=3 SV=2 37 205 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0044425 membrane part No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0031224 intrinsic component of membrane No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 96 115 19
2 120 142 22
3 155 177 22
4 192 211 19
5 255 274 19
6 294 316 22
7 328 350 22
8 360 382 22
9 395 417 22
10 427 449 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|703
MTRSRMARCLHVSYQPGERILIQKLDFFILTFCCLSFLIGNLDHSNLVNAYVSGMREELGFVGNQLTEINTCFTV
GYVLGQIPSNLSLHYVRPRKWFPLMMLLWSGLTMVTASVHNPQSIMVIRFFQGIFEASTFVGTHYVLGAWYTERE
LGKRSGIFSSSGLAGTMIGGFIQTGIYNSLNGRLGLSGWRWLFIVDGLLGLPVALFGLLFFPDTPHTTAVGYLTD
DEKKLALSRVPPAASPSPITLKFLKKVLTSWYWWGFVGLWIIAGEAESFPSNSLLALYMQQHPVNKYSIAQINNY
PTGVSAVGIVSTLFWAALTDLLGGMRYLVGYYIGLTGIATSIMILLASHHPTGPSSTSVVFAAYYWSGTVYACQA
TFFAWCNDAMRSEEAAFRGVVLAGMNMGSNAVNAWWSIVFYGASMAPWFTRGLWAMMACCLVLVTWCAALAHIVQ
VKNTSKQASSLRLDEGLGLL*
Coding >OphauB2|703
ATGACACGCTCACGTATGGCGAGGTGCCTTCACGTGTCATACCAGCCGGGCGAGCGGATCCTGATACAAAAGCTC
GATTTTTTCATCCTGACTTTTTGCTGCTTGAGCTTCCTCATTGGTAATCTTGACCATTCCAATCTTGTCAATGCC
TATGTATCGGGCATGCGAGAGGAGCTTGGGTTTGTCGGCAACCAGCTCACCGAAATCAATACTTGCTTTACTGTG
GGCTACGTCCTTGGTCAGATCCCATCCAACCTCTCCCTTCACTATGTCAGACCTCGGAAATGGTTCCCCCTCATG
ATGCTCCTTTGGAGCGGACTCACCATGGTGACTGCCTCGGTCCACAATCCTCAGTCCATCATGGTCATTCGATTT
TTCCAGGGCATCTTTGAGGCCTCGACATTTGTCGGAACTCATTATGTCCTTGGCGCATGGTATACGGAGCGTGAG
CTCGGTAAACGCAGCGGCATCTTTAGCTCGTCAGGTCTGGCAGGCACCATGATTGGAGGCTTTATACAGACTGGC
ATCTACAATAGTCTAAATGGGCGCCTAGGCCTTAGTGGGTGGCGCTGGTTGTTTATTGTCGACGGGCTCTTGGGG
CTCCCAGTGGCCCTCTTTGGTCTCTTGTTTTTCCCAGATACCCCTCACACCACTGCTGTTGGCTACCTGACAGAC
GACGAGAAGAAGCTGGCGCTCTCTCGCGTGCCGCCAGCTGCCAGCCCGTCTCCGATTACCTTGAAGTTTCTGAAA
AAGGTTCTAACCTCGTGGTACTGGTGGGGATTCGTTGGCTTGTGGATAATTGCGGGAGAGGCTGAATCTTTTCCC
TCCAACTCACTGCTGGCCCTCTACATGCAACAACACCCAGTCAATAAATACAGCATTGCCCAAATCAACAACTAT
CCCACCGGCGTTTCGGCCGTTGGAATTGTCTCGACTCTCTTTTGGGCAGCCTTGACTGACCTTTTGGGTGGCATG
CGATATCTTGTGGGATATTACATAGGCCTGACTGGGATTGCAACCTCCATCATGATTCTCTTGGCGTCACATCAT
CCCACAGGCCCGTCGTCGACATCAGTCGTCTTTGCTGCATACTACTGGTCTGGAACGGTGTATGCCTGTCAGGCC
ACGTTTTTCGCCTGGTGCAACGATGCCATGCGCAGTGAAGAGGCTGCTTTTCGTGGTGTTGTTCTCGCCGGTATG
AACATGGGAAGCAACGCCGTCAATGCCTGGTGGAGCATTGTCTTTTATGGTGCTTCCATGGCTCCATGGTTTACA
CGTGGTTTGTGGGCCATGATGGCTTGTTGTCTGGTATTGGTTACATGGTGCGCAGCACTGGCACACATTGTACAA
GTTAAAAACACTTCCAAGCAGGCCTCTTCGCTACGTCTTGATGAGGGTCTTGGGCTGTTGTAG
Transcript >OphauB2|703
ATGACACGCTCACGTATGGCGAGGTGCCTTCACGTGTCATACCAGCCGGGCGAGCGGATCCTGATACAAAAGCTC
GATTTTTTCATCCTGACTTTTTGCTGCTTGAGCTTCCTCATTGGTAATCTTGACCATTCCAATCTTGTCAATGCC
TATGTATCGGGCATGCGAGAGGAGCTTGGGTTTGTCGGCAACCAGCTCACCGAAATCAATACTTGCTTTACTGTG
GGCTACGTCCTTGGTCAGATCCCATCCAACCTCTCCCTTCACTATGTCAGACCTCGGAAATGGTTCCCCCTCATG
ATGCTCCTTTGGAGCGGACTCACCATGGTGACTGCCTCGGTCCACAATCCTCAGTCCATCATGGTCATTCGATTT
TTCCAGGGCATCTTTGAGGCCTCGACATTTGTCGGAACTCATTATGTCCTTGGCGCATGGTATACGGAGCGTGAG
CTCGGTAAACGCAGCGGCATCTTTAGCTCGTCAGGTCTGGCAGGCACCATGATTGGAGGCTTTATACAGACTGGC
ATCTACAATAGTCTAAATGGGCGCCTAGGCCTTAGTGGGTGGCGCTGGTTGTTTATTGTCGACGGGCTCTTGGGG
CTCCCAGTGGCCCTCTTTGGTCTCTTGTTTTTCCCAGATACCCCTCACACCACTGCTGTTGGCTACCTGACAGAC
GACGAGAAGAAGCTGGCGCTCTCTCGCGTGCCGCCAGCTGCCAGCCCGTCTCCGATTACCTTGAAGTTTCTGAAA
AAGGTTCTAACCTCGTGGTACTGGTGGGGATTCGTTGGCTTGTGGATAATTGCGGGAGAGGCTGAATCTTTTCCC
TCCAACTCACTGCTGGCCCTCTACATGCAACAACACCCAGTCAATAAATACAGCATTGCCCAAATCAACAACTAT
CCCACCGGCGTTTCGGCCGTTGGAATTGTCTCGACTCTCTTTTGGGCAGCCTTGACTGACCTTTTGGGTGGCATG
CGATATCTTGTGGGATATTACATAGGCCTGACTGGGATTGCAACCTCCATCATGATTCTCTTGGCGTCACATCAT
CCCACAGGCCCGTCGTCGACATCAGTCGTCTTTGCTGCATACTACTGGTCTGGAACGGTGTATGCCTGTCAGGCC
ACGTTTTTCGCCTGGTGCAACGATGCCATGCGCAGTGAAGAGGCTGCTTTTCGTGGTGTTGTTCTCGCCGGTATG
AACATGGGAAGCAACGCCGTCAATGCCTGGTGGAGCATTGTCTTTTATGGTGCTTCCATGGCTCCATGGTTTACA
CGTGGTTTGTGGGCCATGATGGCTTGTTGTCTGGTATTGGTTACATGGTGCGCAGCACTGGCACACATTGTACAA
GTTAAAAACACTTCCAAGCAGGCCTCTTCGCTACGTCTTGATGAGGGTCTTGGGCTGTTGTAG
Gene >OphauB2|703
ATGACACGCTCACGTATGGCGAGGTGCCTTCACGTGTCATACCAGCCGGGCGAGCGGATCCTGATACAAAAGCTC
GATTTTTTCATCCTGACTTTTTGCTGCTTGAGCTTCCTCATTGGTAATGTGAGCTTTGCACTTGGACACATGGCA
ATACTGGACAGTATGCGATTTCTCATATGGCGGGCAGACAGACACTAAGAAGGGTACGCATGTATAGCTTGACCA
TTCCAATCTTGTCAATGCCTATGTATCGGGCATGCGAGAGGAGCTTGGGTTTGTCGGCAACCAGCTCACCGAAAT
CAATACTTGCTTTACTGTGGGGTATGCCATGTCTTGCTTTCGGCTTTGCGGAGGCTCTCGTGGCCTCTGACAGCC
GCATCGTGCATACATAGCCGATAGGGACTGACGAGGTGGCAGCTACGTCCTTGGTCAGATCCCATCCAACCTCTC
CCTTCACTATGTCAGACCTCGGAAATGGTTCCCCCTCATGATGCTCCTTTGGAGCGGACTCACCATGGTGACTGC
CTCGGTCCACAATCCTCAGTCCATCATGGTCATTCGATTTTTCCAGGGCATCTTTGAGGCCTCGACATTTGTCGG
AACTCATTATGTCCTTGGCGCATGGTATACGGAGCGTGAGCTCGGTAAACGCAGCGGCATCTTTAGCTCGTCAGG
TCTGGCAGGCACCATGATTGGAGGCTTTATACAGACTGGCATCTACAATAGTCTAAATGGGCGCCTAGGCCTTAG
TGGGTGGCGCTGGTTGTTTATTGTCGACGGGCTCTTGGGGCTCCCAGTGGCCCTCTTTGGTCTCTTGTTTTTCCC
AGATACCCCTCACACCACTGCTGTTGGCTACCTGACAGACGACGAGAAGAAGCTGGCGCTCTCTCGCGTGCCGCC
AGCTGCCAGCCCGTCTCCGATTACCTTGAAGTTTCTGAAAAAGGTTCTAACCTCGTGGTACTGGTGGGGATTCGT
TGGCTTGTGGATAATTGCGGGAGAGGCTGAATCTTTTCCCTCCAACTCACTGCTGGCCCTCTACATGCAACAACA
CCCAGTCAATAAATACAGCATTGCCCAAATCAACAACTATCCCACCGGCGTTTCGGCCGTTGGAATTGTCTCGAC
TCTCTTTTGGGCAGCCTTGACTGACCTTTTGGGTGGCATGCGATATCTTGTGGGATATTACATAGGCCTGACTGG
GATTGCAACCTCCATCATGATTCTCTTGGCGTCACATCATCCCACAGGCCCGTCGTCGACATCAGTCGTCTTTGC
TGCATACTACTGGTCTGGAACGGTGTATGCCTGTCAGGCCACGTTTTTCGCCTGGTGCAACGATGCCATGCGCAG
TGAAGAGGCTGCTTTTCGTGGTGTTGTTCTCGCCGGTATGAACATGGGAAGCAACGCCGTCAATGCCTGGTGGAG
CATTGTCTTTTATGGTGCTTCCATGGCTCCATGGTTTACAGTATGTTTTGCCAATGCCAAAGACCCCTATTGCCT
ACTCCTTTTACCAAGCCAAGGTGTATTACTAAGTAGTGGTTGCAGCGTGGTTTGTGGGCCATGATGGCTTGTTGT
CTGGTATTGGTTACATGGTGCGCAGCACTGGCACACATTGTACAAGTTAAAAACACTTCCAAGCAGGCCTCTTCG
CTACGTCTTGATGAGGGTCTTGGGCTGTTGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail