Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7029
Gene name
LocationContig_7:201503..202514
Strand+
Gene length (bp)1011
Transcript length (bp)1011
Coding sequence length (bp)1011
Protein length (aa) 337

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13621 Cupin_8 Cupin-like domain 5.6E-27 148 336
PF08007 JmjC_2 JmjC domain 9.2E-05 250 322

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54FG7|JMJCF_DICDI JmjC domain-containing protein F OS=Dictyostelium discoideum GN=jcdF PE=3 SV=1 177 319 2.0E-14
sp|Q8RWR1|JMJ30_ARATH Putative lysine-specific demethylase JMJD5 OS=Arabidopsis thaliana GN=JMJD5 PE=2 SV=1 162 335 1.0E-10
sp|B5XF11|KDM8_SALSA Lysine-specific demethylase 8 OS=Salmo salar GN=kdm8 PE=2 SV=1 177 335 3.0E-09
sp|P0C872|JMJD7_MOUSE JmjC domain-containing protein 7 OS=Mus musculus GN=Jmjd7 PE=1 SV=1 185 335 5.0E-09
sp|A8E534|KDM8_DANRE Lysine-specific demethylase 8 OS=Danio rerio GN=kdm8 PE=2 SV=1 177 334 9.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54FG7|JMJCF_DICDI JmjC domain-containing protein F OS=Dictyostelium discoideum GN=jcdF PE=3 SV=1 177 319 2.0E-14
sp|Q8RWR1|JMJ30_ARATH Putative lysine-specific demethylase JMJD5 OS=Arabidopsis thaliana GN=JMJD5 PE=2 SV=1 162 335 1.0E-10
sp|B5XF11|KDM8_SALSA Lysine-specific demethylase 8 OS=Salmo salar GN=kdm8 PE=2 SV=1 177 335 3.0E-09
sp|P0C872|JMJD7_MOUSE JmjC domain-containing protein 7 OS=Mus musculus GN=Jmjd7 PE=1 SV=1 185 335 5.0E-09
sp|A8E534|KDM8_DANRE Lysine-specific demethylase 8 OS=Danio rerio GN=kdm8 PE=2 SV=1 177 334 9.0E-09
sp|B2GUS6|KDM8_XENTR Lysine-specific demethylase 8 OS=Xenopus tropicalis GN=kdm8 PE=2 SV=1 177 334 9.0E-09
sp|P0C870|JMJD7_HUMAN JmjC domain-containing protein 7 OS=Homo sapiens GN=JMJD7 PE=1 SV=1 124 335 9.0E-09
sp|Q55DF5|JMJCD_DICDI JmjC domain-containing protein D OS=Dictyostelium discoideum GN=jcdD PE=3 SV=1 177 320 6.0E-08
sp|Q8BLR9|HIF1N_MOUSE Hypoxia-inducible factor 1-alpha inhibitor OS=Mus musculus GN=Hif1an PE=1 SV=2 198 336 1.0E-07
sp|Q9NWT6|HIF1N_HUMAN Hypoxia-inducible factor 1-alpha inhibitor OS=Homo sapiens GN=HIF1AN PE=1 SV=2 198 336 2.0E-07
sp|P59723|HIF1N_DANRE Hypoxia-inducible factor 1-alpha inhibitor OS=Danio rerio GN=hif1an PE=2 SV=2 198 336 3.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7029
MKRLPLGFSIRQWPRRLSGTFRLSAPSRVNLATPWSNTQADVEAFRQNALIPNKPLLFQRETGSPSQHLQASEKW
FALDTTGTRVLSPYITDASLETLFPYELVQQSQDILRAIASFRDWLLESVSITNTVLAGIVQAALDEAQAFTQLN
APLSLLIKALEFNTNQRAKNQPTLELYVAQAGIENLPQFLKDDLKVPWLLQEAGKGDVYGSSIWLGTEPTYSPLH
RDPNPNLFCQLCGDKSVRLMPPTVGNHLYFLVQAAIQQQGNSRIRSTEMMEGKERTVLHEAVWNSNHYPVEMHQA
NLGPGDALFIPNGWWHSVKSAKSDGQLNGSVNWWFR*
Coding >OphauB2|7029
ATGAAGAGGCTCCCATTGGGATTCAGCATCCGGCAATGGCCGAGGCGTCTCTCAGGCACCTTCAGGCTCAGCGCA
CCGTCACGAGTTAACTTGGCCACACCGTGGTCCAATACGCAGGCAGACGTTGAAGCTTTTCGACAGAATGCTCTG
ATTCCCAACAAACCTCTGCTGTTCCAGAGAGAAACAGGATCTCCGAGTCAGCATCTCCAGGCCTCAGAAAAGTGG
TTTGCTCTAGATACTACCGGCACGCGTGTTCTGTCTCCCTATATAACAGATGCTTCGCTTGAAACATTGTTTCCG
TACGAATTGGTCCAGCAATCACAGGATATATTGAGGGCTATTGCCAGCTTTCGAGACTGGCTCTTGGAATCTGTC
TCCATCACCAATACGGTTCTAGCAGGCATCGTGCAAGCAGCCCTCGATGAAGCCCAAGCCTTTACTCAACTGAAT
GCCCCGCTGAGTCTCCTTATTAAGGCCCTTGAATTCAACACGAATCAAAGGGCCAAGAACCAGCCCACATTGGAG
CTATACGTAGCTCAAGCTGGGATTGAAAACTTGCCTCAGTTTCTAAAAGACGACCTCAAAGTACCTTGGCTGTTG
CAAGAAGCTGGAAAAGGCGACGTGTACGGCTCTTCGATCTGGCTTGGTACTGAGCCGACCTACTCGCCCCTCCAT
AGAGATCCGAACCCAAATCTCTTTTGCCAATTATGTGGCGACAAAAGCGTCAGGCTTATGCCGCCGACAGTGGGA
AATCATTTGTACTTTCTGGTGCAGGCAGCCATTCAACAGCAGGGAAACAGCCGCATCCGCTCCACAGAGATGATG
GAGGGCAAGGAGAGAACAGTGCTACACGAGGCCGTTTGGAATAGCAATCACTACCCAGTCGAGATGCACCAAGCA
AATCTAGGCCCTGGAGACGCTCTGTTCATTCCCAATGGGTGGTGGCACTCGGTAAAGAGCGCCAAATCTGACGGT
CAGCTCAATGGTTCCGTTAACTGGTGGTTTCGATGA
Transcript >OphauB2|7029
ATGAAGAGGCTCCCATTGGGATTCAGCATCCGGCAATGGCCGAGGCGTCTCTCAGGCACCTTCAGGCTCAGCGCA
CCGTCACGAGTTAACTTGGCCACACCGTGGTCCAATACGCAGGCAGACGTTGAAGCTTTTCGACAGAATGCTCTG
ATTCCCAACAAACCTCTGCTGTTCCAGAGAGAAACAGGATCTCCGAGTCAGCATCTCCAGGCCTCAGAAAAGTGG
TTTGCTCTAGATACTACCGGCACGCGTGTTCTGTCTCCCTATATAACAGATGCTTCGCTTGAAACATTGTTTCCG
TACGAATTGGTCCAGCAATCACAGGATATATTGAGGGCTATTGCCAGCTTTCGAGACTGGCTCTTGGAATCTGTC
TCCATCACCAATACGGTTCTAGCAGGCATCGTGCAAGCAGCCCTCGATGAAGCCCAAGCCTTTACTCAACTGAAT
GCCCCGCTGAGTCTCCTTATTAAGGCCCTTGAATTCAACACGAATCAAAGGGCCAAGAACCAGCCCACATTGGAG
CTATACGTAGCTCAAGCTGGGATTGAAAACTTGCCTCAGTTTCTAAAAGACGACCTCAAAGTACCTTGGCTGTTG
CAAGAAGCTGGAAAAGGCGACGTGTACGGCTCTTCGATCTGGCTTGGTACTGAGCCGACCTACTCGCCCCTCCAT
AGAGATCCGAACCCAAATCTCTTTTGCCAATTATGTGGCGACAAAAGCGTCAGGCTTATGCCGCCGACAGTGGGA
AATCATTTGTACTTTCTGGTGCAGGCAGCCATTCAACAGCAGGGAAACAGCCGCATCCGCTCCACAGAGATGATG
GAGGGCAAGGAGAGAACAGTGCTACACGAGGCCGTTTGGAATAGCAATCACTACCCAGTCGAGATGCACCAAGCA
AATCTAGGCCCTGGAGACGCTCTGTTCATTCCCAATGGGTGGTGGCACTCGGTAAAGAGCGCCAAATCTGACGGT
CAGCTCAATGGTTCCGTTAACTGGTGGTTTCGATGA
Gene >OphauB2|7029
ATGAAGAGGCTCCCATTGGGATTCAGCATCCGGCAATGGCCGAGGCGTCTCTCAGGCACCTTCAGGCTCAGCGCA
CCGTCACGAGTTAACTTGGCCACACCGTGGTCCAATACGCAGGCAGACGTTGAAGCTTTTCGACAGAATGCTCTG
ATTCCCAACAAACCTCTGCTGTTCCAGAGAGAAACAGGATCTCCGAGTCAGCATCTCCAGGCCTCAGAAAAGTGG
TTTGCTCTAGATACTACCGGCACGCGTGTTCTGTCTCCCTATATAACAGATGCTTCGCTTGAAACATTGTTTCCG
TACGAATTGGTCCAGCAATCACAGGATATATTGAGGGCTATTGCCAGCTTTCGAGACTGGCTCTTGGAATCTGTC
TCCATCACCAATACGGTTCTAGCAGGCATCGTGCAAGCAGCCCTCGATGAAGCCCAAGCCTTTACTCAACTGAAT
GCCCCGCTGAGTCTCCTTATTAAGGCCCTTGAATTCAACACGAATCAAAGGGCCAAGAACCAGCCCACATTGGAG
CTATACGTAGCTCAAGCTGGGATTGAAAACTTGCCTCAGTTTCTAAAAGACGACCTCAAAGTACCTTGGCTGTTG
CAAGAAGCTGGAAAAGGCGACGTGTACGGCTCTTCGATCTGGCTTGGTACTGAGCCGACCTACTCGCCCCTCCAT
AGAGATCCGAACCCAAATCTCTTTTGCCAATTATGTGGCGACAAAAGCGTCAGGCTTATGCCGCCGACAGTGGGA
AATCATTTGTACTTTCTGGTGCAGGCAGCCATTCAACAGCAGGGAAACAGCCGCATCCGCTCCACAGAGATGATG
GAGGGCAAGGAGAGAACAGTGCTACACGAGGCCGTTTGGAATAGCAATCACTACCCAGTCGAGATGCACCAAGCA
AATCTAGGCCCTGGAGACGCTCTGTTCATTCCCAATGGGTGGTGGCACTCGGTAAAGAGCGCCAAATCTGACGGT
CAGCTCAATGGTTCCGTTAACTGGTGGTTTCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail