Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7026
Gene name
LocationContig_7:192830..196843
Strand+
Gene length (bp)4013
Transcript length (bp)3321
Coding sequence length (bp)3321
Protein length (aa) 1107

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13423 UCH_1 Ubiquitin carboxyl-terminal hydrolase 2.6E-63 489 679
PF13423 UCH_1 Ubiquitin carboxyl-terminal hydrolase 2.6E-15 679 762
PF00929 RNase_T Exonuclease 5.1E-25 838 1011
PF00443 UCH Ubiquitin carboxyl-terminal hydrolase 1.9E-05 496 769

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0UPL5|PAN2_PHANO PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAN2 PE=3 SV=1 1 1091 0.0E+00
sp|Q2GSV2|PAN2_CHAGB PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAN2 PE=3 SV=2 1 1064 0.0E+00
sp|P0CQ09|PAN2_CRYNB PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAN2 PE=3 SV=1 27 1106 0.0E+00
sp|P0CQ08|PAN2_CRYNJ PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAN2 PE=3 SV=1 27 1106 0.0E+00
sp|Q09798|PAN2_SCHPO PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pan2 PE=3 SV=2 26 1042 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0UPL5|PAN2_PHANO PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAN2 PE=3 SV=1 1 1091 0.0E+00
sp|Q2GSV2|PAN2_CHAGB PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAN2 PE=3 SV=2 1 1064 0.0E+00
sp|P0CQ09|PAN2_CRYNB PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAN2 PE=3 SV=1 27 1106 0.0E+00
sp|P0CQ08|PAN2_CRYNJ PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAN2 PE=3 SV=1 27 1106 0.0E+00
sp|Q09798|PAN2_SCHPO PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pan2 PE=3 SV=2 26 1042 0.0E+00
sp|A2QW83|PAN2_ASPNC PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pan2 PE=3 SV=1 1 1045 0.0E+00
sp|A4RF51|PAN2_MAGO7 PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAN2 PE=3 SV=3 1 1085 0.0E+00
sp|Q1E873|PAN2_COCIM PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Coccidioides immitis (strain RS) GN=PAN2 PE=3 SV=2 1 1049 0.0E+00
sp|Q0CJU7|PAN2_ASPTN PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pan2 PE=3 SV=1 1 1097 0.0E+00
sp|Q2ULU6|PAN2_ASPOR PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pan2 PE=3 SV=1 1 1106 0.0E+00
sp|A1DFN6|PAN2_NEOFI PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pan2 PE=3 SV=1 1 1075 0.0E+00
sp|Q5BBL5|PAN2_EMENI PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pan2 PE=3 SV=1 1 1075 0.0E+00
sp|A1CEK7|PAN2_ASPCL PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pan2 PE=3 SV=1 1 1075 0.0E+00
sp|P0C581|PAN2_NEUCR PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pan2 PE=1 SV=2 4 1099 0.0E+00
sp|Q4WHP6|PAN2_ASPFU PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pan2 PE=3 SV=1 1 1075 0.0E+00
sp|Q6BZ78|PAN2_DEBHA PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAN2 PE=3 SV=2 1 1042 3.0E-168
sp|A5DAD0|PAN2_PICGU PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAN2 PE=3 SV=3 1 1042 2.0E-165
sp|Q6CMN5|PAN2_KLULA PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAN2 PE=3 SV=1 26 1042 4.0E-161
sp|Q754X1|PAN2_ASHGO PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAN2 PE=3 SV=2 27 1042 2.0E-151
sp|Q6C462|PAN2_YARLI PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAN2 PE=3 SV=2 1 1043 2.0E-151
sp|P53010|PAN2_YEAST PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAN2 PE=1 SV=1 26 1043 3.0E-133
sp|Q6FS70|PAN2_CANGA PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAN2 PE=3 SV=1 26 1042 2.0E-121
sp|Q6IE70|PAN2_RAT PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Rattus norvegicus GN=Pan2 PE=2 SV=1 1 678 2.0E-78
sp|A3LRV8|PAN2_PICST PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAN2 PE=3 SV=2 1 645 3.0E-78
sp|Q8BGF7|PAN2_MOUSE PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Mus musculus GN=Pan2 PE=1 SV=1 1 678 7.0E-78
sp|Q6IE70|PAN2_RAT PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Rattus norvegicus GN=Pan2 PE=2 SV=1 711 1056 2.0E-76
sp|Q504Q3|PAN2_HUMAN PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Homo sapiens GN=PAN2 PE=1 SV=3 711 1043 2.0E-76
sp|Q504Q3|PAN2_HUMAN PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Homo sapiens GN=PAN2 PE=1 SV=3 1 678 8.0E-76
sp|Q8BGF7|PAN2_MOUSE PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Mus musculus GN=Pan2 PE=1 SV=1 713 1043 2.0E-75
sp|Q5F450|PAN2_CHICK PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Gallus gallus GN=PAN2 PE=2 SV=1 680 1049 3.0E-75
sp|Q5APK0|PAN2_CANAL PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAN2 PE=3 SV=1 1 645 4.0E-73
sp|Q5F450|PAN2_CHICK PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Gallus gallus GN=PAN2 PE=2 SV=1 18 678 1.0E-72
sp|A5E1W0|PAN2_LODEL PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAN2 PE=3 SV=1 24 647 1.0E-68
sp|A3LRV8|PAN2_PICST PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAN2 PE=3 SV=2 753 1043 3.0E-65
sp|A5E1W0|PAN2_LODEL PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAN2 PE=3 SV=1 716 1043 5.0E-63
sp|Q5APK0|PAN2_CANAL PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAN2 PE=3 SV=1 716 1043 2.0E-60
sp|P53015|YPO4_CAEEL Uncharacterized protein F31E3.4 OS=Caenorhabditis elegans GN=F31E3.4 PE=4 SV=1 752 1031 3.0E-39
sp|P53015|YPO4_CAEEL Uncharacterized protein F31E3.4 OS=Caenorhabditis elegans GN=F31E3.4 PE=4 SV=1 26 547 6.0E-19
sp|Q9CZI9|AEN_MOUSE Apoptosis-enhancing nuclease OS=Mus musculus GN=Aen PE=2 SV=1 828 1012 2.0E-14
sp|Q2T9U5|REXON_BOVIN Putative RNA exonuclease NEF-sp OS=Bos taurus PE=2 SV=1 870 1031 4.0E-13
sp|Q96IC2|REXON_HUMAN Putative RNA exonuclease NEF-sp OS=Homo sapiens GN=44M2.3 PE=2 SV=1 870 1036 3.0E-12
sp|A1A5R7|REXON_RAT Putative RNA exonuclease NEF-sp OS=Rattus norvegicus PE=2 SV=1 870 1017 5.0E-12
sp|Q8WTP8|AEN_HUMAN Apoptosis-enhancing nuclease OS=Homo sapiens GN=AEN PE=1 SV=2 827 1012 6.0E-12
sp|Q5REE2|AEN_PONAB Apoptosis-enhancing nuclease OS=Pongo abelii GN=AEN PE=2 SV=1 827 1012 1.0E-11
sp|Q757I9|REXO4_ASHGO RNA exonuclease 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=REX4 PE=3 SV=1 838 1018 1.0E-10
sp|Q4PER6|REXO4_USTMA RNA exonuclease 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=REX4 PE=3 SV=1 826 1048 3.0E-10
sp|Q9GZR2|REXO4_HUMAN RNA exonuclease 4 OS=Homo sapiens GN=REXO4 PE=1 SV=2 871 1029 1.0E-09
sp|Q5A3Q0|REXO4_CANAL RNA exonuclease 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=REX4 PE=3 SV=1 813 1014 2.0E-09
sp|P0CQ44|REXO4_CRYNJ RNA exonuclease 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=REX4 PE=3 SV=1 834 1038 3.0E-08
sp|P0CQ45|REXO4_CRYNB RNA exonuclease 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=REX4 PE=3 SV=1 834 1038 3.0E-08
sp|Q91560|REXO4_XENLA RNA exonuclease 4 OS=Xenopus laevis GN=rexo4 PE=2 SV=2 838 1011 3.0E-08
sp|Q2YDK1|I20L2_BOVIN Interferon-stimulated 20 kDa exonuclease-like 2 OS=Bos taurus GN=ISG20L2 PE=2 SV=1 834 1012 5.0E-08
sp|Q4IEV5|REXO4_GIBZE RNA exonuclease 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=REX4 PE=3 SV=1 869 1014 6.0E-08
sp|Q6BIK6|REXO4_DEBHA RNA exonuclease 4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=REX4 PE=3 SV=2 828 1020 9.0E-08
sp|Q9H9L3|I20L2_HUMAN Interferon-stimulated 20 kDa exonuclease-like 2 OS=Homo sapiens GN=ISG20L2 PE=1 SV=1 834 1012 1.0E-07
sp|Q08237|REXO4_YEAST RNA exonuclease 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REX4 PE=1 SV=1 838 1013 2.0E-07
sp|Q8RXK2|SDN3_ARATH Small RNA degrading nuclease 3 OS=Arabidopsis thaliana GN=SDN3 PE=1 SV=1 869 1010 2.0E-07
sp|Q6CMT3|REXO4_KLULA RNA exonuclease 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=REX4 PE=3 SV=1 833 1018 4.0E-07
sp|O94375|REXO4_SCHPO RNA exonuclease 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rex4 PE=3 SV=1 870 1013 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004843 cysteine-type deubiquitinase activity Yes
GO:0016579 protein deubiquitination Yes
GO:0006807 nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008233 peptidase activity No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0006508 proteolysis No
GO:0070646 protein modification by small protein removal No
GO:0140096 catalytic activity, acting on a protein No
GO:0036211 protein modification process No
GO:0019783 ubiquitin-like protein peptidase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0101005 deubiquitinase activity No
GO:0043412 macromolecule modification No
GO:0008234 cysteine-type peptidase activity No
GO:0008152 metabolic process No
GO:0070647 protein modification by small protein conjugation or removal No
GO:0044238 primary metabolic process No
GO:0019538 protein metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4736
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|113
Ophiocordyceps australis map64 (Brazil) OphauB2|7026 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01141
Ophiocordyceps camponoti-rufipedis Ophun1|5705
Ophiocordyceps kimflemingae Ophio5|1746
Ophiocordyceps subramaniannii Hirsu2|9998

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7026
MDGDWDEVSRIPFPPPGGVHSMPSPVTTMTFDTSHELLWTGNEFGRVSSFISPDLQKYTSFKAHVSSDGPVRQIL
VNDKGVIALGARDLHMALRKGPPIWHLRHDDMTDMRCMGFTSKGTTEVLVAGLQDKLLLVDLNKGEVVKQLKTEH
HYSIIKSGRYICAATRTGSVHLLDPVSLSRIRSWNAHSALINDMDTQHDFIVTCGYSLRQGQTYMLDPFLNVFDI
KKMTSMPPIPFPAGAAYVRMHPRMQTTSIVVSQVGQMHVIDLMNPNTSNVRQANVLTYLSMFEIAPSGEAIALTD
PECFIHLWGSPTKLHFVDLATPLEFATAVEPRHSIEWLADTPLNTIGLPYYRDTLLSAWPDLVCDVGAPPPRMDA
PFLSGLKAAEFGLYGRNSRGLRRNQAEDTRNGGKMAVSGLKAPKFLSEKARELAKDESKNLEERTDDLASPTVDV
DLVSKRSEVPVMYRNVEIKYSKFGVDDFDFGYYNKTQYSGLEIHISNSYANSLLQIMKFTPLVRNLALEHAATAC
VSDSCLLCELGFLFDMLQKADGSICQATNLLRTLSHHPQAAPLGLLEEDAHSSSLNVMLQGLTRFMLDKIVQDYK
SMAPSPLAMEHVLATSATSSIRCMSCRSEYTRPGSTYVNDLLYPPQQTSIRSNKSPNITFSQVLKSSIERETTSK
GWCSWLPEEVGVIVDQGQFYCYEGEDLKLHLQRGMHNIIVYSLIGMAVNIESGQAQKPHLVAMVNVALSQPQTPS
QSQWHLFNDFLVRPISTEDALAFNISWKVPSVVAFQMKEANNKINDDWKLKLDTSILYRDFGPTTPPEGKTYQLL
DPDGERPGPDSIVALDTEFVAVRQPEIEMNSDGERETIRPIVYALARVSVVRGQGEHEGRPFVDDYIAIKEPIVD
YLTSYSGIRQGDLDPRTSNHSLVSLKMAYKKLWLLVNLGCRFLGHGLRQDFRVINIHVPRAQVIDTIDLFFLRSR
LRKLSLAFLAWYLLKEDIQMETHDSIEDARTALKLYRKYLEFQDAGVWDTMLQDVYRAGREVNFRPPKRDESAAA
GGVGLQGTESPPLSGDGAVTLPSTPVTKPAVLAGAATAFGGGSWTPGKSGGPSPLR*
Coding >OphauB2|7026
ATGGATGGAGACTGGGACGAGGTCTCCCGGATACCTTTTCCGCCTCCGGGGGGCGTCCACTCGATGCCATCGCCA
GTGACGACAATGACGTTTGATACGTCGCACGAGCTTCTCTGGACTGGGAACGAATTTGGTCGCGTCAGCTCCTTC
ATCAGTCCAGACCTGCAGAAATACACGTCTTTCAAGGCACATGTCTCTTCGGACGGGCCGGTTCGCCAGATATTA
GTCAACGACAAGGGTGTCATTGCTCTAGGAGCAAGAGATCTGCATATGGCACTGCGAAAAGGGCCTCCCATATGG
CACCTGAGGCACGACGATATGACGGACATGAGATGCATGGGCTTTACATCCAAAGGCACCACAGAAGTGCTTGTA
GCCGGCTTACAAGATAAGTTACTGCTTGTCGACCTTAATAAGGGAGAGGTGGTCAAGCAGCTCAAGACAGAGCAT
CATTACTCCATCATCAAGAGTGGCCGGTACATATGCGCCGCCACTCGAACCGGATCTGTTCATCTCTTGGATCCT
GTCAGCTTGAGCCGCATTCGATCGTGGAACGCCCACTCGGCCTTGATCAACGACATGGATACGCAACACGACTTT
ATTGTCACATGTGGCTACTCTCTGCGCCAGGGCCAGACGTACATGCTCGATCCATTCCTAAACGTCTTTGACATC
AAGAAAATGACATCGATGCCTCCAATTCCATTTCCCGCTGGCGCTGCCTATGTTCGCATGCATCCCAGAATGCAG
ACCACTAGCATAGTCGTCTCGCAGGTTGGACAGATGCATGTTATCGATCTTATGAACCCCAATACCAGTAATGTC
CGTCAGGCAAATGTGCTTACCTACCTCAGCATGTTTGAGATTGCTCCCTCGGGAGAGGCTATAGCCCTCACTGAT
CCCGAATGTTTCATACATCTCTGGGGCTCGCCCACGAAGCTGCATTTTGTTGATCTTGCCACTCCCCTTGAATTT
GCCACGGCGGTCGAGCCACGGCATTCCATAGAATGGTTAGCAGATACTCCTCTCAACACCATTGGATTGCCATAC
TATAGAGACACTCTTTTGTCAGCCTGGCCAGATCTTGTTTGTGATGTTGGCGCTCCTCCACCCCGCATGGACGCT
CCATTCCTGAGCGGACTCAAGGCGGCCGAATTCGGCCTCTATGGAAGAAATAGTCGTGGTTTGCGAAGAAATCAG
GCCGAAGACACGCGGAACGGCGGGAAAATGGCAGTCTCTGGGCTCAAAGCTCCCAAATTCTTGAGCGAAAAGGCT
CGCGAACTTGCCAAAGACGAATCGAAGAACCTGGAAGAAAGGACAGACGACTTGGCAAGCCCCACGGTTGATGTT
GACCTTGTCAGCAAAAGGAGCGAAGTGCCCGTCATGTACCGCAATGTCGAAATCAAGTACAGCAAGTTTGGTGTC
GACGATTTTGATTTTGGATACTATAACAAGACGCAGTATTCTGGGTTGGAGATTCATATTTCCAATTCGTACGCC
AATTCGCTGCTACAGATTATGAAGTTTACGCCTCTGGTCCGCAATCTTGCTCTGGAACACGCTGCAACAGCCTGT
GTCAGCGACTCGTGCCTGCTTTGCGAACTGGGCTTCTTGTTTGACATGCTTCAAAAAGCAGACGGCTCAATATGC
CAAGCCACCAATCTGCTCAGGACCCTGAGTCATCATCCTCAAGCTGCTCCTCTGGGCCTTCTTGAAGAAGATGCG
CACAGCTCATCCTTGAATGTGATGCTACAAGGACTCACGCGTTTCATGCTGGACAAGATTGTACAGGACTACAAA
AGCATGGCCCCGTCCCCTCTGGCAATGGAACACGTTCTTGCAACTTCGGCCACCAGCTCTATCCGCTGCATGAGC
TGCAGGTCCGAATACACTCGGCCAGGGTCAACCTATGTCAATGATTTGCTCTACCCTCCACAGCAGACTTCCATT
CGTAGCAACAAGTCACCAAACATTACCTTCTCTCAAGTATTGAAGAGTAGCATAGAGAGGGAGACGACGTCTAAG
GGCTGGTGCAGCTGGCTTCCGGAAGAGGTGGGCGTCATAGTAGACCAGGGGCAGTTCTATTGCTACGAAGGGGAA
GACCTGAAGCTGCATTTGCAACGGGGCATGCATAACATTATTGTTTACTCGCTTATTGGCATGGCGGTCAATATT
GAGAGCGGCCAGGCTCAGAAGCCGCATCTTGTGGCCATGGTCAACGTAGCACTTTCACAGCCACAGACTCCTAGT
CAGAGCCAGTGGCATCTTTTCAACGACTTTTTAGTCCGCCCCATTAGCACAGAGGACGCGCTAGCATTCAATATT
TCGTGGAAAGTCCCCTCAGTCGTTGCTTTCCAAATGAAGGAGGCCAATAACAAAATTAATGACGACTGGAAACTA
AAGCTCGACACTTCAATTCTCTATCGAGACTTTGGTCCTACGACACCGCCAGAGGGCAAAACATACCAGCTCTTG
GATCCTGACGGCGAGCGTCCGGGGCCTGACTCGATAGTGGCGCTTGACACTGAATTTGTTGCTGTTCGGCAGCCA
GAAATTGAGATGAATTCGGACGGCGAGCGCGAGACGATTCGACCCATAGTCTATGCTCTGGCACGAGTATCCGTG
GTTCGCGGCCAGGGAGAGCACGAGGGACGGCCATTTGTCGATGACTACATTGCCATCAAGGAACCCATTGTTGAT
TATCTCACGTCATATTCTGGCATTAGACAAGGCGATCTGGATCCTCGTACGTCGAACCACAGCCTCGTGTCACTC
AAGATGGCCTACAAGAAACTTTGGCTGCTAGTCAATCTGGGCTGCCGGTTTCTCGGCCATGGTCTGCGGCAGGAC
TTTCGCGTCATCAACATCCACGTGCCCCGCGCACAGGTGATTGATACTATTGATCTTTTCTTTTTGCGATCGCGG
CTGCGCAAGCTGTCACTTGCTTTCTTGGCGTGGTATCTCCTCAAGGAAGATATACAAATGGAGACGCACGACTCA
ATCGAGGACGCCCGCACCGCCCTCAAGTTATATCGCAAATACCTCGAATTTCAGGATGCCGGCGTCTGGGACACG
ATGCTGCAAGATGTCTACCGGGCAGGCAGAGAAGTCAATTTTCGGCCACCAAAGAGGGACGAGAGCGCTGCCGCC
GGTGGTGTTGGCTTGCAGGGAACAGAGTCACCGCCCTTGTCTGGCGATGGCGCCGTGACACTGCCATCGACGCCC
GTCACCAAGCCTGCAGTACTGGCTGGCGCCGCAACTGCGTTTGGTGGTGGTAGTTGGACTCCGGGAAAGAGTGGT
GGTCCCTCACCACTACGGTAG
Transcript >OphauB2|7026
ATGGATGGAGACTGGGACGAGGTCTCCCGGATACCTTTTCCGCCTCCGGGGGGCGTCCACTCGATGCCATCGCCA
GTGACGACAATGACGTTTGATACGTCGCACGAGCTTCTCTGGACTGGGAACGAATTTGGTCGCGTCAGCTCCTTC
ATCAGTCCAGACCTGCAGAAATACACGTCTTTCAAGGCACATGTCTCTTCGGACGGGCCGGTTCGCCAGATATTA
GTCAACGACAAGGGTGTCATTGCTCTAGGAGCAAGAGATCTGCATATGGCACTGCGAAAAGGGCCTCCCATATGG
CACCTGAGGCACGACGATATGACGGACATGAGATGCATGGGCTTTACATCCAAAGGCACCACAGAAGTGCTTGTA
GCCGGCTTACAAGATAAGTTACTGCTTGTCGACCTTAATAAGGGAGAGGTGGTCAAGCAGCTCAAGACAGAGCAT
CATTACTCCATCATCAAGAGTGGCCGGTACATATGCGCCGCCACTCGAACCGGATCTGTTCATCTCTTGGATCCT
GTCAGCTTGAGCCGCATTCGATCGTGGAACGCCCACTCGGCCTTGATCAACGACATGGATACGCAACACGACTTT
ATTGTCACATGTGGCTACTCTCTGCGCCAGGGCCAGACGTACATGCTCGATCCATTCCTAAACGTCTTTGACATC
AAGAAAATGACATCGATGCCTCCAATTCCATTTCCCGCTGGCGCTGCCTATGTTCGCATGCATCCCAGAATGCAG
ACCACTAGCATAGTCGTCTCGCAGGTTGGACAGATGCATGTTATCGATCTTATGAACCCCAATACCAGTAATGTC
CGTCAGGCAAATGTGCTTACCTACCTCAGCATGTTTGAGATTGCTCCCTCGGGAGAGGCTATAGCCCTCACTGAT
CCCGAATGTTTCATACATCTCTGGGGCTCGCCCACGAAGCTGCATTTTGTTGATCTTGCCACTCCCCTTGAATTT
GCCACGGCGGTCGAGCCACGGCATTCCATAGAATGGTTAGCAGATACTCCTCTCAACACCATTGGATTGCCATAC
TATAGAGACACTCTTTTGTCAGCCTGGCCAGATCTTGTTTGTGATGTTGGCGCTCCTCCACCCCGCATGGACGCT
CCATTCCTGAGCGGACTCAAGGCGGCCGAATTCGGCCTCTATGGAAGAAATAGTCGTGGTTTGCGAAGAAATCAG
GCCGAAGACACGCGGAACGGCGGGAAAATGGCAGTCTCTGGGCTCAAAGCTCCCAAATTCTTGAGCGAAAAGGCT
CGCGAACTTGCCAAAGACGAATCGAAGAACCTGGAAGAAAGGACAGACGACTTGGCAAGCCCCACGGTTGATGTT
GACCTTGTCAGCAAAAGGAGCGAAGTGCCCGTCATGTACCGCAATGTCGAAATCAAGTACAGCAAGTTTGGTGTC
GACGATTTTGATTTTGGATACTATAACAAGACGCAGTATTCTGGGTTGGAGATTCATATTTCCAATTCGTACGCC
AATTCGCTGCTACAGATTATGAAGTTTACGCCTCTGGTCCGCAATCTTGCTCTGGAACACGCTGCAACAGCCTGT
GTCAGCGACTCGTGCCTGCTTTGCGAACTGGGCTTCTTGTTTGACATGCTTCAAAAAGCAGACGGCTCAATATGC
CAAGCCACCAATCTGCTCAGGACCCTGAGTCATCATCCTCAAGCTGCTCCTCTGGGCCTTCTTGAAGAAGATGCG
CACAGCTCATCCTTGAATGTGATGCTACAAGGACTCACGCGTTTCATGCTGGACAAGATTGTACAGGACTACAAA
AGCATGGCCCCGTCCCCTCTGGCAATGGAACACGTTCTTGCAACTTCGGCCACCAGCTCTATCCGCTGCATGAGC
TGCAGGTCCGAATACACTCGGCCAGGGTCAACCTATGTCAATGATTTGCTCTACCCTCCACAGCAGACTTCCATT
CGTAGCAACAAGTCACCAAACATTACCTTCTCTCAAGTATTGAAGAGTAGCATAGAGAGGGAGACGACGTCTAAG
GGCTGGTGCAGCTGGCTTCCGGAAGAGGTGGGCGTCATAGTAGACCAGGGGCAGTTCTATTGCTACGAAGGGGAA
GACCTGAAGCTGCATTTGCAACGGGGCATGCATAACATTATTGTTTACTCGCTTATTGGCATGGCGGTCAATATT
GAGAGCGGCCAGGCTCAGAAGCCGCATCTTGTGGCCATGGTCAACGTAGCACTTTCACAGCCACAGACTCCTAGT
CAGAGCCAGTGGCATCTTTTCAACGACTTTTTAGTCCGCCCCATTAGCACAGAGGACGCGCTAGCATTCAATATT
TCGTGGAAAGTCCCCTCAGTCGTTGCTTTCCAAATGAAGGAGGCCAATAACAAAATTAATGACGACTGGAAACTA
AAGCTCGACACTTCAATTCTCTATCGAGACTTTGGTCCTACGACACCGCCAGAGGGCAAAACATACCAGCTCTTG
GATCCTGACGGCGAGCGTCCGGGGCCTGACTCGATAGTGGCGCTTGACACTGAATTTGTTGCTGTTCGGCAGCCA
GAAATTGAGATGAATTCGGACGGCGAGCGCGAGACGATTCGACCCATAGTCTATGCTCTGGCACGAGTATCCGTG
GTTCGCGGCCAGGGAGAGCACGAGGGACGGCCATTTGTCGATGACTACATTGCCATCAAGGAACCCATTGTTGAT
TATCTCACGTCATATTCTGGCATTAGACAAGGCGATCTGGATCCTCGTACGTCGAACCACAGCCTCGTGTCACTC
AAGATGGCCTACAAGAAACTTTGGCTGCTAGTCAATCTGGGCTGCCGGTTTCTCGGCCATGGTCTGCGGCAGGAC
TTTCGCGTCATCAACATCCACGTGCCCCGCGCACAGGTGATTGATACTATTGATCTTTTCTTTTTGCGATCGCGG
CTGCGCAAGCTGTCACTTGCTTTCTTGGCGTGGTATCTCCTCAAGGAAGATATACAAATGGAGACGCACGACTCA
ATCGAGGACGCCCGCACCGCCCTCAAGTTATATCGCAAATACCTCGAATTTCAGGATGCCGGCGTCTGGGACACG
ATGCTGCAAGATGTCTACCGGGCAGGCAGAGAAGTCAATTTTCGGCCACCAAAGAGGGACGAGAGCGCTGCCGCC
GGTGGTGTTGGCTTGCAGGGAACAGAGTCACCGCCCTTGTCTGGCGATGGCGCCGTGACACTGCCATCGACGCCC
GTCACCAAGCCTGCAGTACTGGCTGGCGCCGCAACTGCGTTTGGTGGTGGTAGTTGGACTCCGGGAAAGAGTGGT
GGTCCCTCACCACTACGGTAG
Gene >OphauB2|7026
ATGGATGGAGACTGGGACGAGGTGAGCCACTGGCTCTCGGATCCGGCCATGATTGATGCTTGATGGCTGACTGGG
CAGGTCTCCCGGATACCTTTTCCGCCTCCGGGGGGCGTCCACTCGATGCCATCGCCAGTGACGACAATGACGTTT
GATACGTCGCACGAGCTTCTCTGGACTGGGAACGAATTTGTACGTGGCATGATTTGGACTGTCGTCTCGACAATG
CCAAAGCTCTTACACTCTTGAACGGCTAGGGTCGCGTCAGCTCCTTCATCAGTCCAGACCTGCAGAAATACACGT
CTTTCAAGGCACATGTCTCTTCGGACGGGCCGGTTCGCCAGATATTAGTCAACGACAAGGGTGTCATTGCTCTAG
GAGCAAGAGATCTGCATATGGCACTGCGAAAAGGGCCTCCCATATGGCACCTGAGGTACGACATGCCAGCCAGGC
TGCCTCTTGCATCTCCCCCTACTAACTATGCTGGCCAAGGCACGACGATATGACGGACATGAGATGCATGGGCTT
TACATCCAAAGGCACCACAGAAGTGCTTGTAGCCGGCTTACAAGATAAGTTACTGCTTGTCGACCTTAATAAGGG
AGAGGTGGTCAAGCAGGTGAGCCTGTACCTCTATTCGCCCCGCTGGAGCCTCCCTACTCATGTAAAATGCAGCTC
AAGACAGAGCATCATTACTCCATCATCAAGAGTGGCCGGTACATATGCGCCGCCACTCGAACCGGATCTGTTCAT
CTCTTGGATCCTGTCAGCTTGAGCCGCATTCGATCGTGGAACGCCCACTCGGCCTTGATCAACGACATGGATACG
CAACACGACTTTATTGTCACATGTGGCTACTCTCTGCGCCAGGGCCAGACGTACATGCTCGATCCATTCCTAAAC
GTCTTTGACATCAAGAAAATGACATCGATGCCTCCAATTCCATTTCCCGCTGGCGCTGCCTATGTTCGCATGCAT
CCCAGAATGCAGACCACTAGCATAGTCGTCTCGCAGGTTGGACAGATGCATGTTATCGATCTTATGAACCCCAAT
ACCAGTAATGTCCGTCAGGCAAATGTGCTTACCTACCTCAGCATGTTTGAGATTGCTCCCTCGGGAGAGGCTATA
GCCCTCACTGATCCCGAATGTTTCATACATCTCTGGGGCTCGCCCACGAAGCTGCATTTTGTTGATCTTGCCACT
CCCCTTGAATTTGCCACGGCGGTCGAGCCACGGCATTCCATAGAATGGTTAGCAGATACGTGCGTGTGCTCGTCT
TTGCTGCTTCTTGGTCTCCTGCTGACCTGGGGCAGTCCTCTCAACACCATTGGATTGCCATACTATAGAGACACT
CTTTTGTCAGCCTGGCCAGATCTTGTTTGTGATGTTGGCGCTCCTCCACCCCGCATGGACGCTCCATTCCTGAGC
GGACTCAAGGCGGCCGAATTCGGCCTCTATGGAAGAAATAGTCGTGGTTTGCGAAGAAATCAGGCCGAAGACACG
CGGAACGGCGGGAAAATGGCAGTCTCTGGGCTCAAAGCTCCCAAATTCTTGAGCGAAAAGGCTCGCGAACTTGCC
AAAGACGAATCGAAGAACCTGGAAGAAAGGACAGACGACTTGGCAAGCCCCACGGTTGATGTTGACCTTGTCAGC
AAAAGGAGCGAAGTGCCCGTCATGTACCGCAATGTCGAAATCAAGTACAGCAAGTTTGGTGTCGACGATTTTGAT
TTTGGGTATGTAGGTCCAAAGTCTACGTGGACAAGGGCTTTTGCTCATCAGACACAGATACTATAACAAGACGCA
GTATTCTGGGTTGGAGATTCATATTTCCAATTCGTACGCCAATTCGCTGCTACAGATTATGAAGTTTACGCCTCT
GGTCCGCAATCTTGCTCTGGAACACGCTGCAACAGCCTGTGTCAGCGACTCGTGCCTGCTTTGCGAACTGGGCTT
CTTGTTTGACATGCTTCAAAAAGCAGACGGCTCAATATGCCAAGCCACCAATCTGCTCAGGACCCTGAGTCATCA
TCCTCAAGCTGCTCCTCTGGGCCTTCTTGAAGAAGATGCGCACAGCTCATCCTTGAATGTGATGCTACAAGGACT
CACGCGTTTCATGCTGGACAAGATTGTACAGGACTACAAAAGCATGGCCCCGTCCCCTCTGGCAATGGAACACGT
ACTCACTCTCCATCATGGTGCGTCTCGTTGACTGACCTCTGTTTGCTGACGCTGGACAGGTTCTTGCAACTTCGG
CCACCAGCTCTATCCGCTGCATGAGCTGCAGGTCCGAATACACTCGGCCAGGGTCAACCTATGTCAATGATTTGC
TCTACCCTCCACAGGTATGTTAGACATTCTGATAGCTTCTGTCCCAGTAGTCGCTCATGGTGTCGAGCAGCAGAC
TTCCATTCGTAGCAACAAGTCACCAAACATTACCTTCTCTCAAGTATTGAAGAGTAGCATAGAGAGGGAGACGAC
GTCTAAGGGCTGGTGCAGTAGGTGCCAGCGATACCAGACAATCGCAACGCGGAAAACAATACACAATATCCCCGC
TGTACTGATGCTCAATACTGCCATTACAAGTCTTGATCATCGCATGCTTTGGTCAAGTCCAGGCTGGCTTCCGGA
AGAGGTGGGCGTCATAGTAGACCAGGGGCAGTTCTATTGCTACGAAGGGGAAGACCTGAAGCTGCATTTGCAACG
GGGCATGCATAACATTATTGTTTACTCGCTTATTGGCATGGCGGTCAATATTGAGAGCGGCCAGGCTCAGAAGCC
GCATCTTGTGGCCATGGTCAACGGTAGGTTTTGCTTTTGGCCTTGGACAGGGCATCAATTGGCTGACTAGGTTTT
GTAGTAGCACTTTCACAGCCACAGACTCCTAGTCAGAGCCAGTGGCATCTTTTCAACGACTTTTTAGTCCGCCCC
ATTAGCACAGAGGACGCGCTAGCATTCAATATTTCGTGGAAAGTCCCCTCAGTCGTTGCTTTCCAAATGAAGGAG
GCCAATAACAAAATTAATGACGACTGGAAACTAAAGCTCGACACTTCAATTCTCTATCGAGACTTTGGGTAAGTA
AATGTGGCTTCAAAACAAGATGGCGCCGCCTCTGATTGACGTGATGCCGCAGTCCTACGACACCGCCAGAGGGCA
AAACATACCAGCTCTTGGATCCTGACGGCGAGCGTCCGGGGCCTGACTCGATAGTGGCGCTTGACACTGAATTTG
TTGCTGTTCGGCAGCCAGAAATTGAGATGAATTCGGACGGCGAGCGCGAGACGATTCGACCCATAGTCTATGCTC
TGGCACGAGTATCCGTGGTTCGCGGCCAGGGAGAGCACGAGGGACGGCCATTTGTCGATGACTACATTGCCATCA
AGGAACCCATTGTTGATTATCTCACGTCATATTCTGGCATTAGACAAGGCGATCTGGATCCTCGTACGTCGAACC
ACAGCCTCGTGTCACTCAAGATGGCCTACAAGAAACTTTGGCTGCTAGTCAATCTGGGCTGCCGGTTTCTCGGCC
ATGGTCTGCGGCAGGACTTTCGCGTCATCAACATCCACGTGCCCCGCGCACAGGTGATTGATACTATTGATCTTT
TCTTTTTGCGATCGCGGCTGCGCAAGCTGTCACTTGCTTTCTTGGCGTGGTATCTCCTCAAGGAAGATATACAAA
TGGAGACGCACGACTCAATCGAGGACGCCCGCACCGCCCTCAAGTTATATCGCAAATACCTCGAATTTCAGGATG
CCGGCGTCTGGGACACGATGCTGCAAGATGTCTACCGGGCAGGCAGAGAAGTCAATTTTCGGCCACCAAAGAGGG
ACGAGAGCGCTGCCGCCGGTGGTGTTGGCTTGCAGGGAACAGAGTCACCGCCCTTGTCTGGCGATGGCGCCGTGA
CACTGCCATCGACGCCCGTCACCAAGCCTGCAGTACTGGCTGGCGCCGCAACTGCGTTTGGTGGTGGTAGTTGGA
CTCCGGGAAAGAGTGGTGGTCCCTCACCACTACGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail