Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|702
Gene name
LocationContig_113:34359..35789
Strand-
Gene length (bp)1430
Transcript length (bp)1317
Coding sequence length (bp)1317
Protein length (aa) 439

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02469 Fasciclin Fasciclin domain 3.5E-15 113 245
PF02469 Fasciclin Fasciclin domain 1.9E-23 259 406

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8CFM6|STAB2_RAT Stabilin-2 (Fragment) OS=Rattus norvegicus GN=Stab2 PE=1 SV=1 140 333 2.0E-07
sp|Q8WWQ8|STAB2_HUMAN Stabilin-2 OS=Homo sapiens GN=STAB2 PE=1 SV=3 102 407 4.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|702
MKAALLVSSLIFAQAVPAPDGLPQQHPLGHVTQSRGQSKPGFWPSGLMSSTASNAVDQTVEAFESALEAAQRAAS
RLSHRLEAALDEHGDGGHKHRDWSGKTIYQQIHACKYTSRFAKLVDKYPDIVKLLNGTHRDSNITLFVPVDKAFE
DPHRGHKHYDDDDKEATEKLLRYHIGIGEYPALRILATNTLPTALHQERLGGDAQRLRTSVGLGGVEVNFYSKVV
AADFKASNGIIHGVNHILAPPPPVGLLLTAFPSHFSTLLLAYEKTDFVNFVHGVHMPGGSTVFAPSNGAFTRLGE
KTNSFLFNTGSGRKYLSALLKYHIVPNATLYSDAYYDHVDSETKPLASRREHYDLTTLLGDSRVSADVLRWAGFA
FFRINGFAHVSVRDGVAGNGVVQVLDSVLIPPHKHSATATDNDSDTAGSMDVEELKARLEPYL*
Coding >OphauB2|702
ATGAAGGCTGCACTTTTAGTATCTAGTCTGATCTTTGCGCAAGCCGTGCCAGCGCCAGACGGCTTGCCTCAGCAG
CATCCTCTTGGCCATGTTACGCAAAGCCGAGGACAGTCCAAGCCCGGCTTTTGGCCCAGCGGGCTCATGTCGAGC
ACCGCTAGCAATGCAGTAGACCAGACTGTGGAAGCCTTTGAATCCGCCCTCGAGGCCGCCCAACGCGCTGCTTCT
CGTCTCTCGCATCGACTGGAAGCCGCCTTGGATGAGCATGGCGACGGCGGACACAAGCATCGCGACTGGAGTGGC
AAGACGATTTACCAGCAGATCCACGCATGCAAGTACACGTCGCGCTTTGCAAAGCTGGTCGACAAGTATCCCGAC
ATTGTCAAGCTGCTCAACGGCACGCACCGAGACTCCAACATTACGCTCTTTGTGCCTGTTGACAAGGCTTTTGAA
GACCCGCATCGTGGCCATAAGCACTACGACGACGATGACAAGGAGGCGACTGAGAAGCTGCTCAGGTACCACATT
GGCATTGGGGAGTATCCCGCCCTCCGTATCCTAGCAACCAATACGCTGCCCACGGCGCTCCATCAAGAACGCTTG
GGAGGCGATGCCCAGCGGCTGCGCACGAGCGTCGGCCTCGGCGGTGTCGAAGTCAACTTTTATAGCAAAGTAGTT
GCCGCCGATTTTAAAGCCTCCAACGGCATCATTCATGGCGTCAACCACATCCTCGCACCGCCACCCCCCGTCGGA
CTCCTCCTGACCGCATTTCCCAGCCACTTTTCCACTCTGTTACTGGCCTACGAAAAGACGGATTTTGTAAACTTT
GTCCACGGCGTGCACATGCCTGGCGGAAGCACCGTCTTTGCCCCCAGCAACGGCGCCTTTACTCGCCTCGGCGAA
AAGACCAACTCATTCCTCTTCAACACGGGATCGGGGCGCAAGTACTTGAGCGCGCTGCTCAAATATCACATTGTG
CCCAATGCCACGCTCTATAGCGACGCCTACTACGACCACGTAGATAGCGAGACGAAGCCTCTGGCGTCTCGGCGG
GAGCACTACGACTTGACGACGCTGCTCGGAGACTCTCGCGTCAGCGCCGACGTGCTGAGGTGGGCAGGCTTTGCC
TTTTTCCGAATCAATGGCTTTGCCCACGTCAGTGTGCGTGATGGCGTGGCGGGGAATGGAGTCGTGCAAGTGCTC
GACTCGGTGCTGATTCCGCCTCACAAGCACTCGGCTACTGCGACTGACAACGACTCGGACACGGCGGGTAGCATG
GATGTCGAGGAGCTCAAAGCCAGGCTAGAACCCTATCTCTGA
Transcript >OphauB2|702
ATGAAGGCTGCACTTTTAGTATCTAGTCTGATCTTTGCGCAAGCCGTGCCAGCGCCAGACGGCTTGCCTCAGCAG
CATCCTCTTGGCCATGTTACGCAAAGCCGAGGACAGTCCAAGCCCGGCTTTTGGCCCAGCGGGCTCATGTCGAGC
ACCGCTAGCAATGCAGTAGACCAGACTGTGGAAGCCTTTGAATCCGCCCTCGAGGCCGCCCAACGCGCTGCTTCT
CGTCTCTCGCATCGACTGGAAGCCGCCTTGGATGAGCATGGCGACGGCGGACACAAGCATCGCGACTGGAGTGGC
AAGACGATTTACCAGCAGATCCACGCATGCAAGTACACGTCGCGCTTTGCAAAGCTGGTCGACAAGTATCCCGAC
ATTGTCAAGCTGCTCAACGGCACGCACCGAGACTCCAACATTACGCTCTTTGTGCCTGTTGACAAGGCTTTTGAA
GACCCGCATCGTGGCCATAAGCACTACGACGACGATGACAAGGAGGCGACTGAGAAGCTGCTCAGGTACCACATT
GGCATTGGGGAGTATCCCGCCCTCCGTATCCTAGCAACCAATACGCTGCCCACGGCGCTCCATCAAGAACGCTTG
GGAGGCGATGCCCAGCGGCTGCGCACGAGCGTCGGCCTCGGCGGTGTCGAAGTCAACTTTTATAGCAAAGTAGTT
GCCGCCGATTTTAAAGCCTCCAACGGCATCATTCATGGCGTCAACCACATCCTCGCACCGCCACCCCCCGTCGGA
CTCCTCCTGACCGCATTTCCCAGCCACTTTTCCACTCTGTTACTGGCCTACGAAAAGACGGATTTTGTAAACTTT
GTCCACGGCGTGCACATGCCTGGCGGAAGCACCGTCTTTGCCCCCAGCAACGGCGCCTTTACTCGCCTCGGCGAA
AAGACCAACTCATTCCTCTTCAACACGGGATCGGGGCGCAAGTACTTGAGCGCGCTGCTCAAATATCACATTGTG
CCCAATGCCACGCTCTATAGCGACGCCTACTACGACCACGTAGATAGCGAGACGAAGCCTCTGGCGTCTCGGCGG
GAGCACTACGACTTGACGACGCTGCTCGGAGACTCTCGCGTCAGCGCCGACGTGCTGAGGTGGGCAGGCTTTGCC
TTTTTCCGAATCAATGGCTTTGCCCACGTCAGTGTGCGTGATGGCGTGGCGGGGAATGGAGTCGTGCAAGTGCTC
GACTCGGTGCTGATTCCGCCTCACAAGCACTCGGCTACTGCGACTGACAACGACTCGGACACGGCGGGTAGCATG
GATGTCGAGGAGCTCAAAGCCAGGCTAGAACCCTATCTCTGA
Gene >OphauB2|702
ATGAAGGCTGCACTTTTAGTATCTAGTCTGATCTTTGCGCAAGCCGTGCCAGCGCCAGACGGCTTGCCTCAGCAG
CATCCTCTTGGCCATGTTACGCAAAGCCGAGGACAGTCCAAGCCCGGCTTTTGGCCCAGCGGGCTCATGTCGAGC
ACCGCTAGCAATGCAGTAGACCAGACTGTGGAAGCCTTTGAATCCGCCCTCGAGGCCGCCCAACGCGCTGCTTCT
CGTCTCTCGCATCGACTGGAAGCCGCCTTGGATGAGCATGGCGACGGCGGACACAAGCATCGCGACTGGAGTGGC
AAGACGATTTACCAGCAGATCCACGCATGCAAGTACACGTCGCGCTTTGCAAAGCTGGTCGACAAGTATCCCGAC
ATTGTCAAGCTGCTCAACGGCACGCACCGAGACTCCAACATTACGCTCTTTGTGCCTGTTGACAAGGCTTTTGAA
GACCCGCATCGTGGCCATAAGCACTACGACGACGATGACAAGGAGGCGACTGAGAAGCTGCTCAGGTACCACATT
GGCATTGGGGAGTATCCCGCCCTCCGTATCCTAGCAACCAATACGCTGCCCACGGCGCTCCATCAAGAACGCTTG
GGAGGCGATGCCCAGCGGCTGCGCACGAGCGTCGGCCTCGGCGGTGTCGAAGTCAACTTTTATAGCAAAGTAGTT
GCCGCCGATTTTGTATGTGCCCTCACGACTAACCATGTCTGACCGTTTTTTTTTTTTTTTGTTTTTTTTTCTGGT
TTTTTTTTACGTCTTCTTTTGCTAAACTCTCATCTTTCTCTTCTTACTAGAAAGCCTCCAACGGCATCATTCATG
GCGTCAACCACATCCTCGCACCGCCACCCCCCGTCGGACTCCTCCTGACCGCATTTCCCAGCCACTTTTCCACTC
TGTTACTGGCCTACGAAAAGACGGATTTTGTAAACTTTGTCCACGGCGTGCACATGCCTGGCGGAAGCACCGTCT
TTGCCCCCAGCAACGGCGCCTTTACTCGCCTCGGCGAAAAGACCAACTCATTCCTCTTCAACACGGGATCGGGGC
GCAAGTACTTGAGCGCGCTGCTCAAATATCACATTGTGCCCAATGCCACGCTCTATAGCGACGCCTACTACGACC
ACGTAGATAGCGAGACGAAGCCTCTGGCGTCTCGGCGGGAGCACTACGACTTGACGACGCTGCTCGGAGACTCTC
GCGTCAGCGCCGACGTGCTGAGGTGGGCAGGCTTTGCCTTTTTCCGAATCAATGGCTTTGCCCACGTCAGTGTGC
GTGATGGCGTGGCGGGGAATGGAGTCGTGCAAGTGCTCGACTCGGTGCTGATTCCGCCTCACAAGCACTCGGCTA
CTGCGACTGACAACGACTCGGACACGGCGGGTAGCATGGATGTCGAGGAGCTCAAAGCCAGGCTAGAACCCTATC
TCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail