Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7015
Gene name
LocationContig_7:154438..156133
Strand-
Gene length (bp)1695
Transcript length (bp)1695
Coding sequence length (bp)1695
Protein length (aa) 565

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1307
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3340
Ophiocordyceps australis map64 (Brazil) OphauB2|7015 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01131
Ophiocordyceps camponoti-rufipedis Ophun1|3932
Ophiocordyceps kimflemingae Ophio5|2494
Ophiocordyceps subramaniannii Hirsu2|1063

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7015
MSATATAPLHAQGDSADFVRLHITPLDAELLSTYLSPTLLQLARNISFHVPETWPEKRFGFVELPQPEATKLRKK
LHGSIFKGARVRIEVARSQTWQKRLNRSESSASCDYHANSNQPQPVKRQKKEAGVLEGVRLEGRKVVRGWTEPLD
TKIRSKRSKDAARERVRGDKKRSLPASKYTDNEECLLRLKLPPCSSSTMSDSSVRSGYKKHTRSTITIHEFEHTT
RYPSFLKVDPPLNYGQPAAEYIQGKGWVAPDGSVIEEARAYTKKKIEPQVTVESSAASSDAGLDNGTASSSKSVS
APQDQDFDHKINTANDASRAACACTYESKETGSTACHDEAHCRAASSHVKLDDPQRPQSSSLPSTNLSIAIPSLS
SPSTTKPVHALEALYKRNKIDSAGQKNQIEPFHFFDSSNGGDDEMEYLGASYATPLTPRADRDRRSIRSSAPTPD
TAKPSERRIFWSKTGFEGEEEDKEEEHDQGDDEGDDEDEDDEECNGEAPYTDMGCGHEYEAPTQLQIEDAASADF
PSWFWQNRSHLNRSWMKRRKMAAKEERYKNNKTRAARAV*
Coding >OphauB2|7015
ATGTCTGCAACGGCGACAGCGCCCCTACACGCACAAGGCGACAGCGCTGACTTTGTGCGCTTGCACATCACGCCT
CTGGATGCAGAGCTTCTATCGACTTATCTATCTCCTACACTTCTCCAGCTAGCTCGCAACATTTCATTTCATGTC
CCGGAGACATGGCCCGAGAAGCGGTTTGGCTTCGTCGAATTGCCGCAGCCTGAAGCCACGAAGCTCCGCAAGAAG
CTTCACGGTTCCATTTTCAAAGGAGCCAGGGTGCGGATTGAAGTTGCTCGGTCACAGACTTGGCAGAAGCGTTTA
AACCGTTCAGAGTCTTCTGCAAGTTGCGATTATCATGCCAACTCGAACCAGCCCCAGCCCGTCAAGAGACAGAAG
AAAGAGGCGGGAGTGCTTGAAGGCGTCAGGCTTGAGGGCCGCAAGGTGGTACGCGGATGGACTGAGCCTCTCGAC
ACCAAAATTCGGAGCAAGAGAAGCAAGGACGCTGCCAGAGAGCGAGTGCGAGGCGACAAGAAGCGGAGTCTGCCA
GCATCAAAGTATACGGATAACGAAGAATGTCTCCTAAGGCTCAAGTTGCCCCCCTGCTCATCGAGCACCATGTCC
GACTCTAGTGTACGCAGCGGCTACAAGAAGCACACCCGTTCCACGATAACAATTCACGAATTTGAGCACACAACT
AGATACCCTTCGTTTTTGAAGGTCGATCCGCCCTTGAATTACGGACAACCAGCAGCCGAATATATCCAGGGCAAA
GGTTGGGTTGCCCCAGATGGCAGCGTCATTGAAGAGGCTAGAGCATATACGAAGAAGAAAATTGAACCTCAAGTG
ACCGTTGAGTCTTCGGCTGCTTCTTCTGATGCAGGACTGGATAATGGCACCGCCAGCTCTTCAAAGTCGGTTTCA
GCGCCGCAGGACCAAGATTTTGACCACAAAATAAATACGGCGAATGACGCGAGTAGGGCCGCATGTGCTTGCACT
TACGAGAGCAAGGAAACGGGATCCACTGCTTGTCATGATGAGGCGCATTGCAGAGCAGCATCATCACATGTCAAG
CTCGACGACCCTCAGCGACCGCAGTCGAGCAGCTTGCCTAGCACCAATCTATCCATCGCAATCCCTTCACTCAGC
AGCCCTTCTACTACTAAGCCCGTACATGCACTTGAGGCGCTTTACAAGCGTAACAAGATCGATTCGGCCGGGCAA
AAGAATCAAATAGAGCCCTTTCATTTCTTTGATTCGAGTAACGGTGGTGACGACGAGATGGAGTATTTGGGCGCC
TCGTACGCCACTCCCCTAACACCTCGTGCCGATCGCGATCGGCGTAGTATACGTAGCTCGGCGCCCACGCCAGAT
ACAGCGAAACCGTCTGAGAGGCGCATCTTCTGGTCTAAGACAGGCTTTGAAGGAGAAGAAGAGGACAAGGAAGAA
GAACATGATCAAGGTGACGACGAAGGTGACGACGAAGATGAAGATGACGAGGAATGCAACGGTGAGGCACCATAT
ACAGACATGGGGTGTGGCCATGAATATGAAGCACCAACGCAACTACAAATTGAGGATGCAGCGTCTGCCGATTTT
CCGTCGTGGTTTTGGCAGAATCGCAGCCACTTGAATCGCTCATGGATGAAACGGCGCAAGATGGCTGCCAAGGAG
GAACGATACAAGAACAATAAGACACGGGCTGCCAGAGCAGTCTGA
Transcript >OphauB2|7015
ATGTCTGCAACGGCGACAGCGCCCCTACACGCACAAGGCGACAGCGCTGACTTTGTGCGCTTGCACATCACGCCT
CTGGATGCAGAGCTTCTATCGACTTATCTATCTCCTACACTTCTCCAGCTAGCTCGCAACATTTCATTTCATGTC
CCGGAGACATGGCCCGAGAAGCGGTTTGGCTTCGTCGAATTGCCGCAGCCTGAAGCCACGAAGCTCCGCAAGAAG
CTTCACGGTTCCATTTTCAAAGGAGCCAGGGTGCGGATTGAAGTTGCTCGGTCACAGACTTGGCAGAAGCGTTTA
AACCGTTCAGAGTCTTCTGCAAGTTGCGATTATCATGCCAACTCGAACCAGCCCCAGCCCGTCAAGAGACAGAAG
AAAGAGGCGGGAGTGCTTGAAGGCGTCAGGCTTGAGGGCCGCAAGGTGGTACGCGGATGGACTGAGCCTCTCGAC
ACCAAAATTCGGAGCAAGAGAAGCAAGGACGCTGCCAGAGAGCGAGTGCGAGGCGACAAGAAGCGGAGTCTGCCA
GCATCAAAGTATACGGATAACGAAGAATGTCTCCTAAGGCTCAAGTTGCCCCCCTGCTCATCGAGCACCATGTCC
GACTCTAGTGTACGCAGCGGCTACAAGAAGCACACCCGTTCCACGATAACAATTCACGAATTTGAGCACACAACT
AGATACCCTTCGTTTTTGAAGGTCGATCCGCCCTTGAATTACGGACAACCAGCAGCCGAATATATCCAGGGCAAA
GGTTGGGTTGCCCCAGATGGCAGCGTCATTGAAGAGGCTAGAGCATATACGAAGAAGAAAATTGAACCTCAAGTG
ACCGTTGAGTCTTCGGCTGCTTCTTCTGATGCAGGACTGGATAATGGCACCGCCAGCTCTTCAAAGTCGGTTTCA
GCGCCGCAGGACCAAGATTTTGACCACAAAATAAATACGGCGAATGACGCGAGTAGGGCCGCATGTGCTTGCACT
TACGAGAGCAAGGAAACGGGATCCACTGCTTGTCATGATGAGGCGCATTGCAGAGCAGCATCATCACATGTCAAG
CTCGACGACCCTCAGCGACCGCAGTCGAGCAGCTTGCCTAGCACCAATCTATCCATCGCAATCCCTTCACTCAGC
AGCCCTTCTACTACTAAGCCCGTACATGCACTTGAGGCGCTTTACAAGCGTAACAAGATCGATTCGGCCGGGCAA
AAGAATCAAATAGAGCCCTTTCATTTCTTTGATTCGAGTAACGGTGGTGACGACGAGATGGAGTATTTGGGCGCC
TCGTACGCCACTCCCCTAACACCTCGTGCCGATCGCGATCGGCGTAGTATACGTAGCTCGGCGCCCACGCCAGAT
ACAGCGAAACCGTCTGAGAGGCGCATCTTCTGGTCTAAGACAGGCTTTGAAGGAGAAGAAGAGGACAAGGAAGAA
GAACATGATCAAGGTGACGACGAAGGTGACGACGAAGATGAAGATGACGAGGAATGCAACGGTGAGGCACCATAT
ACAGACATGGGGTGTGGCCATGAATATGAAGCACCAACGCAACTACAAATTGAGGATGCAGCGTCTGCCGATTTT
CCGTCGTGGTTTTGGCAGAATCGCAGCCACTTGAATCGCTCATGGATGAAACGGCGCAAGATGGCTGCCAAGGAG
GAACGATACAAGAACAATAAGACACGGGCTGCCAGAGCAGTCTGA
Gene >OphauB2|7015
ATGTCTGCAACGGCGACAGCGCCCCTACACGCACAAGGCGACAGCGCTGACTTTGTGCGCTTGCACATCACGCCT
CTGGATGCAGAGCTTCTATCGACTTATCTATCTCCTACACTTCTCCAGCTAGCTCGCAACATTTCATTTCATGTC
CCGGAGACATGGCCCGAGAAGCGGTTTGGCTTCGTCGAATTGCCGCAGCCTGAAGCCACGAAGCTCCGCAAGAAG
CTTCACGGTTCCATTTTCAAAGGAGCCAGGGTGCGGATTGAAGTTGCTCGGTCACAGACTTGGCAGAAGCGTTTA
AACCGTTCAGAGTCTTCTGCAAGTTGCGATTATCATGCCAACTCGAACCAGCCCCAGCCCGTCAAGAGACAGAAG
AAAGAGGCGGGAGTGCTTGAAGGCGTCAGGCTTGAGGGCCGCAAGGTGGTACGCGGATGGACTGAGCCTCTCGAC
ACCAAAATTCGGAGCAAGAGAAGCAAGGACGCTGCCAGAGAGCGAGTGCGAGGCGACAAGAAGCGGAGTCTGCCA
GCATCAAAGTATACGGATAACGAAGAATGTCTCCTAAGGCTCAAGTTGCCCCCCTGCTCATCGAGCACCATGTCC
GACTCTAGTGTACGCAGCGGCTACAAGAAGCACACCCGTTCCACGATAACAATTCACGAATTTGAGCACACAACT
AGATACCCTTCGTTTTTGAAGGTCGATCCGCCCTTGAATTACGGACAACCAGCAGCCGAATATATCCAGGGCAAA
GGTTGGGTTGCCCCAGATGGCAGCGTCATTGAAGAGGCTAGAGCATATACGAAGAAGAAAATTGAACCTCAAGTG
ACCGTTGAGTCTTCGGCTGCTTCTTCTGATGCAGGACTGGATAATGGCACCGCCAGCTCTTCAAAGTCGGTTTCA
GCGCCGCAGGACCAAGATTTTGACCACAAAATAAATACGGCGAATGACGCGAGTAGGGCCGCATGTGCTTGCACT
TACGAGAGCAAGGAAACGGGATCCACTGCTTGTCATGATGAGGCGCATTGCAGAGCAGCATCATCACATGTCAAG
CTCGACGACCCTCAGCGACCGCAGTCGAGCAGCTTGCCTAGCACCAATCTATCCATCGCAATCCCTTCACTCAGC
AGCCCTTCTACTACTAAGCCCGTACATGCACTTGAGGCGCTTTACAAGCGTAACAAGATCGATTCGGCCGGGCAA
AAGAATCAAATAGAGCCCTTTCATTTCTTTGATTCGAGTAACGGTGGTGACGACGAGATGGAGTATTTGGGCGCC
TCGTACGCCACTCCCCTAACACCTCGTGCCGATCGCGATCGGCGTAGTATACGTAGCTCGGCGCCCACGCCAGAT
ACAGCGAAACCGTCTGAGAGGCGCATCTTCTGGTCTAAGACAGGCTTTGAAGGAGAAGAAGAGGACAAGGAAGAA
GAACATGATCAAGGTGACGACGAAGGTGACGACGAAGATGAAGATGACGAGGAATGCAACGGTGAGGCACCATAT
ACAGACATGGGGTGTGGCCATGAATATGAAGCACCAACGCAACTACAAATTGAGGATGCAGCGTCTGCCGATTTT
CCGTCGTGGTTTTGGCAGAATCGCAGCCACTTGAATCGCTCATGGATGAAACGGCGCAAGATGGCTGCCAAGGAG
GAACGATACAAGAACAATAAGACACGGGCTGCCAGAGCAGTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail