Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7014
Gene name
LocationContig_7:153006..154020
Strand-
Gene length (bp)1014
Transcript length (bp)879
Coding sequence length (bp)879
Protein length (aa) 293

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18115 Tudor_3 DNA repair protein Crb2 Tudor domain 5.2E-07 105 153

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94519|SPF30_SCHPO Splicing factor spf30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spf30 PE=1 SV=1 7 292 7.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7014
MASIAAIETEKLQYQEQVDLVTAQLRDDPENGDLKALQEELSNLIALLDENIAELRSKRPEKVTKSVVAETPQPE
IWSRENHPAFKKASAQEEKEEPPANYQVNDTVLAKWLSGDKAFYPARITSITGSSTAPIYTVRFKSYDTVESLRA
RDIRPATNKRKTDASSTTTTTTSSSLVATTTPTTALTAAPGLVSSAGATMYAEAQNDAHSKETDAAQPPKPKKLR
AKKELEASKSKWQEFNSKSKVGKSLKKDSMFRTPDGIRGRVGFTGSGQAMRKDPARIRPHHPEEDVD*
Coding >OphauB2|7014
ATGGCCTCTATCGCAGCGATAGAGACAGAGAAGCTGCAATATCAAGAACAGGTCGATCTTGTCACTGCACAGCTG
CGTGACGACCCTGAAAATGGCGACCTCAAAGCGCTTCAGGAAGAGCTTTCCAATCTCATCGCGCTCCTCGACGAA
AATATTGCCGAGTTGCGCTCTAAGCGGCCCGAAAAGGTTACCAAGAGCGTCGTTGCAGAGACTCCTCAGCCCGAA
ATATGGTCTCGCGAAAACCATCCTGCGTTTAAAAAGGCTAGCGCGCAGGAAGAAAAGGAGGAGCCTCCTGCCAAT
TACCAGGTCAATGACACTGTCCTGGCAAAATGGCTATCGGGGGACAAGGCCTTTTATCCTGCCAGAATTACTTCC
ATTACCGGGTCATCAACTGCGCCCATATATACGGTTCGATTCAAGAGTTACGATACAGTAGAGTCTCTGCGCGCC
CGGGACATTCGCCCTGCGACCAACAAGAGAAAGACGGACGCTTCAAGCACGACTACAACTACTACATCATCATCA
TTAGTAGCAACAACGACTCCCACAACTGCCCTCACAGCCGCACCTGGCCTTGTTTCTTCGGCCGGCGCCACCATG
TATGCAGAGGCCCAAAATGATGCCCATTCGAAGGAGACAGACGCTGCTCAGCCCCCCAAACCAAAAAAGCTGAGG
GCCAAGAAGGAACTCGAGGCCTCTAAAAGCAAATGGCAAGAATTCAACTCAAAATCAAAAGTTGGTAAATCTTTG
AAGAAGGATAGCATGTTTCGCACACCGGATGGTATCCGCGGCAGAGTGGGATTCACGGGCTCAGGGCAGGCCATG
CGGAAGGACCCTGCTCGTATTCGACCCCATCATCCTGAAGAGGATGTGGATTGA
Transcript >OphauB2|7014
ATGGCCTCTATCGCAGCGATAGAGACAGAGAAGCTGCAATATCAAGAACAGGTCGATCTTGTCACTGCACAGCTG
CGTGACGACCCTGAAAATGGCGACCTCAAAGCGCTTCAGGAAGAGCTTTCCAATCTCATCGCGCTCCTCGACGAA
AATATTGCCGAGTTGCGCTCTAAGCGGCCCGAAAAGGTTACCAAGAGCGTCGTTGCAGAGACTCCTCAGCCCGAA
ATATGGTCTCGCGAAAACCATCCTGCGTTTAAAAAGGCTAGCGCGCAGGAAGAAAAGGAGGAGCCTCCTGCCAAT
TACCAGGTCAATGACACTGTCCTGGCAAAATGGCTATCGGGGGACAAGGCCTTTTATCCTGCCAGAATTACTTCC
ATTACCGGGTCATCAACTGCGCCCATATATACGGTTCGATTCAAGAGTTACGATACAGTAGAGTCTCTGCGCGCC
CGGGACATTCGCCCTGCGACCAACAAGAGAAAGACGGACGCTTCAAGCACGACTACAACTACTACATCATCATCA
TTAGTAGCAACAACGACTCCCACAACTGCCCTCACAGCCGCACCTGGCCTTGTTTCTTCGGCCGGCGCCACCATG
TATGCAGAGGCCCAAAATGATGCCCATTCGAAGGAGACAGACGCTGCTCAGCCCCCCAAACCAAAAAAGCTGAGG
GCCAAGAAGGAACTCGAGGCCTCTAAAAGCAAATGGCAAGAATTCAACTCAAAATCAAAAGTTGGTAAATCTTTG
AAGAAGGATAGCATGTTTCGCACACCGGATGGTATCCGCGGCAGAGTGGGATTCACGGGCTCAGGGCAGGCCATG
CGGAAGGACCCTGCTCGTATTCGACCCCATCATCCTGAAGAGGATGTGGATTGA
Gene >OphauB2|7014
ATGGCCTCTATCGCAGCGATAGAGACAGAGAAGCTGCAATATCAAGAACAGGTGAGAATCAAGGGCGGCTCAGCT
CGCCGTGCTTTTATTTACTTGTCGCTGATTCCAGTGTCACGTCGCGTAGGTCGATCTTGTCACTGCACAGCTGCG
TGACGACCCTGAAAATGGCGACCTCAAAGCGCTTCAGGAAGAGCTTTCCAATCTCATCGCGCTCCTCGACGAAAA
TATTGCCGAGTTGCGCTCTAAGCGGCCCGAAAAGGTTACCAAGAGCGTCGTTGCAGAGACTCCTCAGCCCGAAAT
ATGGTCTCGCGAAAACCATCCTGCGTTTAAAAAGGCTAGCGCGCAGGAAGAAAAGGAGGAGCCTCCTGCCAATTA
CCAGGTCAATGACACTGTCCTGGCAAAATGGCTATCGGGGGACAAGGCCTTTTATCCTGCCAGAATTACTTCCAT
TACCGGGTCATCAACTGCGCCCATATATACGGTTCGATTCAAGAGTTACGATACAGTAGAGTCTCTGCGCGCCCG
GGACATTCGCCCTGCGACCAACAAGAGAAAGACGGACGCTTCAAGCACGACTACAACTACTACATCATCATCATT
AGTAGCAACAACGACTCCCACAACTGCCCTCACAGCCGCACCTGGCCTTGTTTCTTCGGCCGGCGCCACCATGTA
TGCAGAGGCCCAAAATGATGCCCATTCGAAGGAGACAGACGCTGCTCAGCCCCCCAAACCAAAAAAGCTGAGGGC
CAAGAAGGAACTCGAGGCCTCTAAAAGCAAATGGCAAGAATTCAACTCAAAATCAAAAGTTGGTAAATCTTTGAA
GAAGGATAGCATGTTTCGCACACCGGATGGTATCCGCGGCAGAGGTATGTTGCATGGCACATGACGCAAATCGTG
TGCACCTCGATCCCTGACTGTCTTTTACCAGTGGGATTCACGGGCTCAGGGCAGGCCATGCGGAAGGACCCTGCT
CGTATTCGACCCCATCATCCTGAAGAGGATGTGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail