Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7013
Gene name
LocationContig_7:151503..152666
Strand+
Gene length (bp)1163
Transcript length (bp)894
Coding sequence length (bp)894
Protein length (aa) 298

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10609 ParA NUBPL iron-transfer P-loop NTPase 1.2E-90 44 287
PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain 2.8E-10 48 203
PF13614 AAA_31 AAA domain 2.1E-07 45 83
PF09140 MipZ ATPase MipZ 8.4E-05 47 87

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CE48|IND1_YARLI Iron-sulfur protein IND1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IND1 PE=1 SV=1 9 293 1.0E-86
sp|Q9CWD8|NUBPL_MOUSE Iron-sulfur protein NUBPL OS=Mus musculus GN=Nubpl PE=1 SV=2 36 292 5.0E-81
sp|Q54F15|NUBPL_DICDI Iron-sulfur protein NUBPL OS=Dictyostelium discoideum GN=nubpl PE=3 SV=1 34 293 2.0E-80
sp|Q8TB37|NUBPL_HUMAN Iron-sulfur protein NUBPL OS=Homo sapiens GN=NUBPL PE=1 SV=3 36 296 5.0E-78
sp|O66946|APBC_AQUAE Iron-sulfur cluster carrier protein OS=Aquifex aeolicus (strain VF5) GN=mrp PE=3 SV=1 38 292 8.0E-68
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CE48|IND1_YARLI Iron-sulfur protein IND1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IND1 PE=1 SV=1 9 293 1.0E-86
sp|Q9CWD8|NUBPL_MOUSE Iron-sulfur protein NUBPL OS=Mus musculus GN=Nubpl PE=1 SV=2 36 292 5.0E-81
sp|Q54F15|NUBPL_DICDI Iron-sulfur protein NUBPL OS=Dictyostelium discoideum GN=nubpl PE=3 SV=1 34 293 2.0E-80
sp|Q8TB37|NUBPL_HUMAN Iron-sulfur protein NUBPL OS=Homo sapiens GN=NUBPL PE=1 SV=3 36 296 5.0E-78
sp|O66946|APBC_AQUAE Iron-sulfur cluster carrier protein OS=Aquifex aeolicus (strain VF5) GN=mrp PE=3 SV=1 38 292 8.0E-68
sp|O24999|APBC_HELPY Iron-sulfur cluster carrier protein OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=mrp PE=3 SV=2 25 285 1.0E-67
sp|P45135|APBC_HAEIN Iron-sulfur cluster carrier protein OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=mrp PE=3 SV=2 34 291 2.0E-67
sp|Q9ZMM5|APBC_HELPJ Iron-sulfur cluster carrier protein OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=mrp PE=3 SV=1 25 285 4.0E-67
sp|Q8ZNN5|APBC_SALTY Iron-sulfur cluster carrier protein OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=apbC PE=1 SV=1 34 291 1.0E-63
sp|P0AF08|APBC_ECOLI Iron-sulfur cluster carrier protein OS=Escherichia coli (strain K12) GN=mrp PE=3 SV=1 34 291 3.0E-63
sp|P0AF09|APBC_ECOL6 Iron-sulfur cluster carrier protein OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mrp PE=3 SV=1 34 291 3.0E-63
sp|P53383|APBC_SYNY3 Iron-sulfur cluster carrier protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=mrp PE=3 SV=1 26 295 1.0E-61
sp|P72190|APBC_PSEFR Iron-sulfur cluster carrier protein OS=Pseudomonas fragi PE=3 SV=1 33 284 2.0E-61
sp|O58667|APBC_PYRHO Iron-sulfur cluster carrier protein OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0949 PE=3 SV=1 48 292 5.0E-55
sp|Q57731|APBC_METJA Iron-sulfur cluster carrier protein OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0283 PE=3 SV=1 38 292 2.0E-54
sp|Q8U1R0|APBC_PYRFU Iron-sulfur cluster carrier protein OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1145 PE=3 SV=1 48 292 5.0E-54
sp|Q9V0D9|APBC_PYRAB Iron-sulfur cluster carrier protein OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB08510 PE=3 SV=1 48 292 5.0E-54
sp|P50863|APBC_BACSU Iron-sulfur cluster carrier protein OS=Bacillus subtilis (strain 168) GN=salA PE=2 SV=1 40 293 3.0E-52
sp|Q6LZC5|APBC_METMP Iron-sulfur cluster carrier protein OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP0704 PE=1 SV=1 38 291 9.0E-52
sp|Q0JJS8|HF101_ORYSJ Fe-S cluster assembly factor HCF101, chloroplastic OS=Oryza sativa subsp. japonica GN=HCF101 PE=3 SV=3 39 291 5.0E-50
sp|Q6STH5|HF101_ARATH Fe-S cluster assembly factor HCF101, chloroplastic OS=Arabidopsis thaliana GN=HCF101 PE=1 SV=1 44 291 1.0E-49
sp|Q9RVM9|APBC_DEIRA Iron-sulfur cluster carrier protein OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=mrp PE=3 SV=1 63 293 2.0E-48
sp|Q4UKB5|APBC_RICFE Iron-sulfur cluster carrier protein OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=mrp PE=3 SV=1 38 263 1.0E-47
sp|Q92JA4|APBC_RICCN Iron-sulfur cluster carrier protein OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=mrp PE=3 SV=1 38 263 4.0E-47
sp|Q9ZE27|APBC_RICPR Iron-sulfur cluster carrier protein OS=Rickettsia prowazekii (strain Madrid E) GN=mrp PE=3 SV=1 23 263 6.0E-46
sp|Q6CQV4|CFD1_KLULA Cytosolic Fe-S cluster assembly factor CFD1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CFD1 PE=3 SV=1 39 256 6.0E-46
sp|Q1RHB0|APBC_RICBR Iron-sulfur cluster carrier protein OS=Rickettsia bellii (strain RML369-C) GN=mrp PE=3 SV=1 25 263 9.0E-46
sp|Q5I0L4|NUBP1_RAT Cytosolic Fe-S cluster assembly factor NUBP1 OS=Rattus norvegicus GN=Nubp1 PE=1 SV=1 13 287 1.0E-45
sp|Q6P298|NUBP1_DANRE Cytosolic Fe-S cluster assembly factor nubp1 OS=Danio rerio GN=nubp1 PE=2 SV=2 38 287 2.0E-45
sp|P0CO88|NBP35_CRYNJ Cytosolic Fe-S cluster assembly factor NBP35 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NBP35 PE=3 SV=1 21 287 2.0E-45
sp|P0CO89|NBP35_CRYNB Cytosolic Fe-S cluster assembly factor NBP35 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NBP35 PE=3 SV=1 21 287 2.0E-45
sp|Q9R060|NUBP1_MOUSE Cytosolic Fe-S cluster assembly factor NUBP1 OS=Mus musculus GN=Nubp1 PE=1 SV=1 13 287 3.0E-45
sp|P40558|CFD1_YEAST Cytosolic Fe-S cluster assembly factor CFD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CFD1 PE=1 SV=1 44 255 4.0E-44
sp|Q68XP6|APBC_RICTY Iron-sulfur cluster carrier protein OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=mrp PE=3 SV=1 41 263 4.0E-44
sp|P53384|NUBP1_HUMAN Cytosolic Fe-S cluster assembly factor NUBP1 OS=Homo sapiens GN=NUBP1 PE=1 SV=2 13 293 8.0E-44
sp|Q24K00|NUBP1_BOVIN Cytosolic Fe-S cluster assembly factor NUBP1 OS=Bos taurus GN=NUBP1 PE=2 SV=1 38 287 8.0E-44
sp|Q75AC3|CFD1_ASHGO Cytosolic Fe-S cluster assembly factor CFD1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CFD1 PE=3 SV=2 39 287 1.0E-43
sp|A7RUD5|NUBP1_NEMVE Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Nematostella vectensis GN=v1g236650 PE=3 SV=1 38 287 2.0E-43
sp|Q3KQF0|NUP1A_XENLA Cytosolic Fe-S cluster assembly factor nubp1-A OS=Xenopus laevis GN=nubp1-A PE=2 SV=1 38 290 2.0E-43
sp|Q6FPP7|CFD1_CANGA Cytosolic Fe-S cluster assembly factor CFD1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CFD1 PE=3 SV=1 39 255 3.0E-43
sp|Q59YD9|CFD1_CANAL Cytosolic Fe-S cluster assembly factor CFD1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CFD1 PE=3 SV=1 39 295 3.0E-43
sp|Q9VPD2|NUBP2_DROME Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Drosophila melanogaster GN=CG4858 PE=2 SV=1 41 287 6.0E-43
sp|B4PES4|NBP22_DROYA Cytosolic Fe-S cluster assembly factor NUBP2 homolog 2 OS=Drosophila yakuba GN=GE19695 PE=3 SV=1 41 287 8.0E-43
sp|Q5I050|NUP1B_XENLA Cytosolic Fe-S cluster assembly factor nubp1-B OS=Xenopus laevis GN=nubp1-B PE=2 SV=1 38 290 9.0E-43
sp|B4QJ46|NUBP2_DROSI Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Drosophila simulans GN=GD14899 PE=3 SV=1 41 287 1.0E-42
sp|A9V7A1|NUBP2_MONBE Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Monosiga brevicollis GN=33756 PE=3 SV=1 38 255 1.0E-42
sp|B4IUH5|NBP21_DROYA Cytosolic Fe-S cluster assembly factor NUBP2 homolog 1 OS=Drosophila yakuba GN=GE23241 PE=3 SV=1 41 287 1.0E-42
sp|Q6BWQ9|CFD1_DEBHA Cytosolic Fe-S cluster assembly factor CFD1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CFD1 PE=3 SV=2 35 256 1.0E-42
sp|B3NIP2|NUBP2_DROER Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Drosophila erecta GN=GG16127 PE=3 SV=1 41 287 1.0E-42
sp|B4IAD1|NUBP2_DROSE Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Drosophila sechellia GN=GM22307 PE=3 SV=1 41 287 2.0E-42
sp|P52920|NBP35_YEAST Cytosolic Fe-S cluster assembly factor NBP35 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NBP35 PE=1 SV=1 40 287 4.0E-42
sp|Q3B7Q7|NUBP2_DANRE Cytosolic Fe-S cluster assembly factor nubp2 OS=Danio rerio GN=nubp2 PE=2 SV=1 38 292 5.0E-42
sp|B4N4D9|NUBP2_DROWI Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Drosophila willistoni GN=GK12055 PE=3 SV=1 41 285 5.0E-42
sp|Q8T2F3|NUBP1_DICDI Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Dictyostelium discoideum GN=nubp1 PE=3 SV=1 16 292 7.0E-42
sp|Q16T79|NUBP1_AEDAE Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Aedes aegypti GN=AAEL010360 PE=3 SV=2 38 261 7.0E-42
sp|Q97ZW4|APBC_SULSO Iron-sulfur cluster carrier protein OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0460 PE=3 SV=1 62 288 8.0E-42
sp|B3M9R3|NUBP2_DROAN Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Drosophila ananassae GN=GF10354 PE=3 SV=1 41 285 1.0E-41
sp|Q5EB25|NUBP1_XENTR Cytosolic Fe-S cluster assembly factor nubp1 OS=Xenopus tropicalis GN=nubp1 PE=2 SV=1 38 290 1.0E-41
sp|Q76NZ7|NUBP2_DICDI Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Dictyostelium discoideum GN=nubp2 PE=3 SV=1 48 260 1.0E-41
sp|Q6C7A6|NBP35_YARLI Cytosolic Fe-S cluster assembly factor NBP35 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NBP35 PE=3 SV=1 21 294 2.0E-41
sp|Q6CMN0|NBP35_KLULA Cytosolic Fe-S cluster assembly factor NBP35 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NBP35 PE=3 SV=1 21 287 3.0E-41
sp|Q6C5D0|CFD1_YARLI Cytosolic Fe-S cluster assembly factor CFD1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CFD1 PE=3 SV=1 40 255 3.0E-41
sp|P53382|APBC_MYCLE Iron-sulfur cluster carrier protein OS=Mycobacterium leprae (strain TN) GN=mrp PE=3 SV=2 44 290 9.0E-41
sp|Q9R061|NUBP2_MOUSE Cytosolic Fe-S cluster assembly factor NUBP2 OS=Mus musculus GN=Nubp2 PE=1 SV=1 34 292 1.0E-40
sp|A7SE07|NUBP2_NEMVE Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Nematostella vectensis GN=v1g229988 PE=3 SV=1 39 256 1.0E-40
sp|Q16H50|NUBP2_AEDAE Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Aedes aegypti GN=AAEL008143 PE=3 SV=1 41 287 1.0E-40
sp|Q59MP1|NBP35_CANAL Cytosolic Fe-S cluster assembly factor NBP35 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NBP35 PE=3 SV=2 48 293 1.0E-40
sp|B3RPX4|NUBP2_TRIAD Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_53697 PE=3 SV=1 44 255 2.0E-40
sp|B4IYG8|NUBP2_DROGR Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Drosophila grimshawi GN=GH14587 PE=3 SV=1 41 233 2.0E-40
sp|B4LGB4|NUBP2_DROVI Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Drosophila virilis GN=GJ11530 PE=3 SV=1 41 285 3.0E-40
sp|B4KY56|NUBP2_DROMO Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Drosophila mojavensis GN=GI13405 PE=3 SV=1 41 255 3.0E-40
sp|A8WWQ7|NUBP1_CAEBR Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Caenorhabditis briggsae GN=Cbr-nubp-1 PE=3 SV=1 21 292 4.0E-40
sp|Q9UT57|CFD1_SCHPO Probable cytosolic Fe-S cluster assembly factor SPAC806.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC806.02c PE=3 SV=1 44 255 4.0E-40
sp|Q7PV10|NUBP1_ANOGA Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Anopheles gambiae GN=AGAP011997 PE=3 SV=3 38 274 5.0E-40
sp|Q93459|NUBP1_CAEEL Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Caenorhabditis elegans GN=nubp-1 PE=2 SV=2 21 291 5.0E-40
sp|B0XDJ0|NUBP2_CULQU Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Culex quinquefasciatus GN=CPIJ017390 PE=3 SV=1 41 287 6.0E-40
sp|Q29DB7|NUBP2_DROPS Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA18483 PE=3 SV=2 41 285 9.0E-40
sp|Q68FS1|NUBP2_RAT Cytosolic Fe-S cluster assembly factor NUBP2 OS=Rattus norvegicus GN=Nubp2 PE=1 SV=1 40 291 2.0E-39
sp|Q4HZ34|NBP35_GIBZE Cytosolic Fe-S cluster assembly factor NBP35 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=NBP35 PE=3 SV=1 22 293 2.0E-39
sp|Q5ZKV4|NUBP2_CHICK Cytosolic Fe-S cluster assembly factor NUBP2 OS=Gallus gallus GN=NUBP2 PE=2 SV=1 37 287 4.0E-39
sp|Q3MHY6|NUBP2_BOVIN Cytosolic Fe-S cluster assembly factor NUBP2 OS=Bos taurus GN=NUBP2 PE=2 SV=1 40 287 5.0E-39
sp|O94442|NBP35_SCHPO Cytosolic Fe-S cluster assembly factor nbp35 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nbp35 PE=3 SV=1 24 274 6.0E-39
sp|B0X4N8|NUBP1_CULQU Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Culex quinquefasciatus GN=CPIJ014142 PE=3 SV=1 38 261 7.0E-39
sp|Q6BTZ6|NBP35_DEBHA Cytosolic Fe-S cluster assembly factor NBP35 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NBP35 PE=3 SV=1 38 293 2.0E-38
sp|B6K1G6|CFD1_SCHJY Probable cytosolic Fe-S cluster assembly factor SJAG_02895 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_02895 PE=3 SV=2 41 285 3.0E-38
sp|Q4I174|CFD1_GIBZE Cytosolic Fe-S cluster assembly factor CFD1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CFD1 PE=3 SV=2 40 264 3.0E-38
sp|Q2GWZ4|CFD1_CHAGB Cytosolic Fe-S cluster assembly factor CFD1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CFD1 PE=3 SV=1 40 255 4.0E-38
sp|A8PW87|NUBP1_BRUMA Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Brugia malayi GN=Bm1_36105 PE=3 SV=1 41 287 4.0E-38
sp|Q7QGS3|NUBP2_ANOGA Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Anopheles gambiae GN=AGAP010873 PE=3 SV=4 41 287 5.0E-38
sp|Q9Y5Y2|NUBP2_HUMAN Cytosolic Fe-S cluster assembly factor NUBP2 OS=Homo sapiens GN=NUBP2 PE=1 SV=1 40 287 6.0E-38
sp|Q874M2|NBP35_CANGA Cytosolic Fe-S cluster assembly factor NBP35 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NBP35 PE=3 SV=1 39 287 7.0E-38
sp|Q2UDE2|NBP35_ASPOR Cytosolic Fe-S cluster assembly factor nbp35 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nbp35 PE=3 SV=1 22 287 1.0E-37
sp|Q7S8Z0|NBP35_NEUCR Cytosolic Fe-S cluster assembly factor nbp35 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nbp35 PE=3 SV=1 41 262 3.0E-37
sp|Q0UI56|NBP35_PHANO Cytosolic Fe-S cluster assembly factor NBP35 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=NBP35 PE=3 SV=3 22 296 4.0E-37
sp|Q754X6|NBP35_ASHGO Cytosolic Fe-S cluster assembly factor NBP35 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NBP35 PE=3 SV=3 21 287 4.0E-37
sp|Q1EAU8|NBP35_COCIM Cytosolic Fe-S cluster assembly factor NBP35 OS=Coccidioides immitis (strain RS) GN=NBP35 PE=3 SV=1 48 291 1.0E-36
sp|Q2H317|NBP35_CHAGB Cytosolic Fe-S cluster assembly factor NBP35 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=NBP35 PE=3 SV=1 48 293 2.0E-36
sp|B4H7P4|NUBP2_DROPE Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Drosophila persimilis GN=GL12799 PE=3 SV=1 41 285 2.0E-36
sp|A1C7T4|NBP35_ASPCL Cytosolic Fe-S cluster assembly factor nbp35 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nbp35 PE=3 SV=1 48 291 3.0E-36
sp|Q5BBC5|NBP35_EMENI Cytosolic Fe-S cluster assembly factor nbp35 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nbp35 PE=3 SV=1 48 287 4.0E-36
sp|Q4WZS2|NBP35_ASPFU Cytosolic Fe-S cluster assembly factor nbp35 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nbp35 PE=3 SV=1 22 287 4.0E-36
sp|Q8X0F1|CFD1_NEUCR Cytosolic Fe-S cluster assembly factor cfd1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cfd1 PE=3 SV=1 40 264 5.0E-36
sp|P9WJN7|APBC_MYCTU Iron-sulfur cluster carrier protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mrp PE=1 SV=1 44 290 1.0E-35
sp|P9WJN6|APBC_MYCTO Iron-sulfur cluster carrier protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mrp PE=3 SV=1 44 290 1.0E-35
sp|P65442|APBC_MYCBO Iron-sulfur cluster carrier protein OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mrp PE=3 SV=1 44 290 1.0E-35
sp|A4QNM5|NUBP2_XENTR Cytosolic Fe-S cluster assembly factor nubp2 OS=Xenopus tropicalis GN=nubp2 PE=2 SV=2 40 287 1.0E-35
sp|Q8H1Q2|NBP35_ARATH Cytosolic Fe-S cluster assembly factor NBP35 OS=Arabidopsis thaliana GN=NBP35 PE=1 SV=1 22 265 3.0E-35
sp|Q6DEE4|NUBP2_XENLA Cytosolic Fe-S cluster assembly factor nubp2 OS=Xenopus laevis GN=nubp2 PE=2 SV=1 40 287 3.0E-35
sp|Q4P8S7|CFD1_USTMA Cytosolic Fe-S cluster assembly factor CFD1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CFD1 PE=3 SV=1 39 265 5.0E-35
sp|P53381|APBC_CLOPE Iron-sulfur cluster carrier protein OS=Clostridium perfringens (strain 13 / Type A) GN=mrp PE=3 SV=2 40 272 5.0E-35
sp|Q0CVD6|NBP35_ASPTN Cytosolic Fe-S cluster assembly factor nbp35 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nbp35 PE=3 SV=1 48 262 1.0E-34
sp|B3MU92|NUBP1_DROAN Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Drosophila ananassae GN=GF20875 PE=3 SV=1 39 262 2.0E-34
sp|Q29MT7|NUBP1_DROPS Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA14715 PE=3 SV=1 41 291 3.0E-34
sp|B4LUF5|NUBP1_DROVI Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Drosophila virilis GN=GJ17301 PE=3 SV=1 41 291 4.0E-34
sp|B4G8R5|NUBP1_DROPE Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Drosophila persimilis GN=GL18780 PE=3 SV=1 41 291 7.0E-34
sp|B4N1C3|NUBP1_DROWI Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Drosophila willistoni GN=GK24826 PE=3 SV=1 41 283 7.0E-34
sp|B4JBI7|NUBP1_DROGR Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Drosophila grimshawi GN=GH11560 PE=3 SV=1 41 283 2.0E-33
sp|Q2UA27|CFD1_ASPOR Cytosolic Fe-S cluster assembly factor cfd1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cfd1 PE=3 SV=1 44 253 6.0E-33
sp|A1C4X8|CFD1_ASPCL Cytosolic Fe-S cluster assembly factor cfd1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cfd1 PE=3 SV=1 41 275 1.0E-32
sp|Q9VJI9|NUBP1_DROME Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Drosophila melanogaster GN=CG17904 PE=2 SV=1 39 291 2.0E-32
sp|Q0UAM9|CFD1_PHANO Cytosolic Fe-S cluster assembly factor CFD1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CFD1 PE=3 SV=1 41 264 2.0E-32
sp|Q0CE30|CFD1_ASPTN Cytosolic Fe-S cluster assembly factor cfd1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cfd1 PE=3 SV=1 41 253 3.0E-32
sp|Q4WEN1|CFD1_ASPFU Cytosolic Fe-S cluster assembly factor cfd1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cfd1 PE=3 SV=1 41 253 4.0E-32
sp|B4I540|NUBP1_DROSE Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Drosophila sechellia GN=GM17199 PE=3 SV=1 39 291 6.0E-32
sp|B4KHX1|NUBP1_DROMO Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Drosophila mojavensis GN=GI17051 PE=3 SV=1 41 291 1.0E-31
sp|P0C8Q1|CFD1_EMENI Cytosolic Fe-S cluster assembly factor cfd1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cfd1 PE=3 SV=1 41 253 1.0E-31
sp|Q1DSY6|CFD1_COCIM Cytosolic Fe-S cluster assembly factor CFD1 OS=Coccidioides immitis (strain RS) GN=CFD1 PE=3 SV=1 44 253 1.0E-31
sp|B4P9A8|NUBP1_DROYA Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Drosophila yakuba GN=GE12759 PE=3 SV=1 39 291 1.0E-31
sp|B4Q7F5|NUBP1_DROSI Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Drosophila simulans GN=GD24076 PE=3 SV=1 39 262 3.0E-31
sp|B3NNJ9|NUBP1_DROER Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Drosophila erecta GN=GG22765 PE=3 SV=1 39 291 5.0E-31
sp|P0CO90|CFD1_CRYNJ Cytosolic Fe-S cluster assembly factor CFD1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CFD1 PE=3 SV=1 36 253 2.0E-29
sp|P0CO91|CFD1_CRYNB Cytosolic Fe-S cluster assembly factor CFD1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CFD1 PE=3 SV=1 36 253 2.0E-29
sp|Q57967|Y547_METJA Uncharacterized ATP-binding protein MJ0547 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0547 PE=4 SV=1 44 284 9.0E-13
sp|Q20EV4|MIND_OLTVI Putative septum site-determining protein MinD OS=Oltmannsiellopsis viridis GN=minD PE=3 SV=1 28 251 3.0E-07
sp|P56346|MIND_CHLVU Putative septum site-determining protein MinD OS=Chlorella vulgaris GN=minD PE=3 SV=1 40 221 5.0E-07
sp|O78436|MIND_GUITH Putative septum site-determining protein MinD OS=Guillardia theta GN=minD PE=3 SV=1 44 84 9.0E-07
sp|P96716|YWQD_BACSU Tyrosine-protein kinase YwqD OS=Bacillus subtilis (strain 168) GN=ywqD PE=1 SV=1 35 214 9.0E-07
sp|Q58289|NIFH_METJA Nitrogenase iron protein OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=nifH PE=3 SV=1 53 292 4.0E-06
sp|Q01464|MIND_BACSU Septum site-determining protein MinD OS=Bacillus subtilis (strain 168) GN=minD PE=1 SV=1 44 202 8.0E-06
sp|Q4G386|MIND_EMIHU Putative septum site-determining protein MinD OS=Emiliania huxleyi GN=minD PE=3 SV=1 44 214 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7013
MRPTQKSLFRVLHALRYAEPQGLPRTGTPPSWPRRPQRRNIQDVAKVIAVSSAKGGVGKSTVAANLSVAFARLGL
RSGILDADVFGPSIPNLFDLSGEPRLSSNNQLLPLTNYGVKTMSLGYLVGEKSALVWRGPMVIKAIQQLLHQVEW
GGLDILVLDLPPGTGDVQLTITQQVILDGSVIVTTPHSLATRDAVKGISMFRTVDVNILGLVQNMSLYNCPHCHT
QSHIFGSDQIVKSMCKEHDMDLLGDVPLHPTACREGDRPKLVVVSDPSSDIASVFMKIAQAICHKINLPADY*
Coding >OphauB2|7013
ATGCGGCCAACTCAAAAGAGTCTCTTCCGAGTGCTGCATGCCCTCAGATATGCTGAACCACAGGGTCTTCCTCGC
ACAGGCACGCCTCCAAGCTGGCCCCGACGACCCCAAAGGCGCAACATCCAGGATGTTGCCAAGGTTATTGCCGTC
TCTTCCGCCAAGGGAGGCGTGGGCAAGAGCACAGTCGCAGCAAATCTATCTGTCGCCTTCGCCAGACTAGGTCTT
CGCTCAGGCATCCTTGACGCCGACGTCTTTGGACCTTCTATCCCAAACTTGTTTGACCTTTCGGGAGAGCCCAGG
CTATCGAGCAACAATCAACTTTTGCCTCTGACCAATTATGGCGTCAAGACAATGTCGCTGGGCTATCTCGTTGGC
GAAAAGTCAGCACTTGTTTGGAGGGGCCCCATGGTCATCAAGGCTATCCAACAGCTCCTGCATCAAGTAGAATGG
GGCGGACTCGATATCCTCGTGCTCGACCTGCCTCCGGGAACTGGCGATGTTCAACTCACCATTACGCAGCAGGTT
ATCTTGGACGGGTCTGTCATTGTCACCACCCCTCATAGTCTCGCCACAAGAGATGCCGTCAAGGGTATCAGCATG
TTCAGGACCGTCGACGTCAACATCCTCGGCCTTGTTCAAAACATGTCCCTCTACAATTGTCCCCACTGCCACACC
CAGTCACACATCTTTGGCTCTGACCAGATTGTCAAGTCCATGTGTAAAGAACACGATATGGACTTGCTGGGTGAT
GTTCCTCTTCACCCTACTGCGTGTCGCGAAGGCGACAGACCAAAGCTTGTTGTTGTCTCGGATCCTTCAAGCGAC
ATTGCCTCTGTTTTCATGAAAATTGCTCAGGCTATTTGTCACAAGATCAATTTGCCTGCTGACTACTAG
Transcript >OphauB2|7013
ATGCGGCCAACTCAAAAGAGTCTCTTCCGAGTGCTGCATGCCCTCAGATATGCTGAACCACAGGGTCTTCCTCGC
ACAGGCACGCCTCCAAGCTGGCCCCGACGACCCCAAAGGCGCAACATCCAGGATGTTGCCAAGGTTATTGCCGTC
TCTTCCGCCAAGGGAGGCGTGGGCAAGAGCACAGTCGCAGCAAATCTATCTGTCGCCTTCGCCAGACTAGGTCTT
CGCTCAGGCATCCTTGACGCCGACGTCTTTGGACCTTCTATCCCAAACTTGTTTGACCTTTCGGGAGAGCCCAGG
CTATCGAGCAACAATCAACTTTTGCCTCTGACCAATTATGGCGTCAAGACAATGTCGCTGGGCTATCTCGTTGGC
GAAAAGTCAGCACTTGTTTGGAGGGGCCCCATGGTCATCAAGGCTATCCAACAGCTCCTGCATCAAGTAGAATGG
GGCGGACTCGATATCCTCGTGCTCGACCTGCCTCCGGGAACTGGCGATGTTCAACTCACCATTACGCAGCAGGTT
ATCTTGGACGGGTCTGTCATTGTCACCACCCCTCATAGTCTCGCCACAAGAGATGCCGTCAAGGGTATCAGCATG
TTCAGGACCGTCGACGTCAACATCCTCGGCCTTGTTCAAAACATGTCCCTCTACAATTGTCCCCACTGCCACACC
CAGTCACACATCTTTGGCTCTGACCAGATTGTCAAGTCCATGTGTAAAGAACACGATATGGACTTGCTGGGTGAT
GTTCCTCTTCACCCTACTGCGTGTCGCGAAGGCGACAGACCAAAGCTTGTTGTTGTCTCGGATCCTTCAAGCGAC
ATTGCCTCTGTTTTCATGAAAATTGCTCAGGCTATTTGTCACAAGATCAATTTGCCTGCTGACTACTAG
Gene >OphauB2|7013
ATGCGGCCAACTCAAAAGAGTCTCTTCCGAGTGCTGCATGCCCTCAGATATGCTGAACCACAGGTTTGTTGCCGC
GTCATCACAACATTGCCACTAATCCCCTTGCTTCCACTACTACACACCTGCTGACTGTCTCCTTGTCTGCTGCCG
GGCAAAGGGTCTTCCTCGCACAGGCACGCCTCCAAGCTGGCCCCGACGACCCCAAAGGCGCAACATCCAGGATGT
TGCCAAGGTTATTGCCGTCTCTTCCGCCAAGGGAGGCGTGGGCAAGAGCACAGTCGCAGGTCCGTCTGCCCTCCC
CATATCCGTTCCCAAACACCCCCGTTCATAATCGTTTTTTGCTCGACTAGCAAATCTATCTGTCGCCTTCGCCAG
ACTAGGTCTTCGCTCAGGCATCCTTGACGCCGACGTCTTTGGACCTTCTATCCCAAACTTGTTTGACCTTTCGGG
AGAGCCCAGGCTATCGAGCAGTAAGACGTCTCGGTGCTGCGAGTCAATCGCCCTCGTCTAAACTTCCGACTAGAC
AATCAACTTTTGCCTCTGACCAATTATGGCGTCAAGACAATGTCGCTGGGCTATCTCGTTGGCGAAAAGTCAGCA
CTTGTTTGGAGGGGCCCCATGGTCATCAAGGCTATCCAACAGCTCCTGCATCAAGTAGAATGGGGCGGACTCGAT
ATCCTCGTGCTCGACCTGCCTCCGGGAACTGGCGATGTTCAACTCACCATTACGCAGCAGGTTATCTTGGACGGT
AGGCAAGACTTGTCCAGCTTCACCTAGCACACTGGCTCACAGCTACCTTCACAGGGTCTGTCATTGTCACCACCC
CTCATAGTCTCGCCACAAGAGATGCCGTCAAGGGTATCAGCATGTTCAGGACCGTCGACGTCAACATCCTCGGCC
TTGTTCAAAACATGTCCCTCTACAATTGTCCCCACTGCCACACCCAGTCACACATCTTTGGCTCTGACCAGATTG
TCAAGTCCATGTGTAAAGAACACGATATGGACTTGCTGGGTGATGTTCCTCTTCACCCTACTGCGTGTCGCGAAG
GCGACAGACCAAAGCTTGTTGTTGTCTCGGATCCTTCAAGCGACATTGCCTCTGTTTTCATGAAAATTGCTCAGG
CTATTTGTCACAAGATCAATTTGCCTGCTGACTACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail