Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7
Gene name
LocationContig_1:17457..19501
Strand-
Gene length (bp)2044
Transcript length (bp)1872
Coding sequence length (bp)1872
Protein length (aa) 624

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 2.6E-08 380 424
PF17123 zf-RING_11 RING-like zinc finger 1.2E-06 380 409
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 2.9E-06 380 423

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q1MTR5|YG66_SCHPO Uncharacterized RING finger membrane protein C15C4.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.06c PE=3 SV=1 116 424 7.0E-11
sp|Q8GT74|NIP2_ARATH NEP1-interacting protein 2 OS=Arabidopsis thaliana GN=NIP2 PE=1 SV=1 238 424 1.0E-07
sp|Q6Y290|GOLI_RAT E3 ubiquitin-protein ligase RNF130 OS=Rattus norvegicus GN=Rnf130 PE=1 SV=1 333 466 1.0E-06
sp|Q8VEM1|GOLI_MOUSE E3 ubiquitin-protein ligase RNF130 OS=Mus musculus GN=Rnf130 PE=2 SV=1 333 466 2.0E-06
sp|Q6GPV5|RN181_XENLA E3 ubiquitin-protein ligase RNF181 OS=Xenopus laevis GN=rnf181 PE=2 SV=1 381 450 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q1MTR5|YG66_SCHPO Uncharacterized RING finger membrane protein C15C4.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.06c PE=3 SV=1 116 424 7.0E-11
sp|Q8GT74|NIP2_ARATH NEP1-interacting protein 2 OS=Arabidopsis thaliana GN=NIP2 PE=1 SV=1 238 424 1.0E-07
sp|Q6Y290|GOLI_RAT E3 ubiquitin-protein ligase RNF130 OS=Rattus norvegicus GN=Rnf130 PE=1 SV=1 333 466 1.0E-06
sp|Q8VEM1|GOLI_MOUSE E3 ubiquitin-protein ligase RNF130 OS=Mus musculus GN=Rnf130 PE=2 SV=1 333 466 2.0E-06
sp|Q6GPV5|RN181_XENLA E3 ubiquitin-protein ligase RNF181 OS=Xenopus laevis GN=rnf181 PE=2 SV=1 381 450 2.0E-06
sp|Q8LDB8|RING2_ARATH E3 ubiquitin-protein ligase At1g63170 OS=Arabidopsis thaliana GN=At1g63170 PE=2 SV=2 380 428 3.0E-06
sp|Q8GT75|NIP1_ARATH NEP1-interacting protein 1 OS=Arabidopsis thaliana GN=NIP1 PE=1 SV=2 366 424 4.0E-06
sp|Q9CY62|RN181_MOUSE E3 ubiquitin-protein ligase RNF181 OS=Mus musculus GN=Rnf181 PE=1 SV=1 381 425 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 238 260 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7
MPALASPRLTFAAALTEIRNGVLLFSNPVWDGSKTVPSTLVRNISALSSQLGYEDFITNNLTTLTTNNAPKLDGI
FGGLLFVPRIDSSSSCDAQQYDFIPRNVTRREQLPPRNFNMVALAPWFSIECARAYLDSAAHSPVRALIFFKPNN
STNRPQDVDSPVWSLDDDGAWTKKYHYPIFAVPGLEGQKMMTQLSLYSGSVNQVPHGEQLSQLYGPNPNDFVRIW
TDLTMENQANTPAVWAFVLIVIGALLLIITAVSLIMHFIQRRNRNSLKRRVRSGEVDLEAMGIKRLTVPAAHVEG
FALFTYNAEPDIAAVPPSPTVGSLSSQSRKPSRKSRRSDARTSNKDTALTASTRSVRSIRSKRSSITGTGDTTAT
NFQPNCQICLLSFEHCKTIIRELPCGHIFHPPCIDEFLTQNSSLCPMCKHCMLPQGYSPKITNGMVRREQAVRRL
RERVDLDSSSLESGEPKLKEWGKRLFNYSGHASSNKPPSPPDVLMASLPATQNAVFGSSPAAHNQANDAVSAAPS
RTSGNQVAMESASTSDPSQPPTSTRTARSRKFKPRPLNLLPTHLEESESKETSMGRLSPSSFARERMRQLAAKNA
PIDDPDRQRPYWRRVLSKAFPGF*
Coding >OphauB2|7
ATGCCAGCCTTGGCATCACCACGGCTAACCTTTGCTGCAGCGCTCACCGAGATTCGAAATGGCGTACTCTTGTTC
AGCAACCCCGTCTGGGATGGCTCCAAAACTGTGCCCTCGACTCTGGTCAGAAACATTTCGGCCCTCTCGAGCCAA
CTTGGTTACGAGGACTTCATCACAAACAATCTCACTACCCTGACCACCAACAATGCCCCCAAACTCGATGGCATC
TTTGGTGGCTTACTCTTTGTGCCCCGCATTGACTCGTCCTCGTCGTGCGATGCCCAACAATACGACTTCATCCCC
CGCAACGTCACCCGCCGCGAGCAGCTGCCCCCGAGAAACTTCAACATGGTGGCTCTTGCGCCATGGTTTAGCATC
GAGTGTGCCAGAGCCTATCTCGACTCTGCCGCCCATAGCCCCGTCCGCGCCCTCATCTTCTTCAAACCAAACAAT
TCAACAAACCGCCCACAGGATGTCGACTCTCCTGTCTGGAGCCTCGACGATGACGGCGCCTGGACCAAGAAGTAT
CATTACCCCATTTTTGCCGTGCCCGGTCTCGAGGGCCAAAAAATGATGACACAGCTCAGCCTTTACTCTGGCAGT
GTCAACCAGGTTCCCCATGGCGAGCAGCTCAGCCAACTCTACGGCCCAAATCCAAATGACTTTGTCCGCATATGG
ACCGACTTGACCATGGAAAACCAGGCCAACACCCCTGCCGTCTGGGCTTTTGTTCTCATCGTCATAGGCGCTCTG
CTCCTCATCATAACGGCCGTCTCCCTAATCATGCACTTTATTCAACGTCGCAATCGCAACTCGCTCAAACGCCGT
GTCCGCTCGGGCGAGGTCGATCTCGAGGCCATGGGTATCAAGCGTCTCACCGTGCCCGCCGCCCACGTCGAGGGC
TTTGCCCTTTTCACCTACAATGCTGAGCCCGACATTGCTGCTGTACCGCCCTCTCCCACTGTCGGGAGCCTTTCC
TCACAGTCAAGAAAGCCATCGCGAAAAAGCCGTCGCTCGGATGCGCGCACGTCCAACAAGGACACGGCTCTCACT
GCCAGCACTCGCAGCGTCCGCAGCATCCGCAGCAAGCGATCTAGCATCACTGGCACAGGCGACACGACGGCCACT
AATTTCCAGCCCAATTGCCAGATATGTCTCCTCAGCTTTGAGCACTGCAAAACCATTATTCGTGAACTGCCCTGT
GGCCACATTTTCCATCCACCATGCATTGACGAGTTCCTCACCCAAAACAGCTCTCTCTGTCCAATGTGCAAGCAC
TGCATGTTGCCCCAAGGCTACAGCCCCAAAATCACAAATGGCATGGTGCGTCGCGAGCAGGCTGTGCGCCGCCTG
AGGGAACGCGTCGACCTTGACAGCTCGTCTCTAGAATCCGGGGAGCCCAAGCTCAAGGAATGGGGCAAGCGTCTA
TTCAACTACTCGGGCCATGCATCCTCCAACAAGCCGCCCTCTCCGCCCGACGTGCTCATGGCTTCTTTACCAGCG
ACGCAGAATGCAGTCTTTGGGTCGAGTCCGGCAGCGCACAATCAAGCCAACGACGCTGTATCGGCAGCACCTTCG
CGCACCTCTGGCAATCAAGTTGCTATGGAATCAGCTAGCACCTCGGATCCATCCCAACCACCCACGTCAACCAGA
ACAGCTCGATCCCGCAAGTTTAAGCCTCGGCCTCTAAATCTTTTACCAACACATCTCGAGGAGTCAGAATCCAAG
GAAACATCAATGGGGCGGCTCAGTCCCTCATCATTTGCTCGTGAACGTATGCGCCAACTTGCAGCCAAGAATGCG
CCAATCGACGATCCGGATCGCCAGCGTCCTTATTGGCGTCGAGTGTTATCTAAAGCGTTTCCGGGCTTTTAG
Transcript >OphauB2|7
ATGCCAGCCTTGGCATCACCACGGCTAACCTTTGCTGCAGCGCTCACCGAGATTCGAAATGGCGTACTCTTGTTC
AGCAACCCCGTCTGGGATGGCTCCAAAACTGTGCCCTCGACTCTGGTCAGAAACATTTCGGCCCTCTCGAGCCAA
CTTGGTTACGAGGACTTCATCACAAACAATCTCACTACCCTGACCACCAACAATGCCCCCAAACTCGATGGCATC
TTTGGTGGCTTACTCTTTGTGCCCCGCATTGACTCGTCCTCGTCGTGCGATGCCCAACAATACGACTTCATCCCC
CGCAACGTCACCCGCCGCGAGCAGCTGCCCCCGAGAAACTTCAACATGGTGGCTCTTGCGCCATGGTTTAGCATC
GAGTGTGCCAGAGCCTATCTCGACTCTGCCGCCCATAGCCCCGTCCGCGCCCTCATCTTCTTCAAACCAAACAAT
TCAACAAACCGCCCACAGGATGTCGACTCTCCTGTCTGGAGCCTCGACGATGACGGCGCCTGGACCAAGAAGTAT
CATTACCCCATTTTTGCCGTGCCCGGTCTCGAGGGCCAAAAAATGATGACACAGCTCAGCCTTTACTCTGGCAGT
GTCAACCAGGTTCCCCATGGCGAGCAGCTCAGCCAACTCTACGGCCCAAATCCAAATGACTTTGTCCGCATATGG
ACCGACTTGACCATGGAAAACCAGGCCAACACCCCTGCCGTCTGGGCTTTTGTTCTCATCGTCATAGGCGCTCTG
CTCCTCATCATAACGGCCGTCTCCCTAATCATGCACTTTATTCAACGTCGCAATCGCAACTCGCTCAAACGCCGT
GTCCGCTCGGGCGAGGTCGATCTCGAGGCCATGGGTATCAAGCGTCTCACCGTGCCCGCCGCCCACGTCGAGGGC
TTTGCCCTTTTCACCTACAATGCTGAGCCCGACATTGCTGCTGTACCGCCCTCTCCCACTGTCGGGAGCCTTTCC
TCACAGTCAAGAAAGCCATCGCGAAAAAGCCGTCGCTCGGATGCGCGCACGTCCAACAAGGACACGGCTCTCACT
GCCAGCACTCGCAGCGTCCGCAGCATCCGCAGCAAGCGATCTAGCATCACTGGCACAGGCGACACGACGGCCACT
AATTTCCAGCCCAATTGCCAGATATGTCTCCTCAGCTTTGAGCACTGCAAAACCATTATTCGTGAACTGCCCTGT
GGCCACATTTTCCATCCACCATGCATTGACGAGTTCCTCACCCAAAACAGCTCTCTCTGTCCAATGTGCAAGCAC
TGCATGTTGCCCCAAGGCTACAGCCCCAAAATCACAAATGGCATGGTGCGTCGCGAGCAGGCTGTGCGCCGCCTG
AGGGAACGCGTCGACCTTGACAGCTCGTCTCTAGAATCCGGGGAGCCCAAGCTCAAGGAATGGGGCAAGCGTCTA
TTCAACTACTCGGGCCATGCATCCTCCAACAAGCCGCCCTCTCCGCCCGACGTGCTCATGGCTTCTTTACCAGCG
ACGCAGAATGCAGTCTTTGGGTCGAGTCCGGCAGCGCACAATCAAGCCAACGACGCTGTATCGGCAGCACCTTCG
CGCACCTCTGGCAATCAAGTTGCTATGGAATCAGCTAGCACCTCGGATCCATCCCAACCACCCACGTCAACCAGA
ACAGCTCGATCCCGCAAGTTTAAGCCTCGGCCTCTAAATCTTTTACCAACACATCTCGAGGAGTCAGAATCCAAG
GAAACATCAATGGGGCGGCTCAGTCCCTCATCATTTGCTCGTGAACGTATGCGCCAACTTGCAGCCAAGAATGCG
CCAATCGACGATCCGGATCGCCAGCGTCCTTATTGGCGTCGAGTGTTATCTAAAGCGTTTCCGGGCTTTTAG
Gene >OphauB2|7
ATGCCAGCCTTGGCATCACCACGGCTAACCTTTGCTGCAGCGCTCACCGAGATTCGAAATGGCGTGTACGTGTTT
TCCGACTTGGCCACGGCTGCACAAGGACAAACTGACTTTTGCCGCCCAGACTCTTGTTCAGCAACCCCGTCTGGG
ATGGCTCCAAAACTGTGCCCTCGACTCTGGTCAGAAACATTTCGGCCCTCTCGGTATGCATCATTTGACCCAGTC
TGGCTGCCTCGATTGCCGCTGACGGCTGCCACAGAGCCAACTTGGTTACGAGGACTTCATCACAAACAATCTCAC
TACCCTGACCACCAACAATGCCCCCAAACTCGATGGCATCTTTGGTGGCTTACTCTTTGTGCCCCGCATTGACTC
GTCCTCGTCGTGCGATGCCCAACAATACGACTTCATCCCCCGCAACGTCACCCGCCGCGAGCAGCTGCCCCCGAG
AAACTTCAACATGGTGGCTCTTGCGCCATGGTTTAGCATCGAGTGTGCCAGAGCCTATCTCGACTCTGCCGCCCA
TAGCCCCGTCCGCGCCCTCATCTTCTTCAAACCAAACAATTCAACAAACCGCCCACAGGATGTCGACTCTCCTGT
CTGGAGCCTCGACGATGACGGCGCCTGGACCAAGAAGTATCATTACCCCATTTTTGCCGTGCCCGGTCTCGAGGG
CCAAAAAATGATGACACAGCTCAGCCTTTACTCTGGCAGTGTCAACCAGGTTCCCCATGGCGAGCAGCTCAGCCA
ACTCTACGGCCCAAATCCAAATGACTTTGTCCGCATATGGACCGACTTGACCATGGAAAACCAGGCCAACACCCC
TGCCGTCTGGGCTTTTGTTCTCATCGTCATAGGCGCTCTGCTCCTCATCATAACGGCCGTCTCCCTAATCATGCA
CTTTATTCAACGTCGCAATCGCAACTCGCTCAAACGCCGTGTCCGCTCGGGCGAGGTCGATCTCGAGGCCATGGG
TATCAAGCGTCTCACCGTGCCCGCCGCCCACGTCGAGGGCTTTGCCCTTTTCACCTACAATGCTGAGCCCGACAT
TGCTGCTGTACCGCCCTCTCCCACTGTCGGGAGCCTTTCCTCACAGTCAAGAAAGCCATCGCGAAAAAGCCGTCG
CTCGGATGCGCGCACGTCCAACAAGGACACGGCTCTCACTGCCAGCACTCGCAGCGTCCGCAGCATCCGCAGCAA
GCGATCTAGCATCACTGGCACAGGCGACACGACGGCCACTAATTTCCAGCCCAATTGCCAGATATGTCTCCTCAG
CTTTGAGCACTGCAAAACCATTATTCGTGAACTGCCCTGTGGCCACATTTTCCATCCACCATGCATTGACGAGTT
CCTCACCCAAAACAGCTCTCTCTGTCCAATGTGCAAGCACTGCATGTTGCCCCAAGGCTACAGCCCCAAAATCAC
AAATGGCATGGTGCGTCGCGAGCAGGCTGTGCGCCGCCTGAGGGAACGCGTCGACCTTGACAGCTCGTCTCTAGA
ATCCGGGGAGCCCAAGCTCAAGGAATGGGGCAAGCGTCTATTCAACTACTCGGGCCATGCATCCTCCAACAAGCC
GCCCTCTCCGCCCGACGTGCTCATGGCTTCTTTACCAGCGACGCAGAATGCAGTCTTTGGGTCGAGTCCGGCAGC
GCACAATCAAGCCAACGACGCTGTATCGGCAGCACCTTCGCGCACCTCTGGCAATCAAGTTGCTATGGAATCAGC
TAGCACCTCGGATCCATCCCAACCACCCACGTCAACCAGAACAGCTCGATCCCGCAAGTTTAAGCCTCGGCCTCT
AAATCTTTTACCAACACATCTCGAGGAGTCAGAATCCAAGGAAACATCAATGGGGCGGCTCAGTCCCTCATCATT
TGCTCGTGAACGTATGCGCCAACTTGCAGCCAAGAATGCGCCAATCGACGATCCGGATCGCCAGCGTCCTTATTG
TGAGTCATGATGCGCCTTTTTAATTGGAACACGAGTCTAATCAAGCACGTGTCTAGGGCGTCGAGTGTTATCTAA
AGCGTTTCCGGGCTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail