Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|699
Gene name
LocationContig_113:25719..27085
Strand-
Gene length (bp)1366
Transcript length (bp)1302
Coding sequence length (bp)1302
Protein length (aa) 434

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00188 CAP Cysteine-rich secretory protein family 5.2E-17 289 409

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P47033|PRY3_YEAST Cell wall protein PRY3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY3 PE=1 SV=1 288 431 1.0E-20
sp|P36110|PRY2_YEAST Protein PRY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY2 PE=1 SV=1 282 431 2.0E-20
sp|P47032|PRY1_YEAST Protein PRY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY1 PE=1 SV=1 287 431 3.0E-19
sp|Q59ZX3|RBE1_CANAL Repressed by EFG1 protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RBE1 PE=1 SV=1 288 431 2.0E-16
sp|Q9ET66|PI16_MOUSE Peptidase inhibitor 16 OS=Mus musculus GN=Pi16 PE=2 SV=1 277 425 7.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P47033|PRY3_YEAST Cell wall protein PRY3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY3 PE=1 SV=1 288 431 1.0E-20
sp|P36110|PRY2_YEAST Protein PRY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY2 PE=1 SV=1 282 431 2.0E-20
sp|P47032|PRY1_YEAST Protein PRY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY1 PE=1 SV=1 287 431 3.0E-19
sp|Q59ZX3|RBE1_CANAL Repressed by EFG1 protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RBE1 PE=1 SV=1 288 431 2.0E-16
sp|Q9ET66|PI16_MOUSE Peptidase inhibitor 16 OS=Mus musculus GN=Pi16 PE=2 SV=1 277 425 7.0E-16
sp|A9YME1|VA5_MICHY Venom allergen 5 OS=Microctonus hyperodae PE=2 SV=1 299 428 1.0E-15
sp|Q58D34|PI16_BOVIN Peptidase inhibitor 16 OS=Bos taurus GN=PI16 PE=2 SV=1 280 425 4.0E-15
sp|Q6UXB8|PI16_HUMAN Peptidase inhibitor 16 OS=Homo sapiens GN=PI16 PE=1 SV=1 277 425 2.0E-14
sp|Q9ZNS4|PRB1_ARATH Pathogenesis-related protein 1 OS=Arabidopsis thaliana GN=PRB1 PE=2 SV=1 280 422 5.0E-14
sp|Q6UWM5|GPRL1_HUMAN GLIPR1-like protein 1 OS=Homo sapiens GN=GLIPR1L1 PE=1 SV=2 285 423 2.0E-13
sp|Q08697|PR1A_SOLLC Pathogenesis-related protein 1A1 OS=Solanum lycopersicum PE=2 SV=1 288 431 2.0E-13
sp|Q9CYL5|GAPR1_MOUSE Golgi-associated plant pathogenesis-related protein 1 OS=Mus musculus GN=Glipr2 PE=1 SV=3 276 431 8.0E-13
sp|Q05968|PR1_HORVU Pathogenesis-related protein 1 OS=Hordeum vulgare PE=2 SV=1 288 425 2.0E-12
sp|P35786|VA5_VESSQ Venom allergen 5 OS=Vespula squamosa PE=1 SV=1 253 423 2.0E-12
sp|P35792|PR12_HORVU Pathogenesis-related protein PRB1-2 OS=Hordeum vulgare PE=2 SV=1 288 425 3.0E-12
sp|P35779|VA3_SOLRI Venom allergen 3 OS=Solenopsis richteri PE=1 SV=2 284 433 4.0E-12
sp|P07053|PR1B_TOBAC Pathogenesis-related protein 1B OS=Nicotiana tabacum PE=2 SV=1 288 425 4.0E-12
sp|Q9H4G4|GAPR1_HUMAN Golgi-associated plant pathogenesis-related protein 1 OS=Homo sapiens GN=GLIPR2 PE=1 SV=3 276 431 8.0E-12
sp|W4VS53|CRVP_TRILK CRISP/Allergen/PR-1 OS=Trittame loki PE=1 SV=1 279 428 1.0E-11
sp|Q41359|PR1_SAMNI Pathogenesis-related protein PR-1 type OS=Sambucus nigra PE=2 SV=1 278 425 1.0E-11
sp|Q59PV6|PRY1_CANAL Secreted protein PRY1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRY1 PE=1 SV=1 288 431 2.0E-11
sp|P35787|VA5_VESVI Venom allergen 5 OS=Vespula vidua PE=1 SV=1 269 424 2.0E-11
sp|P35795|SC14_SCHCO Fruiting body protein SC14 OS=Schizophyllum commune GN=SC14 PE=2 SV=1 254 423 2.0E-11
sp|P35760|VA5_VESMC Venom allergen 5 OS=Vespula maculifrons PE=1 SV=1 249 424 3.0E-11
sp|Q5AB48|RBT4_CANAL Secreted protein RBT4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RBT4 PE=1 SV=2 220 425 3.0E-11
sp|P35783|VA5_VESFL Venom allergen 5 OS=Vespula flavopilosa PE=1 SV=1 264 424 3.0E-11
sp|C0ITL3|VA5_PACCH Venom allergen 5 (Fragment) OS=Pachycondyla chinensis PE=2 SV=1 284 426 3.0E-11
sp|Q04108|PR04_SOLLC Pathogenesis-related leaf protein 4 OS=Solanum lycopersicum PE=2 SV=1 288 425 5.0E-11
sp|Q9CWG1|GLIP1_MOUSE Glioma pathogenesis-related protein 1 OS=Mus musculus GN=Glipr1 PE=2 SV=1 281 422 6.0E-11
sp|Q32LB5|GPRL1_BOVIN GLIPR1-like protein 1 OS=Bos taurus GN=GLIPR1L1 PE=2 SV=1 303 422 9.0E-11
sp|P11670|PRB1_TOBAC Basic form of pathogenesis-related protein 1 OS=Nicotiana tabacum PE=3 SV=1 291 425 1.0E-10
sp|P10737|VA53_DOLMA Venom allergen 5.02 (Fragment) OS=Dolichovespula maculata PE=1 SV=3 269 422 1.0E-10
sp|P08299|PR1A_TOBAC Pathogenesis-related protein 1A OS=Nicotiana tabacum PE=1 SV=1 288 425 1.0E-10
sp|O19010|CRIS3_HORSE Cysteine-rich secretory protein 3 OS=Equus caballus GN=CRISP3 PE=1 SV=1 282 422 2.0E-10
sp|P48060|GLIP1_HUMAN Glioma pathogenesis-related protein 1 OS=Homo sapiens GN=GLIPR1 PE=1 SV=3 283 422 2.0E-10
sp|Q05108|VA5_DOLAR Venom allergen 5 OS=Dolichovespula arenaria PE=1 SV=1 269 422 2.0E-10
sp|P04284|PR06_SOLLC Pathogenesis-related leaf protein 6 OS=Solanum lycopersicum GN=PR1B1 PE=1 SV=2 288 425 3.0E-10
sp|Q05110|VA5_VESVU Venom allergen 5 OS=Vespula vulgaris PE=1 SV=1 265 424 3.0E-10
sp|P86870|VA5_VESMG Venom allergen 5 OS=Vespa magnifica PE=1 SV=2 265 423 4.0E-10
sp|Q59WG5|Y2336_CANAL Probable pathogenesis-related protein CaO19.2336 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.2336 PE=2 SV=1 285 431 7.0E-10
sp|Q40374|PR1_MEDTR Pathogenesis-related protein PR-1 OS=Medicago truncatula GN=PR-1 PE=2 SV=1 302 425 9.0E-10
sp|Q2L6Z1|VAL5_VESMC Venom allergen 5 OS=Vespula maculifrons PE=2 SV=1 264 423 1.0E-09
sp|Q5AB49|Y6200_CANAL Probable pathogenesis-related protein CaO19.6200 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.13580 PE=2 SV=1 188 431 1.0E-09
sp|P81656|VA5_POLDO Venom allergen 5 OS=Polistes dominula PE=1 SV=2 280 425 1.0E-09
sp|P35778|VA3_SOLIN Venom allergen 3 OS=Solenopsis invicta PE=1 SV=2 284 433 1.0E-09
sp|P35794|SC7_SCHCO Fruiting body protein SC7 OS=Schizophyllum commune GN=SC7 PE=2 SV=1 285 423 1.0E-09
sp|Q00008|PRMS_MAIZE Pathogenesis-related protein PRMS OS=Zea mays GN=PRMS PE=2 SV=1 292 425 1.0E-09
sp|P35785|VA5_VESPE Venom allergen 5 OS=Vespula pensylvanica PE=1 SV=1 265 423 2.0E-09
sp|P16562|CRIS2_HUMAN Cysteine-rich secretory protein 2 OS=Homo sapiens GN=CRISP2 PE=1 SV=1 283 422 2.0E-09
sp|P35784|VA5_VESGE Venom allergen 5 OS=Vespula germanica PE=1 SV=1 249 423 2.0E-09
sp|P35793|PR13_HORVU Pathogenesis-related protein PRB1-3 OS=Hordeum vulgare PE=2 SV=1 288 425 2.0E-09
sp|P86686|VA5_POLPI Venom allergen 5 OS=Polybia paulista PE=1 SV=1 261 431 3.0E-09
sp|P81657|VA5_VESMA Venom allergen 5 OS=Vespa mandarinia PE=1 SV=1 269 423 4.0E-09
sp|Q7Z156|VA5_POLSR Venom allergen 5 OS=Polybia scutellaris rioplatensis PE=1 SV=2 261 425 4.0E-09
sp|P16563|CRIS2_MOUSE Cysteine-rich secretory protein 2 OS=Mus musculus GN=Crisp2 PE=1 SV=1 283 422 6.0E-09
sp|P09042|PR1C_TOBAC Pathogenesis-related protein 1C OS=Nicotiana tabacum PE=2 SV=3 288 425 9.0E-09
sp|P35780|VA5_POLFU Venom allergen 5 OS=Polistes fuscatus PE=1 SV=1 261 425 2.0E-08
sp|P83377|VA5_POLGA Venom allergen 5 OS=Polistes gallicus PE=1 SV=1 280 425 2.0E-08
sp|B2MVK7|VA5_RHYBR Venom allergen 5 OS=Rhynchium brunneum PE=2 SV=1 303 431 3.0E-08
sp|P33154|PR1_ARATH Pathogenesis-related protein 1 OS=Arabidopsis thaliana GN=At2g14610 PE=1 SV=1 288 422 3.0E-08
sp|Q60477|CRIS2_CAVPO Cysteine-rich secretory protein 2 OS=Cavia porcellus GN=CRISP2 PE=1 SV=1 283 422 4.0E-08
sp|Q09GJ9|CRVP_PHIOL Cysteine-rich venom protein OS=Philodryas olfersii PE=2 SV=1 282 425 5.0E-08
sp|P35781|VA51_VESCR Venom allergen 5.01 OS=Vespa crabro PE=1 SV=1 269 423 5.0E-08
sp|Q8AVA4|CRVP_PSEAU Cysteine-rich venom protein pseudechetoxin OS=Pseudechis australis PE=1 SV=1 288 427 5.0E-08
sp|Q3SB04|CRVP_NOTSC Cysteine-rich venom protein pseudechetoxin-like OS=Notechis scutatus scutatus PE=2 SV=1 281 427 6.0E-08
sp|Q8AVA3|CRVP_PSEPO Cysteine-rich venom protein pseudecin OS=Pseudechis porphyriacus PE=1 SV=1 288 427 6.0E-08
sp|B3EWZ8|ECT_ACRMI Ectin (Fragment) OS=Acropora millepora PE=1 SV=1 249 433 6.0E-08
sp|Q2XXP4|CRVP_TRIBI Cysteine-rich venom protein TRI1 (Fragment) OS=Trimorphodon biscutatus PE=2 SV=1 288 426 7.0E-08
sp|P10736|VA52_DOLMA Venom allergen 5.01 OS=Dolichovespula maculata PE=1 SV=1 269 422 7.0E-08
sp|A8S6B6|CRVP_AUSSU Cysteine-rich venom protein OS=Austrelaps superbus PE=2 SV=1 281 427 7.0E-08
sp|Q05109|VA5_POLAN Venom allergen 5 (Fragment) OS=Polistes annularis PE=1 SV=1 280 425 7.0E-08
sp|Q3KPV7|PI15_XENLA Peptidase inhibitor 15 OS=Xenopus laevis GN=pi15 PE=2 SV=1 249 425 9.0E-08
sp|P35759|VA5_POLEX Venom allergen 5 OS=Polistes exclamans PE=1 SV=2 280 425 1.0E-07
sp|Q3SB03|CRVP_HOPST Cysteine-rich venom protein pseudechetoxin-like OS=Hoplocephalus stephensii PE=2 SV=1 281 427 1.0E-07
sp|Q3SB05|CRVP_PSETE Cysteine-rich venom protein pseudechetoxin-like OS=Pseudonaja textilis PE=1 SV=1 282 427 2.0E-07
sp|Q3SB06|CRVP_OXYMI Cysteine-rich venom protein pseudechetoxin-like OS=Oxyuranus microlepidotus PE=2 SV=1 281 427 2.0E-07
sp|Q2XXQ2|CRVP2_PSEPL Cysteine-rich venom protein ENH2 OS=Pseudoferania polylepis PE=2 SV=1 288 425 2.0E-07
sp|Q2XXQ3|CRVP1_PSEPL Cysteine-rich venom protein ENH1 OS=Pseudoferania polylepis PE=2 SV=1 288 425 2.0E-07
sp|Q2XXQ5|CRVP2_DISTY Cysteine-rich venom protein DIS2 OS=Dispholidus typus PE=2 SV=1 288 425 3.0E-07
sp|Q3SB07|CRVP_OXYSC Cysteine-rich venom protein pseudechetoxin-like OS=Oxyuranus scutellatus scutellatus PE=2 SV=1 281 427 3.0E-07
sp|P60623|CRVP_TRIST Cysteine-rich venom protein (Fragment) OS=Trimeresurus stejnegeri PE=1 SV=1 282 425 4.0E-07
sp|P35782|VA52_VESCR Venom allergen 5.02 OS=Vespa crabro PE=1 SV=1 269 423 4.0E-07
sp|Q03401|CRIS1_MOUSE Cysteine-rich secretory protein 1 OS=Mus musculus GN=Crisp1 PE=2 SV=1 277 425 5.0E-07
sp|Q8JI38|CRVP_LATSE Cysteine-rich venom protein latisemin OS=Laticauda semifasciata PE=2 SV=1 288 427 8.0E-07
sp|B7FDI1|CRVP_VIPBE Cysteine-rich venom protein OS=Vipera berus PE=1 SV=1 282 425 9.0E-07
sp|Q2XXQ6|CRVP1_DISTY Cysteine-rich venom protein DIS1 OS=Dispholidus typus PE=2 SV=1 288 425 9.0E-07
sp|O43692|PI15_HUMAN Peptidase inhibitor 15 OS=Homo sapiens GN=PI15 PE=1 SV=1 279 425 1.0E-06
sp|Q8BS03|PI15_MOUSE Peptidase inhibitor 15 OS=Mus musculus GN=Pi15 PE=2 SV=2 279 425 1.0E-06
sp|Q7ZT98|CRVP_OPHHA Cysteine-rich venom protein ophanin OS=Ophiophagus hannah PE=1 SV=1 288 426 1.0E-06
sp|B7FDI0|CRVP_VIPNI Cysteine-rich venom protein (Fragment) OS=Vipera nikolskii PE=2 SV=1 282 425 1.0E-06
sp|Q7YT83|TX31_CONTE Cysteine-rich venom protein OS=Conus textile PE=1 SV=1 266 418 1.0E-06
sp|Q41495|ST14_SOLTU STS14 protein OS=Solanum tuberosum GN=STS14 PE=2 SV=1 288 425 2.0E-06
sp|Q9CQ35|GRPL2_MOUSE GLIPR1-like protein 2 OS=Mus musculus GN=Glipr1l2 PE=1 SV=1 303 423 2.0E-06
sp|D4B327|PRY1_ARTBC Probable pathogenesis-related protein ARB_02861 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02861 PE=3 SV=2 281 431 2.0E-06
sp|Q2XXQ4|CRVP3_DISTY Cysteine-rich venom protein DIS3 OS=Dispholidus typus PE=2 SV=1 288 425 3.0E-06
sp|Q2XXQ0|CRVP_ERYPO Cysteine-rich venom protein LIO1 (Fragment) OS=Erythrolamprus poecilogyrus PE=2 SV=1 282 425 3.0E-06
sp|Q98ST6|PI15_CHICK Peptidase inhibitor 15 OS=Gallus gallus GN=PI15 PE=2 SV=1 279 425 3.0E-06
sp|P79845|CRVP_PROMU Cysteine-rich venom protein OS=Protobothrops mucrosquamatus PE=2 SV=2 282 425 3.0E-06
sp|F8S0Y4|CRVP_CROAD Cysteine-rich secretory protein OS=Crotalus adamanteus PE=1 SV=1 282 425 3.0E-06
sp|Q2XXQ1|CRVP_LEIMD Cysteine-rich venom protein LEI1 (Fragment) OS=Leioheterodon madagascariensis PE=1 SV=1 288 427 4.0E-06
sp|Q8JI40|CRVP_GLOBL Cysteine-rich venom protein ablomin OS=Gloydius blomhoffii PE=1 SV=1 282 425 6.0E-06
sp|A1BQQ5|MR30_CONMR Cysteine-rich venom protein Mr30 OS=Conus marmoreus PE=1 SV=1 260 418 7.0E-06
sp|Q7T1K6|CRVP1_NAJAT Cysteine-rich venom protein natrin-1 OS=Naja atra PE=1 SV=1 288 425 7.0E-06
sp|F7C0L1|CRISA_XENTR Allurin OS=Xenopus tropicalis GN=crisp-a PE=1 SV=2 322 423 8.0E-06
sp|Q2XXP5|CRVP_TELDH Cysteine-rich venom protein TEL1 (Fragment) OS=Telescopus dhara PE=2 SV=1 288 425 8.0E-06
sp|P84805|CRVP1_NAJKA Cysteine-rich venom protein kaouthin-1 OS=Naja kaouthia PE=1 SV=2 288 425 8.0E-06
sp|Q7ZZN9|CRVP_PROJR Cysteine-rich venom protein OS=Protobothrops jerdonii PE=1 SV=1 282 425 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|699
MRVAVLSLALPLVQAIPQASLLSRGHQTRDIKGPARNPDDGPLPNREWDGPKPIRAWNGPAPNPADDGPEPNPAD
DGPEPNPADDGPEPNPADDGPESNPARDGPREGRKSNQIKANEQPPRKPEPQAQPGQQPSPQPQQQANSGPMNYD
DMILALLRMGMDPDQRSEIEKLLQSSSKDSTFELSTDTPPEADDAQDSGNPKPPPTVNIQQKPKEQKAPVPADKP
LPQPKVNQELPKPKQQAPPPAQPISAKKPATPKPASPKPATPPTSDKPTSGNSVSQDVKDMAVEKHNSYRSKHQA
GPLEWDQGLADEAWNWINRSDKCILGHPSDKDYGQNLYLSRRSNDFTDSSVFDDVSASIDSWYNEIRLHDFSRNY
FVKETGHFTQLVWKSTERVGCATRLCEGENGEWNSMVTGCNYFPAGNMQGAFIENVSR*
Coding >OphauB2|699
ATGCGTGTCGCTGTTTTATCTCTGGCGTTGCCTCTGGTCCAGGCAATCCCCCAGGCAAGTCTGCTGAGCAGAGGC
CACCAGACTCGGGATATCAAAGGTCCTGCACGGAACCCGGACGACGGTCCTCTACCAAACCGAGAGTGGGATGGA
CCCAAGCCGATCAGAGCGTGGAACGGCCCTGCGCCGAATCCCGCTGACGATGGCCCCGAACCGAATCCTGCTGAC
GATGGCCCCGAACCGAATCCTGCTGACGATGGCCCCGAACCGAATCCTGCTGACGATGGCCCTGAGTCGAACCCA
GCTAGGGATGGACCTAGAGAAGGAAGAAAGTCGAATCAAATCAAGGCGAATGAGCAGCCGCCTCGCAAGCCTGAG
CCCCAGGCTCAGCCGGGTCAGCAGCCATCGCCCCAGCCGCAACAACAGGCCAATTCAGGACCCATGAATTATGAC
GACATGATTCTCGCTCTGTTGAGGATGGGCATGGATCCCGATCAACGCAGCGAAATCGAAAAGCTTCTCCAGTCG
TCTTCCAAGGATTCTACCTTTGAGTTGAGCACGGATACCCCCCCCGAGGCGGATGATGCTCAGGACTCTGGAAAC
CCCAAGCCGCCCCCCACTGTCAATATCCAGCAAAAGCCCAAGGAGCAAAAAGCTCCCGTCCCTGCCGACAAACCT
CTGCCCCAACCCAAAGTTAACCAGGAACTCCCCAAGCCCAAGCAGCAAGCTCCTCCTCCTGCTCAGCCCATCAGT
GCCAAGAAGCCCGCAACTCCCAAGCCTGCGTCTCCCAAGCCTGCAACTCCTCCTACTTCGGACAAGCCTACCTCG
GGCAACTCTGTCAGCCAAGATGTCAAGGACATGGCTGTTGAGAAACACAATAGTTATCGCAGCAAGCACCAGGCC
GGACCGTTGGAATGGGACCAAGGTCTTGCCGATGAGGCCTGGAACTGGATCAATCGCAGCGATAAATGCATTCTA
GGACATCCCTCCGACAAAGACTATGGCCAGAACCTTTATTTAAGTCGCAGATCCAATGACTTCACCGATAGTTCA
GTGTTTGACGACGTTTCGGCAAGCATTGATTCATGGTATAATGAAATTCGCCTCCACGACTTTTCGCGCAATTAT
TTCGTTAAGGAAACTGGACATTTTACTCAGCTCGTCTGGAAGTCTACTGAGCGCGTGGGCTGCGCTACTCGATTG
TGTGAAGGGGAAAATGGTGAATGGAATTCTATGGTTACTGGCTGTAACTATTTCCCCGCTGGCAACATGCAAGGC
GCATTCATCGAAAACGTTTCGCGGTAA
Transcript >OphauB2|699
ATGCGTGTCGCTGTTTTATCTCTGGCGTTGCCTCTGGTCCAGGCAATCCCCCAGGCAAGTCTGCTGAGCAGAGGC
CACCAGACTCGGGATATCAAAGGTCCTGCACGGAACCCGGACGACGGTCCTCTACCAAACCGAGAGTGGGATGGA
CCCAAGCCGATCAGAGCGTGGAACGGCCCTGCGCCGAATCCCGCTGACGATGGCCCCGAACCGAATCCTGCTGAC
GATGGCCCCGAACCGAATCCTGCTGACGATGGCCCCGAACCGAATCCTGCTGACGATGGCCCTGAGTCGAACCCA
GCTAGGGATGGACCTAGAGAAGGAAGAAAGTCGAATCAAATCAAGGCGAATGAGCAGCCGCCTCGCAAGCCTGAG
CCCCAGGCTCAGCCGGGTCAGCAGCCATCGCCCCAGCCGCAACAACAGGCCAATTCAGGACCCATGAATTATGAC
GACATGATTCTCGCTCTGTTGAGGATGGGCATGGATCCCGATCAACGCAGCGAAATCGAAAAGCTTCTCCAGTCG
TCTTCCAAGGATTCTACCTTTGAGTTGAGCACGGATACCCCCCCCGAGGCGGATGATGCTCAGGACTCTGGAAAC
CCCAAGCCGCCCCCCACTGTCAATATCCAGCAAAAGCCCAAGGAGCAAAAAGCTCCCGTCCCTGCCGACAAACCT
CTGCCCCAACCCAAAGTTAACCAGGAACTCCCCAAGCCCAAGCAGCAAGCTCCTCCTCCTGCTCAGCCCATCAGT
GCCAAGAAGCCCGCAACTCCCAAGCCTGCGTCTCCCAAGCCTGCAACTCCTCCTACTTCGGACAAGCCTACCTCG
GGCAACTCTGTCAGCCAAGATGTCAAGGACATGGCTGTTGAGAAACACAATAGTTATCGCAGCAAGCACCAGGCC
GGACCGTTGGAATGGGACCAAGGTCTTGCCGATGAGGCCTGGAACTGGATCAATCGCAGCGATAAATGCATTCTA
GGACATCCCTCCGACAAAGACTATGGCCAGAACCTTTATTTAAGTCGCAGATCCAATGACTTCACCGATAGTTCA
GTGTTTGACGACGTTTCGGCAAGCATTGATTCATGGTATAATGAAATTCGCCTCCACGACTTTTCGCGCAATTAT
TTCGTTAAGGAAACTGGACATTTTACTCAGCTCGTCTGGAAGTCTACTGAGCGCGTGGGCTGCGCTACTCGATTG
TGTGAAGGGGAAAATGGTGAATGGAATTCTATGGTTACTGGCTGTAACTATTTCCCCGCTGGCAACATGCAAGGC
GCATTCATCGAAAACGTTTCGCGGTAA
Gene >OphauB2|699
ATGCGTGTCGCTGTTTTATCTCTGGCGTTGCCTCTGGTCCAGGCAATCCCCCAGGCAAGTCTGCTGAGCAGAGGC
CACCAGACTCGGGATATCAAAGGTCCTGCACGGAACCCGGACGACGGTCCTCTACCAAACCGAGAGTGGGATGGA
CCCAAGCCGATCAGAGCGTGGAACGGCCCTGCGCCGAATCCCGCTGACGATGGCCCCGAACCGAATCCTGCTGAC
GATGGCCCCGAACCGAATCCTGCTGACGATGGCCCCGAACCGAATCCTGCTGACGATGGCCCTGAGTCGAACCCA
GCTAGGGATGGACCTAGAGAAGGAAGAAAGTCGAATCAAATCAAGGCGAATGAGCAGCCGCCTCGCAAGCCTGAG
CCCCAGGCTCAGCCGGGTCAGCAGCCATCGCCCCAGCCGCAACAACAGGCCAATTCAGGACCCATGAATTATGAC
GACATGATTCTCGCTCTGTTGAGGATGGGCATGGATCCCGATCAACGCAGCGAAATCGAAAAGCTTCTCCAGTCG
TCTTCCAAGGATTCTACCTTTGAGTTGAGCACGGATACCCCCCCCGAGGCGGATGATGCTCAGGACTCTGGAAAC
CCCAAGCCGCCCCCCACTGTCAATATCCAGCAAAAGCCCAAGGAGCAAAAAGCTCCCGTCCCTGCCGACAAACCT
CTGCCCCAACCCAAAGTTAACCAGGAACTCCCCAAGCCCAAGCAGCAAGCTCCTCCTCCTGCTCAGCCCATCAGT
GCCAAGAAGCCCGCAACTCCCAAGCCTGCGTCTCCCAAGCCTGCAACTCCTCCTACTTCGGACAAGCCTACCTCG
GGCAACTCTGTCAGCCAAGATGTCAAGGACATGGCTGTTGAGAAACACAATAGTTATCGCAGCAAGCACCAGGCC
GGACCGTTGGAATGGGACCAAGGTCTTGCCGATGAGGCCTGGAACTGGATCAATCGCAGCGATAAATGCATTCTA
GGACATCCCTCCGACAAAGACTATGGCCAGAACCTTTATTTAAGTCGCAGATCCAATGACTTCACCGATAGTTCA
GTGTTTGACGACGTTTCGGCAAGCATTGATTCATGGTATAATGAAATTCGCCTCCACGACTTTTCGCGCAATTAT
TTCGTTAAGGAAACTGGACATTTTACTCAGCTCGTCTGGAAGTCTACTGAGCGCGTGGGCTGCGCTACTCGATTG
TGTGAAGGGGAAAATGGTGAATGGAATTCTATGGTTACTGGCTGTAACTATTTCCCCGCTGGTAAGTTCAAAGTC
TTGTCATTGAACCACTCAAAGTGCTTAGTTGGTGCTGATCATTTTCAAAGGCAACATGCAAGGCGCATTCATCGA
AAACGTTTCGCGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail