Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6988
Gene name
LocationContig_7:86595..88188
Strand-
Gene length (bp)1593
Transcript length (bp)1461
Coding sequence length (bp)1461
Protein length (aa) 487

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 45 67 22
3 109 128 19
4 140 162 22
5 199 221 22
6 234 256 22
7 279 301 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6988
MVNTNTAYNIAAGALVLVTAVAAAVVFLCSLCLVRRRKDPARSWLVYYKIAFGLFVFAIILYFFHYLLVVLFDRL
YHSDENKERVAGVVLNLRRAGAETGIVGALATDLVVIFALLALLGLGVGINTVYNNGQKLSLDRWLQFAGFGVAV
LLGSLDLAVFALREKEFSGAYTEQAHDHISGGLKALNTDYKWAGSTKAITLAILTIQFACALAVSVNSIVVAVQT
RLEPRVKTAVRHLLVCCVLLLLRTSYDLGYFLKYVPLHDQYHGDGQSSESNVCFAVVDIVLSFWPTYILFVVLFA
FGTKQQHGIWATPGNFTRVGPGDNSSLTPWGYSSSHQSQQSQEPLQPEWNHSRQTSSQQTRDLEREQTREPVPDQ
ARSPAPSYSPCQVPLPPPAMVQVPSLQSVPSLSSMAPLQPVAPLQVMQPQLDGSNMQPWPAVPAPYFQYPQPYEV
SVASGPPPAHSEAMGLYHQADGTPPSSSPLPYDEKR*
Coding >OphauB2|6988
ATGGTCAACACAAACACGGCTTACAACATTGCCGCCGGCGCCCTCGTGCTCGTCACAGCCGTTGCCGCCGCCGTC
GTGTTTCTCTGCTCGCTGTGTCTTGTCCGGCGTCGCAAAGACCCGGCTCGTTCATGGCTCGTCTATTACAAGATT
GCCTTTGGACTCTTTGTCTTCGCCATTATACTCTACTTCTTCCACTATTTGCTCGTCGTGCTATTTGATCGGCTC
TATCATTCCGACGAGAATAAAGAAAGGGTCGCAGGCGTCGTCTTGAACCTGCGCCGCGCCGGTGCTGAGACGGGC
ATCGTTGGCGCTCTGGCTACCGATCTCGTCGTCATCTTTGCTTTGCTGGCCCTGCTCGGCCTAGGCGTTGGCATC
AACACCGTCTACAACAACGGACAGAAACTGTCGCTGGACCGATGGTTGCAGTTCGCCGGCTTTGGAGTTGCTGTG
CTTCTTGGATCCCTCGACCTTGCCGTATTTGCTTTGCGCGAAAAGGAGTTTTCGGGCGCCTACACCGAGCAGGCC
CATGACCACATCTCAGGCGGCCTCAAGGCTCTCAACACCGACTATAAATGGGCCGGCAGCACAAAGGCCATCACT
CTTGCTATACTTACCATCCAGTTTGCCTGCGCCCTGGCTGTCTCGGTCAACTCCATCGTCGTCGCTGTGCAAACA
CGCCTTGAACCCCGCGTCAAGACTGCCGTTCGCCATTTGTTGGTTTGTTGTGTTCTCTTGCTCCTCAGGACTTCT
TACGACCTGGGCTACTTTCTCAAATATGTCCCCCTGCACGACCAGTACCACGGCGACGGCCAATCGTCCGAGTCT
AATGTGTGCTTCGCCGTCGTCGATATAGTCCTCAGCTTTTGGCCCACCTATATCCTATTCGTTGTCCTCTTCGCC
TTTGGTACCAAGCAGCAGCACGGCATCTGGGCCACTCCGGGCAACTTCACCAGAGTCGGTCCTGGGGACAATAGC
TCCTTGACGCCTTGGGGCTATTCGAGCAGCCATCAAAGCCAGCAAAGTCAGGAGCCCCTGCAGCCAGAGTGGAAC
CACTCCCGACAGACATCGTCACAGCAGACACGCGATCTAGAGCGCGAGCAAACTCGGGAGCCTGTTCCGGACCAA
GCTCGGTCGCCAGCCCCAAGCTATTCCCCCTGCCAGGTGCCGCTGCCTCCACCCGCCATGGTTCAAGTTCCGTCG
CTGCAATCGGTGCCGTCGCTGTCTTCAATGGCACCGTTGCAGCCAGTGGCACCGTTGCAGGTCATGCAGCCCCAG
CTCGATGGCTCCAATATGCAGCCATGGCCGGCTGTGCCTGCTCCCTACTTTCAGTATCCACAGCCATACGAGGTG
AGTGTGGCTAGCGGGCCACCTCCAGCCCATTCTGAGGCTATGGGCCTATACCATCAAGCCGATGGCACGCCGCCT
TCCTCAAGTCCGTTGCCATATGATGAAAAGAGGTGA
Transcript >OphauB2|6988
ATGGTCAACACAAACACGGCTTACAACATTGCCGCCGGCGCCCTCGTGCTCGTCACAGCCGTTGCCGCCGCCGTC
GTGTTTCTCTGCTCGCTGTGTCTTGTCCGGCGTCGCAAAGACCCGGCTCGTTCATGGCTCGTCTATTACAAGATT
GCCTTTGGACTCTTTGTCTTCGCCATTATACTCTACTTCTTCCACTATTTGCTCGTCGTGCTATTTGATCGGCTC
TATCATTCCGACGAGAATAAAGAAAGGGTCGCAGGCGTCGTCTTGAACCTGCGCCGCGCCGGTGCTGAGACGGGC
ATCGTTGGCGCTCTGGCTACCGATCTCGTCGTCATCTTTGCTTTGCTGGCCCTGCTCGGCCTAGGCGTTGGCATC
AACACCGTCTACAACAACGGACAGAAACTGTCGCTGGACCGATGGTTGCAGTTCGCCGGCTTTGGAGTTGCTGTG
CTTCTTGGATCCCTCGACCTTGCCGTATTTGCTTTGCGCGAAAAGGAGTTTTCGGGCGCCTACACCGAGCAGGCC
CATGACCACATCTCAGGCGGCCTCAAGGCTCTCAACACCGACTATAAATGGGCCGGCAGCACAAAGGCCATCACT
CTTGCTATACTTACCATCCAGTTTGCCTGCGCCCTGGCTGTCTCGGTCAACTCCATCGTCGTCGCTGTGCAAACA
CGCCTTGAACCCCGCGTCAAGACTGCCGTTCGCCATTTGTTGGTTTGTTGTGTTCTCTTGCTCCTCAGGACTTCT
TACGACCTGGGCTACTTTCTCAAATATGTCCCCCTGCACGACCAGTACCACGGCGACGGCCAATCGTCCGAGTCT
AATGTGTGCTTCGCCGTCGTCGATATAGTCCTCAGCTTTTGGCCCACCTATATCCTATTCGTTGTCCTCTTCGCC
TTTGGTACCAAGCAGCAGCACGGCATCTGGGCCACTCCGGGCAACTTCACCAGAGTCGGTCCTGGGGACAATAGC
TCCTTGACGCCTTGGGGCTATTCGAGCAGCCATCAAAGCCAGCAAAGTCAGGAGCCCCTGCAGCCAGAGTGGAAC
CACTCCCGACAGACATCGTCACAGCAGACACGCGATCTAGAGCGCGAGCAAACTCGGGAGCCTGTTCCGGACCAA
GCTCGGTCGCCAGCCCCAAGCTATTCCCCCTGCCAGGTGCCGCTGCCTCCACCCGCCATGGTTCAAGTTCCGTCG
CTGCAATCGGTGCCGTCGCTGTCTTCAATGGCACCGTTGCAGCCAGTGGCACCGTTGCAGGTCATGCAGCCCCAG
CTCGATGGCTCCAATATGCAGCCATGGCCGGCTGTGCCTGCTCCCTACTTTCAGTATCCACAGCCATACGAGGTG
AGTGTGGCTAGCGGGCCACCTCCAGCCCATTCTGAGGCTATGGGCCTATACCATCAAGCCGATGGCACGCCGCCT
TCCTCAAGTCCGTTGCCATATGATGAAAAGAGGTGA
Gene >OphauB2|6988
ATGGTCAACACAAACACGGCTTACAACATTGCCGCCGGCGCCCTCGTGCTCGTCACAGCCGTTGCCGCCGCCGTC
GTGTTTCTCTGCTCGCTGTGTCTTGTCCGGCGTCGCAAAGACCCGGCTCGTTCATGGCTCGTCTATTACAAGATT
GCCTTTGGACTCTTTGTCTTGTGAGTTTCATTTTTGAATCAAGTCCGAAAAGCTAGCCCCGGCCGTGGCTGACGT
GAGAGACGATAGCGCCATTATACTCTACTTCTTCCACTATTTGCTCGTCGTGCTATTTGATCGGCTCTATCATTC
CGACGAGAATAAAGAAAGGGTCGCAGGCGTCGTCTTGAACCTGCGCCGCGCCGGTGCTGAGACGGGCATCGTTGG
CGCTCTGGCTACCGATCTCGTCGTCATCTTTGCTTTGCTGGCCCTGCTCGGCCTAGGCGTTGGCATCAACACCGT
CTACAACAACGGACAGAAACTGTCGCTGGACCGATGGTTGCAGTTCGCCGGCTTTGGAGTTGCTGTGCTTCTTGG
ATCCCTCGACCTTGCCGTATTTGCTTTGCGCGAAAAGGAGTTTTCGGGCGCCTACACCGAGCAGGCCCATGACCA
CATCTCAGGCGGCCTCAAGGCTCTCAACACCGACTATAAATGGGCCGGCAGCACAAAGGCCATCACTCTTGCTAT
ACTTACCATCCAGTTTGCCTGCGCCCTGGCTGTCTCGGTCAACTCCATCGTCGTCGCTGTGCAAACACGCCTTGA
ACCCCGCGTCAAGACTGTAAGTGCTCATATCCATAACAGGCTGTCATTGGTGCTCCGATACTCATGGCTCTACCC
AACCAGGCCGTTCGCCATTTGTTGGTTTGTTGTGTTCTCTTGCTCCTCAGGACTTCTTACGACCTGGGCTACTTT
CTCAAATATGTCCCCCTGCACGACCAGTACCACGGCGACGGCCAATCGTCCGAGTCTAATGTGTGCTTCGCCGTC
GTCGATATAGTCCTCAGCTTTTGGCCCACCTATATCCTATTCGTTGTCCTCTTCGCCTTTGGTACCAAGCAGCAG
CACGGCATCTGGGCCACTCCGGGCAACTTCACCAGAGTCGGTCCTGGGGACAATAGCTCCTTGACGCCTTGGGGC
TATTCGAGCAGCCATCAAAGCCAGCAAAGTCAGGAGCCCCTGCAGCCAGAGTGGAACCACTCCCGACAGACATCG
TCACAGCAGACACGCGATCTAGAGCGCGAGCAAACTCGGGAGCCTGTTCCGGACCAAGCTCGGTCGCCAGCCCCA
AGCTATTCCCCCTGCCAGGTGCCGCTGCCTCCACCCGCCATGGTTCAAGTTCCGTCGCTGCAATCGGTGCCGTCG
CTGTCTTCAATGGCACCGTTGCAGCCAGTGGCACCGTTGCAGGTCATGCAGCCCCAGCTCGATGGCTCCAATATG
CAGCCATGGCCGGCTGTGCCTGCTCCCTACTTTCAGTATCCACAGCCATACGAGGTGAGTGTGGCTAGCGGGCCA
CCTCCAGCCCATTCTGAGGCTATGGGCCTATACCATCAAGCCGATGGCACGCCGCCTTCCTCAAGTCCGTTGCCA
TATGATGAAAAGAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail