Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6984
Gene name
LocationContig_7:79771..80848
Strand+
Gene length (bp)1077
Transcript length (bp)1077
Coding sequence length (bp)1077
Protein length (aa) 359

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05742 TANGO2 Transport and Golgi organisation 2 7.9E-63 1 333

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q29RZ5|TNG2_BOVIN Transport and Golgi organization protein 2 homolog OS=Bos taurus GN=TANGO2 PE=2 SV=1 1 291 8.0E-19
sp|P53275|YG37_YEAST Uncharacterized protein YGR127W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR127W PE=1 SV=1 1 333 9.0E-18
sp|Q6ICL3|TNG2_HUMAN Transport and Golgi organization protein 2 homolog OS=Homo sapiens GN=TANGO2 PE=2 SV=1 1 274 1.0E-17
sp|P54797|TNG2_MOUSE Transport and Golgi organization 2 homolog OS=Mus musculus GN=Tango2 PE=1 SV=1 1 336 2.0E-15

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6984
MCIVLLTTAHPDYALILIDNRDEFILRPTTRPQWWKHPLSGGQVLSSRDLQRAEQGTWLGITPTGLLAVLTNYRE
QVDAQAGAIHGTRSRGRMVTAWLGGPADGAQGLDDAVKRLLHDNGGVGGIGGFSMLGGKLRRRGGGVAIISNRAT
RADQVPVIARERGQTWGLSNTVFDDPNEWPKVREGKRLLSLAVERHLARKEKGDAAQQQLVKELFEVLDCDTLPR
MRADAGFDEYIGLLKQTIYVPVIGDTAAVSKPRRGSRGSAVVDGASHATAAAVDELAAQQQRPEASGRRPSASSA
NKAFEEGPYGTQRQTVMLVDWDGNVTFIERALWDDEGNEIARGSGDVVFCFQIQPWDE*
Coding >OphauB2|6984
ATGTGCATAGTCTTGCTGACAACGGCGCACCCCGATTATGCCCTCATTCTCATAGACAACCGCGACGAGTTTATT
CTTCGGCCGACAACTCGGCCCCAGTGGTGGAAGCACCCCTTGTCAGGCGGGCAGGTGCTCTCGTCGCGCGACCTG
CAGCGCGCAGAGCAGGGGACGTGGCTGGGCATCACGCCCACGGGGCTGCTGGCAGTACTGACCAACTATCGCGAG
CAAGTGGATGCACAGGCTGGAGCCATACACGGCACCCGGAGCAGAGGCCGCATGGTGACGGCGTGGCTGGGAGGA
CCAGCCGACGGGGCCCAGGGGCTTGACGACGCCGTCAAGCGGCTGCTGCACGACAACGGCGGAGTCGGCGGCATT
GGCGGCTTCTCCATGCTCGGCGGCAAGCTGCGGCGGCGGGGCGGCGGCGTGGCCATTATCAGCAACCGAGCCACC
AGGGCCGACCAAGTACCCGTCATTGCACGCGAGCGCGGCCAGACGTGGGGGCTGAGCAACACCGTCTTTGACGAT
CCCAACGAATGGCCCAAGGTGCGCGAGGGCAAGCGGCTTCTGTCGCTGGCTGTGGAGCGCCATCTGGCGCGCAAG
GAAAAGGGAGACGCGGCGCAGCAGCAGCTGGTCAAGGAGCTGTTTGAGGTGCTCGACTGCGACACGCTGCCGCGC
ATGAGGGCCGATGCCGGCTTCGACGAGTACATTGGCCTGCTCAAACAGACAATCTACGTGCCCGTCATTGGCGAC
ACGGCAGCCGTGAGCAAGCCTCGGCGCGGCAGCCGCGGAAGCGCCGTGGTTGATGGCGCGTCACACGCTACTGCA
GCGGCTGTCGACGAGCTGGCGGCCCAGCAACAGCGGCCCGAGGCCTCTGGGCGCCGCCCAAGTGCAAGCAGCGCC
AACAAGGCGTTTGAGGAAGGGCCCTATGGCACGCAGAGACAGACTGTCATGCTGGTCGACTGGGACGGCAACGTC
ACCTTTATCGAGCGCGCTCTGTGGGATGACGAGGGCAACGAGATTGCGCGAGGCAGCGGCGACGTTGTCTTTTGC
TTTCAGATTCAGCCATGGGATGAGTAG
Transcript >OphauB2|6984
ATGTGCATAGTCTTGCTGACAACGGCGCACCCCGATTATGCCCTCATTCTCATAGACAACCGCGACGAGTTTATT
CTTCGGCCGACAACTCGGCCCCAGTGGTGGAAGCACCCCTTGTCAGGCGGGCAGGTGCTCTCGTCGCGCGACCTG
CAGCGCGCAGAGCAGGGGACGTGGCTGGGCATCACGCCCACGGGGCTGCTGGCAGTACTGACCAACTATCGCGAG
CAAGTGGATGCACAGGCTGGAGCCATACACGGCACCCGGAGCAGAGGCCGCATGGTGACGGCGTGGCTGGGAGGA
CCAGCCGACGGGGCCCAGGGGCTTGACGACGCCGTCAAGCGGCTGCTGCACGACAACGGCGGAGTCGGCGGCATT
GGCGGCTTCTCCATGCTCGGCGGCAAGCTGCGGCGGCGGGGCGGCGGCGTGGCCATTATCAGCAACCGAGCCACC
AGGGCCGACCAAGTACCCGTCATTGCACGCGAGCGCGGCCAGACGTGGGGGCTGAGCAACACCGTCTTTGACGAT
CCCAACGAATGGCCCAAGGTGCGCGAGGGCAAGCGGCTTCTGTCGCTGGCTGTGGAGCGCCATCTGGCGCGCAAG
GAAAAGGGAGACGCGGCGCAGCAGCAGCTGGTCAAGGAGCTGTTTGAGGTGCTCGACTGCGACACGCTGCCGCGC
ATGAGGGCCGATGCCGGCTTCGACGAGTACATTGGCCTGCTCAAACAGACAATCTACGTGCCCGTCATTGGCGAC
ACGGCAGCCGTGAGCAAGCCTCGGCGCGGCAGCCGCGGAAGCGCCGTGGTTGATGGCGCGTCACACGCTACTGCA
GCGGCTGTCGACGAGCTGGCGGCCCAGCAACAGCGGCCCGAGGCCTCTGGGCGCCGCCCAAGTGCAAGCAGCGCC
AACAAGGCGTTTGAGGAAGGGCCCTATGGCACGCAGAGACAGACTGTCATGCTGGTCGACTGGGACGGCAACGTC
ACCTTTATCGAGCGCGCTCTGTGGGATGACGAGGGCAACGAGATTGCGCGAGGCAGCGGCGACGTTGTCTTTTGC
TTTCAGATTCAGCCATGGGATGAGTAG
Gene >OphauB2|6984
ATGTGCATAGTCTTGCTGACAACGGCGCACCCCGATTATGCCCTCATTCTCATAGACAACCGCGACGAGTTTATT
CTTCGGCCGACAACTCGGCCCCAGTGGTGGAAGCACCCCTTGTCAGGCGGGCAGGTGCTCTCGTCGCGCGACCTG
CAGCGCGCAGAGCAGGGGACGTGGCTGGGCATCACGCCCACGGGGCTGCTGGCAGTACTGACCAACTATCGCGAG
CAAGTGGATGCACAGGCTGGAGCCATACACGGCACCCGGAGCAGAGGCCGCATGGTGACGGCGTGGCTGGGAGGA
CCAGCCGACGGGGCCCAGGGGCTTGACGACGCCGTCAAGCGGCTGCTGCACGACAACGGCGGAGTCGGCGGCATT
GGCGGCTTCTCCATGCTCGGCGGCAAGCTGCGGCGGCGGGGCGGCGGCGTGGCCATTATCAGCAACCGAGCCACC
AGGGCCGACCAAGTACCCGTCATTGCACGCGAGCGCGGCCAGACGTGGGGGCTGAGCAACACCGTCTTTGACGAT
CCCAACGAATGGCCCAAGGTGCGCGAGGGCAAGCGGCTTCTGTCGCTGGCTGTGGAGCGCCATCTGGCGCGCAAG
GAAAAGGGAGACGCGGCGCAGCAGCAGCTGGTCAAGGAGCTGTTTGAGGTGCTCGACTGCGACACGCTGCCGCGC
ATGAGGGCCGATGCCGGCTTCGACGAGTACATTGGCCTGCTCAAACAGACAATCTACGTGCCCGTCATTGGCGAC
ACGGCAGCCGTGAGCAAGCCTCGGCGCGGCAGCCGCGGAAGCGCCGTGGTTGATGGCGCGTCACACGCTACTGCA
GCGGCTGTCGACGAGCTGGCGGCCCAGCAACAGCGGCCCGAGGCCTCTGGGCGCCGCCCAAGTGCAAGCAGCGCC
AACAAGGCGTTTGAGGAAGGGCCCTATGGCACGCAGAGACAGACTGTCATGCTGGTCGACTGGGACGGCAACGTC
ACCTTTATCGAGCGCGCTCTGTGGGATGACGAGGGCAACGAGATTGCGCGAGGCAGCGGCGACGTTGTCTTTTGC
TTTCAGATTCAGCCATGGGATGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail