Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6975
Gene name
LocationContig_7:55755..57999
Strand-
Gene length (bp)2244
Transcript length (bp)1977
Coding sequence length (bp)1977
Protein length (aa) 659

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09825 BPL_N Biotin-protein ligase, N terminal 3.1E-111 7 287
PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family 1.2E-18 394 535

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P48445|BPL1_YEAST Biotin--protein ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BPL1 PE=1 SV=1 6 657 3.0E-119
sp|O14353|BPL1_SCHPO Biotin--protein ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bpl1 PE=3 SV=1 6 657 4.0E-112
sp|Q920N2|BPL1_MOUSE Biotin--protein ligase OS=Mus musculus GN=Hlcs PE=1 SV=1 359 658 8.0E-38
sp|Q9SL92|HCS1_ARATH Biotin--protein ligase 1, chloroplastic OS=Arabidopsis thaliana GN=HCS1 PE=1 SV=2 387 657 2.0E-37
sp|F4I4W2|HCS2_ARATH Biotin--protein ligase 2 OS=Arabidopsis thaliana GN=HCS2 PE=2 SV=1 387 657 2.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P48445|BPL1_YEAST Biotin--protein ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BPL1 PE=1 SV=1 6 657 3.0E-119
sp|O14353|BPL1_SCHPO Biotin--protein ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bpl1 PE=3 SV=1 6 657 4.0E-112
sp|Q920N2|BPL1_MOUSE Biotin--protein ligase OS=Mus musculus GN=Hlcs PE=1 SV=1 359 658 8.0E-38
sp|Q9SL92|HCS1_ARATH Biotin--protein ligase 1, chloroplastic OS=Arabidopsis thaliana GN=HCS1 PE=1 SV=2 387 657 2.0E-37
sp|F4I4W2|HCS2_ARATH Biotin--protein ligase 2 OS=Arabidopsis thaliana GN=HCS2 PE=2 SV=1 387 657 2.0E-37
sp|P50747|BPL1_HUMAN Biotin--protein ligase OS=Homo sapiens GN=HLCS PE=1 SV=1 329 658 1.0E-36
sp|Q9PL03|Y305_CHLMU Uncharacterized protein TC_0305 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=TC_0305 PE=3 SV=1 8 227 1.0E-26
sp|O84038|Y035_CHLTR Uncharacterized protein CT_035 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=CT_035 PE=3 SV=1 8 249 3.0E-25
sp|Q9Z953|Y128_CHLPN Uncharacterized protein CPn_0128/CP_0643/CPj0128/CpB0130 OS=Chlamydia pneumoniae GN=CPn_0128 PE=3 SV=1 5 247 8.0E-22
sp|P46363|BIRA_HAEIN Bifunctional ligase/repressor BirA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=birA PE=3 SV=1 394 624 4.0E-07
sp|P37416|BIRA_SALTY Bifunctional ligase/repressor BirA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=birA PE=3 SV=2 397 582 1.0E-06
sp|Q9JWI7|BICOA_NEIMA Bifunctional enzyme BirA/CoaX OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=birA/coaX PE=3 SV=1 426 582 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0036211 protein modification process Yes
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0043412 macromolecule modification No
GO:0071704 organic substance metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0019538 protein metabolic process No
GO:0043170 macromolecule metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3359
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7535
Ophiocordyceps australis map64 (Brazil) OphauB2|6975 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01097
Ophiocordyceps camponoti-rufipedis Ophun1|251
Ophiocordyceps kimflemingae Ophio5|6851
Ophiocordyceps subramaniannii Hirsu2|6248

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6975
MSSRRLNVLVYTGTGTSVESVRQCIYSLRCLVSDTYAVAPVSETTLLKEPWAATCALLVIPGGADLGYCRVLNGA
GNRLISDYVRRGGAYLGFCAGAYYASRRCEFEVGNGELEVIGSRELALFPGICRGAAFSGFEYGSERGARACQLA
VHGGVFGSQQGLPDSFASYFNGGGVFVDAASVTSRKVQILASYHDAIRVDGGDGKAAIVLCHVGEGKVLLTGPHP
EFAAANLSPQPSVPGYDRLIQELEADDKARVSFLKACLCKLGLEVGLDEAPVATLSSIHVSSPDPTRVTRLIDAW
HLIADNKDDQFFIRGESDTFLIETQQACSGGMPLDRAQGIVDYASITKHIIPHQETLPPSILTPRLNHQLYFSSL
ERFHAEKNNASRWGSLFMYGEVVTSTNSLLEKNPTFMSTLPTGFVFSASTQISARGRGNNAWVAPRGALMFSTII
SHPARLAASRPIVFTQYVAAIAIIEAIQSLGVGYQELPVKLKWPNDIYALDPTSHSERYVKVGGILSQCCYFDGS
YQIVLGIGINANNPRPTTSLSSLAPPHAAPLRLEVLLARLLASLEAVYSQFLREGFSADLEHRYYRHWLHTGQLV
QLEAEGGARARVLGITSDWGMLRVEQTDQDGRGTGKIWTLQSDENSFDFWKGLVRRKQ*
Coding >OphauB2|6975
ATGTCGAGCAGACGGCTCAACGTCCTTGTCTACACTGGCACCGGCACAAGCGTCGAGTCGGTTCGGCAGTGCATC
TACTCGCTGCGCTGCCTAGTCTCCGACACATACGCCGTGGCGCCAGTCAGCGAGACAACGCTTCTCAAGGAGCCC
TGGGCAGCGACGTGTGCTCTTCTCGTCATCCCGGGCGGCGCCGACTTGGGCTACTGCCGCGTCCTCAACGGGGCC
GGGAACCGGCTCATCAGCGACTATGTCCGACGAGGCGGTGCCTATCTCGGCTTCTGTGCCGGCGCCTACTATGCA
AGCCGCCGCTGCGAGTTTGAGGTTGGCAATGGCGAGCTCGAGGTGATTGGAAGCCGCGAGCTGGCTCTGTTCCCC
GGCATCTGTCGCGGTGCTGCCTTTTCAGGCTTTGAGTATGGCAGCGAGAGGGGAGCCCGAGCCTGTCAGCTCGCA
GTCCATGGTGGCGTCTTTGGGTCCCAGCAGGGCCTCCCAGACAGTTTTGCTTCCTACTTCAACGGCGGCGGAGTC
TTTGTCGATGCTGCCAGCGTGACAAGCCGCAAGGTGCAAATCTTGGCCTCGTATCACGACGCCATTCGTGTTGAT
GGTGGTGACGGCAAGGCTGCCATAGTCCTTTGCCACGTGGGAGAGGGCAAGGTGCTCCTTACAGGGCCGCATCCC
GAATTTGCTGCTGCCAATCTCTCGCCTCAGCCCAGCGTGCCCGGATATGACCGACTCATCCAGGAGCTCGAGGCC
GACGACAAAGCTCGCGTCAGCTTCCTCAAGGCATGTCTATGCAAGCTGGGGCTTGAAGTCGGTCTTGACGAGGCT
CCAGTTGCGACGCTGTCGAGCATACACGTTTCCTCCCCCGACCCTACCAGAGTCACGCGTCTTATCGACGCCTGG
CACCTGATTGCAGACAACAAGGACGACCAATTTTTTATCAGGGGCGAGTCAGACACATTTCTCATTGAAACGCAA
CAGGCTTGTTCTGGTGGCATGCCCCTGGACAGGGCGCAAGGAATCGTGGACTATGCGTCTATTACCAAGCACATC
ATCCCTCACCAAGAGACACTTCCGCCATCTATTCTGACGCCGCGCTTGAACCACCAGCTCTACTTCTCAAGTCTT
GAGCGCTTCCACGCAGAAAAAAACAATGCCAGTCGCTGGGGTTCTTTGTTTATGTATGGAGAAGTTGTCACAAGC
ACCAACTCGCTTCTAGAAAAAAACCCAACTTTCATGTCTACATTGCCCACGGGATTCGTCTTTTCGGCATCGACT
CAAATTTCTGCGCGCGGCCGTGGTAACAACGCTTGGGTTGCCCCTCGCGGTGCCCTCATGTTCTCCACAATCATC
AGTCATCCAGCCCGACTCGCCGCCTCTCGGCCCATTGTCTTTACTCAATATGTCGCTGCCATTGCCATTATCGAG
GCTATTCAGTCTCTGGGTGTAGGATACCAAGAGTTGCCAGTCAAGTTAAAATGGCCCAACGATATCTATGCTCTC
GATCCCACTTCTCACTCGGAACGATATGTCAAGGTTGGCGGTATTCTTAGCCAGTGCTGCTACTTTGATGGGTCC
TACCAGATTGTCCTGGGCATAGGCATAAATGCGAACAACCCACGCCCAACTACCTCTCTTTCAAGCCTCGCTCCG
CCTCATGCAGCCCCTCTGCGACTTGAAGTCCTCCTTGCGCGTCTGCTTGCTAGCCTTGAGGCTGTCTACTCCCAA
TTTTTGCGCGAAGGCTTCTCGGCTGATCTTGAGCATCGCTACTATCGTCATTGGTTACACACTGGACAGCTTGTG
CAACTCGAGGCCGAAGGCGGCGCGCGAGCGCGTGTACTTGGCATCACAAGCGACTGGGGGATGCTGCGCGTCGAA
CAGACTGACCAAGACGGCAGGGGCACGGGCAAGATTTGGACCCTGCAGAGCGATGAAAACAGCTTTGATTTCTGG
AAAGGTCTTGTACGCAGGAAGCAGTAG
Transcript >OphauB2|6975
ATGTCGAGCAGACGGCTCAACGTCCTTGTCTACACTGGCACCGGCACAAGCGTCGAGTCGGTTCGGCAGTGCATC
TACTCGCTGCGCTGCCTAGTCTCCGACACATACGCCGTGGCGCCAGTCAGCGAGACAACGCTTCTCAAGGAGCCC
TGGGCAGCGACGTGTGCTCTTCTCGTCATCCCGGGCGGCGCCGACTTGGGCTACTGCCGCGTCCTCAACGGGGCC
GGGAACCGGCTCATCAGCGACTATGTCCGACGAGGCGGTGCCTATCTCGGCTTCTGTGCCGGCGCCTACTATGCA
AGCCGCCGCTGCGAGTTTGAGGTTGGCAATGGCGAGCTCGAGGTGATTGGAAGCCGCGAGCTGGCTCTGTTCCCC
GGCATCTGTCGCGGTGCTGCCTTTTCAGGCTTTGAGTATGGCAGCGAGAGGGGAGCCCGAGCCTGTCAGCTCGCA
GTCCATGGTGGCGTCTTTGGGTCCCAGCAGGGCCTCCCAGACAGTTTTGCTTCCTACTTCAACGGCGGCGGAGTC
TTTGTCGATGCTGCCAGCGTGACAAGCCGCAAGGTGCAAATCTTGGCCTCGTATCACGACGCCATTCGTGTTGAT
GGTGGTGACGGCAAGGCTGCCATAGTCCTTTGCCACGTGGGAGAGGGCAAGGTGCTCCTTACAGGGCCGCATCCC
GAATTTGCTGCTGCCAATCTCTCGCCTCAGCCCAGCGTGCCCGGATATGACCGACTCATCCAGGAGCTCGAGGCC
GACGACAAAGCTCGCGTCAGCTTCCTCAAGGCATGTCTATGCAAGCTGGGGCTTGAAGTCGGTCTTGACGAGGCT
CCAGTTGCGACGCTGTCGAGCATACACGTTTCCTCCCCCGACCCTACCAGAGTCACGCGTCTTATCGACGCCTGG
CACCTGATTGCAGACAACAAGGACGACCAATTTTTTATCAGGGGCGAGTCAGACACATTTCTCATTGAAACGCAA
CAGGCTTGTTCTGGTGGCATGCCCCTGGACAGGGCGCAAGGAATCGTGGACTATGCGTCTATTACCAAGCACATC
ATCCCTCACCAAGAGACACTTCCGCCATCTATTCTGACGCCGCGCTTGAACCACCAGCTCTACTTCTCAAGTCTT
GAGCGCTTCCACGCAGAAAAAAACAATGCCAGTCGCTGGGGTTCTTTGTTTATGTATGGAGAAGTTGTCACAAGC
ACCAACTCGCTTCTAGAAAAAAACCCAACTTTCATGTCTACATTGCCCACGGGATTCGTCTTTTCGGCATCGACT
CAAATTTCTGCGCGCGGCCGTGGTAACAACGCTTGGGTTGCCCCTCGCGGTGCCCTCATGTTCTCCACAATCATC
AGTCATCCAGCCCGACTCGCCGCCTCTCGGCCCATTGTCTTTACTCAATATGTCGCTGCCATTGCCATTATCGAG
GCTATTCAGTCTCTGGGTGTAGGATACCAAGAGTTGCCAGTCAAGTTAAAATGGCCCAACGATATCTATGCTCTC
GATCCCACTTCTCACTCGGAACGATATGTCAAGGTTGGCGGTATTCTTAGCCAGTGCTGCTACTTTGATGGGTCC
TACCAGATTGTCCTGGGCATAGGCATAAATGCGAACAACCCACGCCCAACTACCTCTCTTTCAAGCCTCGCTCCG
CCTCATGCAGCCCCTCTGCGACTTGAAGTCCTCCTTGCGCGTCTGCTTGCTAGCCTTGAGGCTGTCTACTCCCAA
TTTTTGCGCGAAGGCTTCTCGGCTGATCTTGAGCATCGCTACTATCGTCATTGGTTACACACTGGACAGCTTGTG
CAACTCGAGGCCGAAGGCGGCGCGCGAGCGCGTGTACTTGGCATCACAAGCGACTGGGGGATGCTGCGCGTCGAA
CAGACTGACCAAGACGGCAGGGGCACGGGCAAGATTTGGACCCTGCAGAGCGATGAAAACAGCTTTGATTTCTGG
AAAGGTCTTGTACGCAGGAAGCAGTAG
Gene >OphauB2|6975
ATGTCGAGCAGACGGCTCAACGTCCTTGTCTACACTGGCAAGCAGGGCCTTTTCTTGCCATGGACTGGAGCCAGA
GGCTGACACGGCTCGCCAGGCACCGGCACAAGCGTCGAGTCGGTTCGGCAGTGCATCTACTCGCTGCGCTGCCTA
GTCTCCGACACATACGCCGTGGCGCCAGTCAGCGAGACAACGCTTCTCAAGGAGCCCTGGGCAGCGACGTGTGCT
CTTCTCGTCATCCCGGGCGGCGCCGACTTGGGCTACTGCCGCGTCCTCAACGGGGCCGGGAACCGGCTCATCAGC
GACTATGTCCGACGAGGCGGTGCCTATCTCGGCTTCTGTGCCGGCGCCTACTATGCAAGCCGCCGCTGCGAGTTT
GAGGTTGGCAATGGCGAGCTCGAGGTGATTGGAAGCCGCGAGCTGGCTCTGTTCCCCGGCATCTGTCGCGGTGCT
GCCTTTTCAGGCTTTGAGTATGGCAGCGAGAGGGGAGCCCGAGCCTGTCAGCTCGCAGTCCATGGTGGCGTCTTT
GGGTCCCAGCAGGGCCTCCCAGACAGTTTTGCTTCCTACTTCAACGGCGGCGGAGTCTTTGTCGATGCTGCCAGC
GTGACAAGCCGCAAGGTGCAAATCTTGGCCTCGTATCACGACGCCATTCGTGTTGATGGTGGTGACGGCAAGGCT
GCCATAGTCCTTTGCCACGTGGGAGAGGGCAAGGTGCTCCTTACAGGGCCGCATCCCGAGTGAGTGAAGCACACT
CATGCTTGCCCCTCGTGCTTGCCCCTCATGCTTGCCCCTCATGATTGCCGCACAGCGCTCACACTCCCCAGATTT
GCTGCTGCCAATCTCTCGCCTCAGCCCAGCGTGCCCGGATATGACCGACTCATCCAGGAGCTCGAGGCCGACGAC
AAAGCTCGCGTCAGCTTCCTCAAGGCATGTCTATGCAAGCTGGGGCTTGAAGTCGGTCTTGACGAGGCTCCAGTT
GCGACGCTGTCGAGCATACACGTTTCCTCCCCCGACCCTACCAGAGTCACGCGTCTTATCGACGCCTGGCACCTG
ATTGCAGACAACAAGGACGACCAATTTTTTATCAGGGGCGAGTCAGACACATTTCTCATTGAAACGCAACAGGCT
TGTTCTGGTGGCATGCCCCTGGACAGGGCGCAAGGAATCGTGGACTATGCGTCTATTACCAAGCACATCATCCCT
CACCAAGAGACACTTCCGCCATCTATTCTGACGCCGCGCTTGAACCACCAGCTCTACTTCTCAAGTCTTGAGCGC
TTCCACGCAGAAAAAAACAATGCCAGTCGCTGGGGTTCTTTGTTTATGTATGGAGAAGTTGTCACAAGCACCAAC
TCGCTTCTAGAAAAGTAATTAATGCCTGATCCCCCTTGCTTCTAATCCGCATCAAAATCTCTAACTCAAATGCCC
GTTAGAAACCCAACTTTCATGTCTACATTGCCCACGGGATTCGTCTTTTCGGCATCGACTCAAATTTCTGCGCGC
GGCCGTGGTAACAACGCTTGGGTTGCCCCTCGCGGTGCCCTCATGTTCTCCACAATCATCAGTCATCCAGCCCGA
CTCGCCGCCTCTCGGCCCATTGTCTTTACTCAATATGTCGCTGCCATTGCCATTATCGAGGCTATTCAGTCTCTG
GGTGTAGGATACCAAGAGTTGCCAGTCAAGTTAAAATGGCCCAACGATATCTGTGCCGTCTCATGACTGATACTC
GACACAATGAATGCATCACGCTAACTGCATGTAGATGCTCTCGATCCCACTTCTCACTCGGAACGATATGTCAAG
GTTGGCGGTATTCTTAGCCAGTGCTGCTACTTTGATGGGTCCTACCAGATTGTCCTGGGCATAGGCATAAATGCG
AACAACCCACGCCCAACTACCTCTCTTTCAAGCCTCGCTCCGCCTCATGCAGCCCCTCTGCGACTTGAAGTCCTC
CTTGCGCGTCTGCTTGCTAGCCTTGAGGCTGTCTACTCCCAATTTTTGCGCGAAGGCTTCTCGGCTGATCTTGAG
CATCGCTACTATCGTCATTGGTTACACACTGGACAGCTTGTGCAACTCGAGGCCGAAGGCGGCGCGCGAGCGCGT
GTACTTGGCATCACAAGCGACTGGGGGATGCTGCGCGTCGAACAGACTGACCAAGACGGCAGGGGCACGGGCAAG
ATTTGGACCCTGCAGAGCGATGAAAACAGCTTTGATTTCTGGAAAGGTCTTGTACGCAGGAAGCAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail