Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6966
Gene name
LocationContig_7:39465..40931
Strand-
Gene length (bp)1466
Transcript length (bp)972
Coding sequence length (bp)972
Protein length (aa) 324

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 1.9E-16 73 238
PF13649 Methyltransf_25 Methyltransferase domain 2.6E-13 92 180
PF08241 Methyltransf_11 Methyltransferase domain 1.0E-12 93 182
PF08242 Methyltransf_12 Methyltransferase domain 1.4E-08 93 182

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9RX93|TAM_DEIRA Trans-aconitate 2-methyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=tam PE=3 SV=1 91 186 1.0E-09
sp|Q9C6B9|PEAM3_ARATH Phosphoethanolamine N-methyltransferase 3 OS=Arabidopsis thaliana GN=NMT3 PE=2 SV=2 74 180 5.0E-09
sp|C5CSI6|TAM_VARPS Trans-aconitate 2-methyltransferase OS=Variovorax paradoxus (strain S110) GN=tam PE=3 SV=1 91 185 5.0E-09
sp|Q944H0|PEAM2_ARATH Phosphomethylethanolamine N-methyltransferase OS=Arabidopsis thaliana GN=NMT2 PE=2 SV=2 79 180 3.0E-08
sp|Q9FR44|PEAM1_ARATH Phosphoethanolamine N-methyltransferase 1 OS=Arabidopsis thaliana GN=NMT1 PE=1 SV=1 74 180 5.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9RX93|TAM_DEIRA Trans-aconitate 2-methyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=tam PE=3 SV=1 91 186 1.0E-09
sp|Q9C6B9|PEAM3_ARATH Phosphoethanolamine N-methyltransferase 3 OS=Arabidopsis thaliana GN=NMT3 PE=2 SV=2 74 180 5.0E-09
sp|C5CSI6|TAM_VARPS Trans-aconitate 2-methyltransferase OS=Variovorax paradoxus (strain S110) GN=tam PE=3 SV=1 91 185 5.0E-09
sp|Q944H0|PEAM2_ARATH Phosphomethylethanolamine N-methyltransferase OS=Arabidopsis thaliana GN=NMT2 PE=2 SV=2 79 180 3.0E-08
sp|Q9FR44|PEAM1_ARATH Phosphoethanolamine N-methyltransferase 1 OS=Arabidopsis thaliana GN=NMT1 PE=1 SV=1 74 180 5.0E-08
sp|Q9M571|PEAMT_SPIOL Phosphoethanolamine N-methyltransferase OS=Spinacia oleracea GN=PEAMT PE=1 SV=1 79 180 5.0E-08
sp|Q98K73|TAM_RHILO Trans-aconitate 2-methyltransferase OS=Rhizobium loti (strain MAFF303099) GN=tam PE=3 SV=1 89 235 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6966
MATPQHIVVDEHDDEGNDAGSIQSSMTSITSSVLYGVVAEGRRTYAVYGKEEYGFPMDAREMERMDLCHSMYYAL
LEKKRYLSPIGLHPQRILDLGCGTGIWAVDMADDFPSAEVVGVDIAPTQPDWIPPNCTFELDDIEEAWMWKDNSA
DFIFGRDLFLSVRDFPKLIDRCYKHLKPGGWLEMQCVTGIMQCDDGTVPADSAYQHMSDNVKRACERFGTPVDDP
LRWRGWLADRGFTRVTRQIFKLPCSPWALDRRLKLVGMWEQYHLLSNVDGMIMRLFHKALGWTEDEILVFSAMFR
KDLQNLNMHAYFPFYVVYGQKPL*
Coding >OphauB2|6966
ATGGCGACTCCTCAGCATATTGTCGTGGATGAGCACGATGACGAAGGCAATGATGCCGGAAGCATACAGAGCTCC
ATGACATCCATCACCTCGTCGGTTCTCTACGGCGTTGTTGCCGAAGGGAGGCGCACCTATGCAGTCTATGGCAAA
GAAGAATATGGCTTCCCCATGGATGCTCGCGAGATGGAGCGGATGGACCTTTGCCATTCCATGTACTACGCTTTA
TTGGAGAAGAAGCGATACCTCTCTCCAATTGGACTCCATCCCCAAAGGATTCTAGACCTGGGATGTGGCACAGGG
ATATGGGCTGTGGACATGGCCGACGATTTTCCAAGTGCAGAGGTTGTTGGAGTCGACATTGCCCCAACACAACCA
GACTGGATCCCCCCAAACTGCACCTTTGAGCTCGACGACATTGAAGAAGCGTGGATGTGGAAAGACAATAGCGCC
GATTTCATCTTTGGACGCGACCTATTTCTCTCAGTCCGCGATTTCCCCAAGCTCATTGACAGATGCTACAAACAT
CTCAAGCCCGGAGGCTGGCTCGAAATGCAATGCGTGACAGGCATCATGCAATGCGACGATGGCACTGTGCCAGCA
GACAGCGCCTACCAGCACATGTCGGACAATGTGAAGCGCGCGTGCGAGCGTTTCGGAACGCCCGTGGACGATCCG
CTGCGGTGGCGCGGCTGGTTGGCTGATAGAGGCTTTACGCGCGTGACGCGGCAAATATTCAAACTACCATGTTCG
CCGTGGGCGTTGGACAGACGCCTCAAGCTCGTGGGCATGTGGGAGCAGTATCATCTGCTCAGCAATGTCGACGGC
ATGATCATGCGCCTCTTCCACAAGGCACTCGGCTGGACCGAAGACGAAATTCTCGTTTTTTCCGCCATGTTCCGA
AAAGATTTGCAAAACCTCAACATGCATGCCTACTTTCCTTTTTATGTTGTGTATGGCCAGAAGCCACTGTAG
Transcript >OphauB2|6966
ATGGCGACTCCTCAGCATATTGTCGTGGATGAGCACGATGACGAAGGCAATGATGCCGGAAGCATACAGAGCTCC
ATGACATCCATCACCTCGTCGGTTCTCTACGGCGTTGTTGCCGAAGGGAGGCGCACCTATGCAGTCTATGGCAAA
GAAGAATATGGCTTCCCCATGGATGCTCGCGAGATGGAGCGGATGGACCTTTGCCATTCCATGTACTACGCTTTA
TTGGAGAAGAAGCGATACCTCTCTCCAATTGGACTCCATCCCCAAAGGATTCTAGACCTGGGATGTGGCACAGGG
ATATGGGCTGTGGACATGGCCGACGATTTTCCAAGTGCAGAGGTTGTTGGAGTCGACATTGCCCCAACACAACCA
GACTGGATCCCCCCAAACTGCACCTTTGAGCTCGACGACATTGAAGAAGCGTGGATGTGGAAAGACAATAGCGCC
GATTTCATCTTTGGACGCGACCTATTTCTCTCAGTCCGCGATTTCCCCAAGCTCATTGACAGATGCTACAAACAT
CTCAAGCCCGGAGGCTGGCTCGAAATGCAATGCGTGACAGGCATCATGCAATGCGACGATGGCACTGTGCCAGCA
GACAGCGCCTACCAGCACATGTCGGACAATGTGAAGCGCGCGTGCGAGCGTTTCGGAACGCCCGTGGACGATCCG
CTGCGGTGGCGCGGCTGGTTGGCTGATAGAGGCTTTACGCGCGTGACGCGGCAAATATTCAAACTACCATGTTCG
CCGTGGGCGTTGGACAGACGCCTCAAGCTCGTGGGCATGTGGGAGCAGTATCATCTGCTCAGCAATGTCGACGGC
ATGATCATGCGCCTCTTCCACAAGGCACTCGGCTGGACCGAAGACGAAATTCTCGTTTTTTCCGCCATGTTCCGA
AAAGATTTGCAAAACCTCAACATGCATGCCTACTTTCCTTTTTATGTTGTGTATGGCCAGAAGCCACTGTAG
Gene >OphauB2|6966
ATGGCGACTCCTCAGCATATTGTCGTGGATGAGGCAAGTTCAATTGGGCCAGATCTTGCCGGCTTGACGGCTAAC
AAGAATGCCAGCACGATGACGAAGTATGGCTTGACAGCCCAAGACGCAGCCCGGGTGATTGTGTGTTGATGCAGA
GGCAGGGCAATGATGCCGGAAGCATACAGAGCTCCATGACATCCATCACCTCGTCGGTTCTCTACGGCGTTGTTG
CCGAAGGGAGGCGCACCTATGCAGTCTATGGCAAAGAAGGTGAGCAAGAGGCATCGCCCACGTCGGCACAGCTCG
CCTTGTTGACGCATCGCCAGAATATGGCTTCCCCATGGATGCTCGCGAGATGGAGCGGATGGACCTTTGCCATTC
CATGTACTACGCTTTATTGGAGAAGAAGCGATACCTCTCTCCAATTGGACTCCATCCCCAAAGGATTCTAGACCT
GGGATGTGGCACAGGCATGTCCAGGTAAAAGCCGTGGCCGAAGCAACTAGCTAATCATCATGTATGCATAGGGAT
ATGGGCTGTGGACATGGCCGACGATTTTCCAAGTGCAGAGGTGCGTACCAGGAGAGATGGATTCTCTTTTAAAAG
CAAAGGAAAAGGACTGACTCTCGGCAGGTTGTTGGAGTCGACATTGCCCCAACACAACCAGACTGGCAAGTCTCG
CCCAAGACGATACTCTCTCGTTCCATTTTCCCGAGCTTTGCCTCTTGTATACAAGGCTAACGTGGCAATTGTCTC
AGGATCCCCCCAAACTGCACCTTTGAGCTCGACGACATTGAAGAAGCGTGGATGTGGAAAGACAATAGCGCCGAT
TTCATCTTTGGACGCGACCTATTTCTCTCAGTCCGCGATTTCCCCAAGCTCATTGACAGATGCTACAAGTGACTT
CTTTCTTGCCTTTGGGCTTCAAGTGGCGCGCAGAATAACTGACAGGTCCTACGCAGACATCTCAAGCCCGGAGGC
TGGCTCGAAATGCAATGCGTGACAGGCATCATGCAATGCGACGATGGCACTGTGCCAGCAGACAGCGCCTACCAG
CACATGTCGGACAATGTGAAGCGCGCGTGCGAGCGTTTCGGAACGCCCGTGGACGATCCGCTGCGGTGGCGCGGC
TGGTTGGCTGATAGAGGCTTTACGCGCGTGACGCGGCAAATATTCAAACTACCATGTTCGCCGTGGGCGTTGGAC
AGACGCCTCAAGCTCGTGGGCATGTGGGAGCAGTATCATCTGCTCAGCAATGTCGACGGCATGATCATGCGCCTC
TTCCACAAGGCACTCGGCTGGACCGAAGACGAAATTCTCGTTTTTTCCGCCATGTTCCGAAAAGATTTGCAAAAC
CTCAACATGCATGCCTACTTTCCTTTGTGAGTCTGAAGCTTCGACTCTTTGCGGGGAAGCTTGGACTAACAAGGG
AAAAAAAAAGTTATGTTGTGTATGGCCAGAAGCCACTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail