© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | OphauB2|6961 |
| Gene name | |
| Location | Contig_7:28338..29958 |
| Strand | - |
| Gene length (bp) | 1620 |
| Transcript length (bp) | 1500 |
| Coding sequence length (bp) | 1500 |
| Protein length (aa) | 500 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00067 | p450 | Cytochrome P450 | 1.8E-55 | 70 | 468 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q12588|CP52J_CANMA | Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 | 66 | 470 | 2.0E-82 |
| sp|Q12589|CP52K_CANMA | Cytochrome P450 52A11 OS=Candida maltosa GN=CYP52A11 PE=2 SV=1 | 56 | 471 | 8.0E-82 |
| sp|Q9Y757|CP52L_DEBHN | Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 | 27 | 467 | 7.0E-80 |
| sp|P16496|CP52C_CANMA | Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 | 89 | 471 | 2.0E-78 |
| sp|P24458|CP52E_CANMA | Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 | 89 | 470 | 1.0E-77 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q12588|CP52J_CANMA | Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 | 66 | 470 | 2.0E-82 |
| sp|Q12589|CP52K_CANMA | Cytochrome P450 52A11 OS=Candida maltosa GN=CYP52A11 PE=2 SV=1 | 56 | 471 | 8.0E-82 |
| sp|Q9Y757|CP52L_DEBHN | Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 | 27 | 467 | 7.0E-80 |
| sp|P16496|CP52C_CANMA | Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 | 89 | 471 | 2.0E-78 |
| sp|P24458|CP52E_CANMA | Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 | 89 | 470 | 1.0E-77 |
| sp|P30607|CP52B_CANTR | Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 | 8 | 496 | 6.0E-77 |
| sp|Q12586|CP52I_CANMA | Cytochrome P450 52A9 OS=Candida maltosa GN=CYP52A9 PE=1 SV=1 | 80 | 471 | 7.0E-77 |
| sp|Q12581|CP52X_CANMA | Cytochrome P450 52A5 OS=Candida maltosa GN=CYP52A5 PE=1 SV=1 | 79 | 496 | 7.0E-77 |
| sp|Q9Y758|CP52M_DEBHN | Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=CYP52A13 PE=2 SV=1 | 49 | 496 | 8.0E-77 |
| sp|P16141|CP52D_CANMA | Cytochrome P450 52A4 OS=Candida maltosa GN=CYP52A4 PE=1 SV=4 | 80 | 470 | 3.0E-75 |
| sp|P30608|CP52F_CANTR | Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 | 87 | 496 | 6.0E-75 |
| sp|Q12587|CP52Q_CANMA | Cytochrome P450 52C2 OS=Candida maltosa GN=CYP52C2 PE=2 SV=1 | 8 | 497 | 9.0E-73 |
| sp|Q12573|CP52W_CANAP | Cytochrome P450 52E2 OS=Candida apicola GN=CYP52E2 PE=3 SV=1 | 91 | 473 | 4.0E-71 |
| sp|P10615|CP52A_CANTR | Cytochrome P450 52A1 OS=Candida tropicalis GN=CYP52A1 PE=1 SV=3 | 90 | 467 | 3.0E-70 |
| sp|P43083|CP52V_CANAP | Cytochrome P450 52E1 OS=Candida apicola GN=CYP52E1 PE=3 SV=1 | 84 | 473 | 6.0E-70 |
| sp|P30610|CP52H_CANTR | Cytochrome P450 52A8 OS=Candida tropicalis GN=CYP52A8 PE=2 SV=1 | 97 | 470 | 7.0E-69 |
| sp|D4AY62|A1131_ARTBC | Cytochrome P450 ARB_01131 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01131 PE=3 SV=1 | 8 | 499 | 6.0E-67 |
| sp|P30609|CP52G_CANTR | Cytochrome P450 52A7 OS=Candida tropicalis GN=CYP52A7 PE=2 SV=1 | 80 | 496 | 2.0E-66 |
| sp|Q12585|CP52T_CANMA | Cytochrome P450 52D1 OS=Candida maltosa GN=CYP52D1 PE=2 SV=1 | 80 | 470 | 3.0E-65 |
| sp|P30612|CP52P_CANTR | Cytochrome P450 52C1 OS=Candida tropicalis GN=CYP52C1 PE=2 SV=1 | 93 | 494 | 2.0E-63 |
| sp|P30611|CP52N_CANTR | Cytochrome P450 52B1 OS=Candida tropicalis GN=CYP52B1 PE=2 SV=1 | 80 | 498 | 5.0E-53 |
| sp|Q9ZUX1|C94C1_ARATH | Cytochrome P450 94C1 OS=Arabidopsis thaliana GN=CYP94C1 PE=2 SV=1 | 76 | 468 | 7.0E-32 |
| sp|Q9FVS9|C96AF_ARATH | Alkane hydroxylase MAH1 OS=Arabidopsis thaliana GN=CYP96A15 PE=2 SV=1 | 89 | 468 | 1.0E-28 |
| sp|P14581|CP4A7_RABIT | Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 | 85 | 498 | 5.0E-28 |
| sp|P48422|C86A1_ARATH | Cytochrome P450 86A1 OS=Arabidopsis thaliana GN=CYP86A1 PE=1 SV=2 | 93 | 497 | 1.0E-27 |
| sp|O23365|C97B3_ARATH | Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 | 120 | 498 | 2.0E-27 |
| sp|Q50EK3|C04C1_PINTA | Cytochrome P450 704C1 OS=Pinus taeda GN=CYP704C1 PE=2 SV=1 | 47 | 468 | 3.0E-27 |
| sp|Q9FMY1|C86B1_ARATH | Cytochrome P450 86B1 OS=Arabidopsis thaliana GN=CYP86B1 PE=2 SV=1 | 93 | 496 | 3.0E-27 |
| sp|Q9FMV7|C94B1_ARATH | Cytochrome P450 94B1 OS=Arabidopsis thaliana GN=CYP94B1 PE=2 SV=1 | 76 | 498 | 5.0E-27 |
| sp|Q9GJX5|CP4AL_PIG | Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 | 85 | 498 | 6.0E-27 |
| sp|Q93VK5|LUT5_ARATH | Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 | 91 | 468 | 4.0E-26 |
| sp|P14579|CP4A5_RABIT | Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 | 124 | 468 | 7.0E-26 |
| sp|P14580|CP4A6_RABIT | Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 | 124 | 468 | 1.0E-25 |
| sp|Q9SMP5|C94B3_ARATH | Cytochrome P450 94B3 OS=Arabidopsis thaliana GN=CYP94B3 PE=2 SV=1 | 76 | 468 | 3.0E-25 |
| sp|P08516|CP4AA_RAT | Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 | 124 | 498 | 5.0E-25 |
| sp|Q9VYQ7|CP311_DROME | Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 | 62 | 468 | 2.0E-24 |
| sp|O88833|CP4AA_MOUSE | Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 | 294 | 498 | 2.0E-24 |
| sp|Q91WL5|CP4CA_MOUSE | Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 | 294 | 498 | 2.0E-24 |
| sp|O48921|C97B2_SOYBN | Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 | 281 | 498 | 3.0E-24 |
| sp|P20817|CP4AE_RAT | Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2 | 104 | 498 | 1.0E-23 |
| sp|Q8SPK1|CP4AO_PIG | Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 | 294 | 498 | 1.0E-23 |
| sp|O35728|CP4AE_MOUSE | Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 | 104 | 498 | 1.0E-23 |
| sp|Q8SPK0|CP4AP_PIG | Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 | 294 | 498 | 1.0E-23 |
| sp|O81117|C94A1_VICSA | Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE=2 SV=2 | 91 | 470 | 2.0E-23 |
| sp|P20816|CP4A2_RAT | Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 | 119 | 498 | 2.0E-23 |
| sp|P10611|CP4A4_RABIT | Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 | 106 | 498 | 5.0E-23 |
| sp|O08336|CYPB_BACSU | Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 | 90 | 474 | 1.0E-22 |
| sp|P98188|C94A2_VICSA | Cytochrome P450 94A2 OS=Vicia sativa GN=CYP94A2 PE=2 SV=1 | 91 | 498 | 2.0E-22 |
| sp|B3RFJ6|86A22_PETHY | Cytochrome P450 86A22 OS=Petunia hybrida GN=CYP86A22 PE=1 SV=1 | 90 | 461 | 9.0E-22 |
| sp|Q02928|CP4AB_HUMAN | Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1 | 294 | 498 | 9.0E-22 |
| sp|P33270|CP6A2_DROME | Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2 | 92 | 467 | 1.0E-21 |
| sp|Q86W10|CP4Z1_HUMAN | Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 | 120 | 461 | 1.0E-21 |
| sp|Q8N118|CP4X1_HUMAN | Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1 | 123 | 467 | 2.0E-21 |
| sp|O23066|C86A2_ARATH | Cytochrome P450 86A2 OS=Arabidopsis thaliana GN=CYP86A2 PE=1 SV=1 | 90 | 461 | 2.0E-21 |
| sp|Q6A152|CP4X1_MOUSE | Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 | 120 | 468 | 2.0E-21 |
| sp|Q9LMM1|C86A4_ARATH | Cytochrome P450 86A4 OS=Arabidopsis thaliana GN=CYP86A4 PE=1 SV=1 | 90 | 498 | 2.0E-21 |
| sp|Q9DBG1|CP27A_MOUSE | Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 | 127 | 468 | 4.0E-21 |
| sp|Q9VFJ0|CA131_DROME | Probable cytochrome P450 313a1 OS=Drosophila melanogaster GN=Cyp313a1 PE=3 SV=2 | 117 | 468 | 7.0E-21 |
| sp|Q9C788|C70B1_ARATH | Cytochrome P450 704B1 OS=Arabidopsis thaliana GN=CYP704B1 PE=1 SV=1 | 92 | 471 | 8.0E-21 |
| sp|P14779|CPXB_BACME | Bifunctional cytochrome P450/NADPH--P450 reductase OS=Bacillus megaterium GN=cyp102A1 PE=1 SV=2 | 290 | 468 | 1.0E-20 |
| sp|O80823|C86A8_ARATH | Cytochrome P450 86A8 OS=Arabidopsis thaliana GN=CYP86A8 PE=2 SV=1 | 90 | 452 | 1.0E-20 |
| sp|Q6ZWL3|CP4V2_HUMAN | Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 | 120 | 467 | 1.0E-20 |
| sp|P24464|CP4AC_RAT | Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 | 294 | 498 | 2.0E-20 |
| sp|Q9VE00|C12A4_DROME | Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 | 127 | 467 | 2.0E-20 |
| sp|Q9HCS2|CP4FC_HUMAN | Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 | 62 | 467 | 2.0E-20 |
| sp|O46051|C4D14_DROME | Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 | 17 | 468 | 2.0E-20 |
| sp|P17178|CP27A_RAT | Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 | 127 | 470 | 4.0E-20 |
| sp|Q5TCH4|CP4AM_HUMAN | Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1 | 294 | 498 | 5.0E-20 |
| sp|Q9CAD6|C86A7_ARATH | Cytochrome P450 86A7 OS=Arabidopsis thaliana GN=CYP86A7 PE=2 SV=1 | 90 | 463 | 7.0E-20 |
| sp|Q9VA27|CP4C3_DROME | Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 | 294 | 496 | 9.0E-20 |
| sp|Q43078|C97B1_PEA | Cytochrome P450 97B1, chloroplastic OS=Pisum sativum GN=CYP97B1 PE=2 SV=1 | 281 | 456 | 9.0E-20 |
| sp|Q9VG40|CP134_DROME | Probable cytochrome P450 313a4 OS=Drosophila melanogaster GN=Cyp313a4 PE=2 SV=4 | 119 | 467 | 1.0E-19 |
| sp|P98187|CP4F8_HUMAN | Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 | 260 | 461 | 2.0E-19 |
| sp|Q9VCW1|CP6D4_DROME | Probable cytochrome P450 6d4 OS=Drosophila melanogaster GN=Cyp6d4 PE=2 SV=1 | 275 | 498 | 2.0E-19 |
| sp|Q5RCN6|CP4V2_PONAB | Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 | 120 | 467 | 3.0E-19 |
| sp|Q02318|CP27A_HUMAN | Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 | 127 | 470 | 3.0E-19 |
| sp|Q8K4D6|CP4X1_RAT | Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 | 123 | 461 | 4.0E-19 |
| sp|P9WPN2|CP132_MYCTO | Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp132 PE=3 SV=1 | 92 | 467 | 6.0E-19 |
| sp|P59954|CP132_MYCBO | Putative cytochrome P450 132 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp132 PE=3 SV=1 | 92 | 467 | 6.0E-19 |
| sp|Q9VE01|C12A5_DROME | Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1 | 126 | 467 | 7.0E-19 |
| sp|O70537|CP3AV_MESAU | Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 | 297 | 467 | 9.0E-19 |
| sp|Q6TBX7|LUT1_ARATH | Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana GN=CYP97C1 PE=1 SV=1 | 78 | 465 | 1.0E-18 |
| sp|O44221|CP4E5_DROMT | Cytochrome P450 4e5, mitochondrial OS=Drosophila mettleri GN=Cyp4e5 PE=2 SV=1 | 98 | 468 | 2.0E-18 |
| sp|Q9HBI6|CP4FB_HUMAN | Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 | 260 | 461 | 2.0E-18 |
| sp|Q9VVN6|CP312_DROME | Probable cytochrome P450 312a1 OS=Drosophila melanogaster GN=Cyp312a1 PE=2 SV=1 | 119 | 467 | 3.0E-18 |
| sp|Q9W011|C4D20_DROME | Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 | 292 | 468 | 3.0E-18 |
| sp|Q29496|CP3AO_SHEEP | Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 | 288 | 467 | 4.0E-18 |
| sp|P9WPN3|CP132_MYCTU | Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp132 PE=1 SV=1 | 92 | 467 | 4.0E-18 |
| sp|Q27516|C13A8_CAEEL | Putative cytochrome P450 CYP13A8 OS=Caenorhabditis elegans GN=cyp-13A8 PE=3 SV=2 | 297 | 468 | 6.0E-18 |
| sp|Q9VVR9|C12C1_DROME | Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 | 127 | 467 | 6.0E-18 |
| sp|P78329|CP4F2_HUMAN | Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 | 120 | 461 | 7.0E-18 |
| sp|Q9HB55|CP343_HUMAN | Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 | 288 | 467 | 7.0E-18 |
| sp|P51869|CP4F4_RAT | Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 | 90 | 461 | 8.0E-18 |
| sp|Q9V7G5|C4AA1_DROME | Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 | 301 | 498 | 9.0E-18 |
| sp|Q08477|CP4F3_HUMAN | Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 | 260 | 461 | 9.0E-18 |
| sp|O08394|CYPD_BACSU | Bifunctional cytochrome P450/NADPH--P450 reductase 1 OS=Bacillus subtilis (strain 168) GN=cypD PE=1 SV=1 | 236 | 470 | 1.0E-17 |
| sp|Q9GQM9|CP6L1_BLAGE | Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6L1 PE=2 SV=1 | 95 | 466 | 1.0E-17 |
| sp|Q964T1|CP4CU_BLAGE | Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 | 124 | 477 | 1.0E-17 |
| sp|I7CT85|C7A53_PANGI | Protopanaxadiol 6-hydroxylase OS=Panax ginseng PE=1 SV=1 | 294 | 468 | 1.0E-17 |
| sp|Q27589|CP4D2_DROME | Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 | 66 | 468 | 1.0E-17 |
| sp|Q64409|CP3AH_CAVPO | Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 | 288 | 467 | 2.0E-17 |
| sp|P08684|CP3A4_HUMAN | Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 | 297 | 467 | 2.0E-17 |
| sp|P24463|CP3AC_CANLF | Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 | 297 | 467 | 3.0E-17 |
| sp|P33268|CP3A8_MACFA | Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 | 297 | 467 | 3.0E-17 |
| sp|Q64417|CP3AE_CAVPO | Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 | 288 | 467 | 4.0E-17 |
| sp|O15528|CP27B_HUMAN | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 | 182 | 468 | 5.0E-17 |
| sp|P13584|CP4B1_HUMAN | Cytochrome P450 4B1 OS=Homo sapiens GN=CYP4B1 PE=1 SV=2 | 292 | 468 | 5.0E-17 |
| sp|Q9VGB5|CP135_DROME | Probable cytochrome P450 313a5 OS=Drosophila melanogaster GN=Cyp313a5 PE=1 SV=2 | 119 | 467 | 5.0E-17 |
| sp|P51870|CP4F5_RAT | Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 | 120 | 461 | 6.0E-17 |
| sp|Q92045|CP11A_DASAM | Cholesterol side-chain cleavage enzyme, mitochondrial (Fragment) OS=Dasyatis americana GN=CYP11A1 PE=2 SV=1 | 127 | 468 | 6.0E-17 |
| sp|Q9VS79|CP4D8_DROME | Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 | 294 | 468 | 7.0E-17 |
| sp|P05183|CP3A2_RAT | Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 | 297 | 467 | 7.0E-17 |
| sp|P15129|CP4B1_RAT | Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 | 292 | 468 | 9.0E-17 |
| sp|Q9VHP4|CP313_DROME | Probable cytochrome P450 313b1 OS=Drosophila melanogaster GN=Cyp313b1 PE=2 SV=2 | 91 | 467 | 9.0E-17 |
| sp|P33274|CP4F1_RAT | Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 | 90 | 461 | 1.0E-16 |
| sp|P17177|CP27A_RABIT | Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 | 127 | 468 | 1.0E-16 |
| sp|P15128|CP4B1_RABIT | Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 | 294 | 468 | 1.0E-16 |
| sp|Q64464|CP3AD_MOUSE | Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 | 297 | 467 | 1.0E-16 |
| sp|H2DH18|C7A12_PANGI | Cytochrome P450 CYP736A12 OS=Panax ginseng PE=2 SV=1 | 259 | 468 | 1.0E-16 |
| sp|Q9K498|EIZFM_STRCO | Epi-isozizaene 5-monooxygenase/(E)-beta-farnesene synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5223 PE=1 SV=1 | 119 | 472 | 1.0E-16 |
| sp|Q64406|CP3AF_CAVPO | Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 | 288 | 467 | 1.0E-16 |
| sp|Q964Q7|CP6D3_MUSDO | Cytochrome P450 6d3 OS=Musca domestica GN=CYP6D3 PE=2 SV=1 | 95 | 468 | 2.0E-16 |
| sp|O17624|C13B1_CAEEL | Putative cytochrome P450 cyp-13B1 OS=Caenorhabditis elegans GN=cyp-13B1 PE=3 SV=2 | 301 | 473 | 2.0E-16 |
| sp|O35084|CP27B_MOUSE | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 | 181 | 468 | 2.0E-16 |
| sp|Q64462|CP4B1_MOUSE | Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 | 292 | 468 | 2.0E-16 |
| sp|O48786|C734A_ARATH | Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 | 120 | 467 | 2.0E-16 |
| sp|Q9EP75|CP4FE_MOUSE | Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 | 260 | 461 | 3.0E-16 |
| sp|A2RRT9|CP4V2_RAT | Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 | 120 | 498 | 3.0E-16 |
| sp|Q9DBW0|CP4V2_MOUSE | Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 | 120 | 467 | 3.0E-16 |
| sp|Q9V4U7|C6A14_DROME | Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=3 SV=2 | 297 | 498 | 4.0E-16 |
| sp|Q7Y1V5|C78AB_ORYSJ | Cytochrome P450 78A11 OS=Oryza sativa subsp. japonica GN=CYP78A11 PE=1 SV=2 | 90 | 468 | 4.0E-16 |
| sp|Q59990|CP120_SYNY3 | Putative cytochrome P450 120 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cyp120 PE=1 SV=1 | 261 | 496 | 4.0E-16 |
| sp|Q964R0|CP6K1_BLAGE | Cytochrome P450 6k1 OS=Blattella germanica GN=CYP6K1 PE=2 SV=1 | 86 | 468 | 5.0E-16 |
| sp|O18635|C12A2_MUSDO | Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 | 126 | 467 | 5.0E-16 |
| sp|Q6NKZ8|C14A2_ARATH | Cytochrome P450 714A2 OS=Arabidopsis thaliana GN=CYP714A2 PE=2 SV=1 | 290 | 467 | 5.0E-16 |
| sp|Q27520|C13A1_CAEEL | Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 | 127 | 497 | 5.0E-16 |
| sp|P17549|CP53_ASPNG | Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 | 179 | 468 | 6.0E-16 |
| sp|P51538|CP3A9_RAT | Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 | 285 | 467 | 7.0E-16 |
| sp|Q27518|C13A2_CAEEL | Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 | 180 | 497 | 7.0E-16 |
| sp|B9X287|C7346_ORYSJ | Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 | 301 | 468 | 8.0E-16 |
| sp|Q64658|C11B2_MESAU | Cytochrome P450 11B2, mitochondrial OS=Mesocricetus auratus GN=CYP11B2 PE=2 SV=1 | 124 | 467 | 8.0E-16 |
| sp|P79401|CP3AT_PIG | Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 | 297 | 467 | 8.0E-16 |
| sp|Q07217|CP11A_ONCMY | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Oncorhynchus mykiss GN=cyp11a1 PE=2 SV=1 | 127 | 467 | 1.0E-15 |
| sp|P48420|C78A1_MAIZE | Cytochrome P450 78A1 OS=Zea mays GN=CYP78A1 PE=2 SV=1 | 90 | 468 | 1.0E-15 |
| sp|P20815|CP3A5_HUMAN | Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 | 297 | 467 | 1.0E-15 |
| sp|Q98T91|C340_ORYLA | Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 | 297 | 468 | 1.0E-15 |
| sp|Q64481|CP3AG_MOUSE | Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 | 297 | 467 | 2.0E-15 |
| sp|P79152|CP3AJ_CAPHE | Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 | 297 | 470 | 2.0E-15 |
| sp|P29981|CP4C1_BLADI | Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 | 294 | 496 | 2.0E-15 |
| sp|P51871|CP4F6_RAT | Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 | 294 | 461 | 2.0E-15 |
| sp|O18993|CP3AL_CALJA | Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 | 297 | 467 | 3.0E-15 |
| sp|Q9VLZ7|C4D21_DROME | Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 | 31 | 468 | 3.0E-15 |
| sp|Q6NT55|CP4FN_HUMAN | Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 | 265 | 461 | 3.0E-15 |
| sp|P11707|CP3A6_RABIT | Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 | 297 | 467 | 3.0E-15 |
| sp|Q99N16|CP4F3_MOUSE | Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 | 294 | 461 | 3.0E-15 |
| sp|Q64408|C11B1_CAVPO | Cytochrome P450 11B1, mitochondrial OS=Cavia porcellus GN=CYP11B1 PE=2 SV=1 | 127 | 467 | 3.0E-15 |
| sp|P33269|CP4D1_DROME | Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 | 294 | 468 | 4.0E-15 |
| sp|Q9Y6A2|CP46A_HUMAN | Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1 | 90 | 468 | 4.0E-15 |
| sp|O16805|CP4D1_DROSI | Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 | 294 | 468 | 4.0E-15 |
| sp|Q9VFP1|CP6D5_DROME | Probable cytochrome P450 6d5 OS=Drosophila melanogaster GN=Cyp6d5 PE=2 SV=1 | 297 | 468 | 4.0E-15 |
| sp|O54749|CP2J5_MOUSE | Cytochrome P450 2J5 OS=Mus musculus GN=Cyp2j5 PE=1 SV=1 | 6 | 467 | 4.0E-15 |
| sp|P04800|CP3A1_RAT | Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 | 297 | 467 | 4.0E-15 |
| sp|P82713|CP392_DROME | Probable cytochrome P450 309a2 OS=Drosophila melanogaster GN=Cyp309a2 PE=2 SV=2 | 273 | 472 | 4.0E-15 |
| sp|Q43068|C82A1_PEA | Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 | 294 | 471 | 5.0E-15 |
| sp|P24462|CP3A7_HUMAN | Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 | 294 | 467 | 5.0E-15 |
| sp|P52786|CP2J1_RABIT | Cytochrome P450 2J1 OS=Oryctolagus cuniculus GN=CYP2J1 PE=1 SV=2 | 239 | 467 | 5.0E-15 |
| sp|Q3MID2|CP4F3_RAT | Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 | 294 | 461 | 6.0E-15 |
| sp|P82712|CCD1P_DROME | Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 | 126 | 467 | 6.0E-15 |
| sp|O09158|CP3AP_MOUSE | Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 | 297 | 467 | 9.0E-15 |
| sp|Q64581|CP3AI_RAT | Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 | 297 | 468 | 9.0E-15 |
| sp|P15150|C11B1_BOVIN | Cytochrome P450 11B1, mitochondrial OS=Bos taurus GN=CYP11B1 PE=1 SV=2 | 127 | 467 | 1.0E-14 |
| sp|P9WPM1|CP139_MYCTU | Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp139 PE=1 SV=1 | 235 | 463 | 1.0E-14 |
| sp|P9WPM0|CP139_MYCTO | Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp139 PE=3 SV=1 | 235 | 463 | 1.0E-14 |
| sp|P63720|CP139_MYCBO | Putative cytochrome P450 139 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp139 PE=3 SV=1 | 235 | 463 | 1.0E-14 |
| sp|Q27515|C13A6_CAEEL | Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 | 297 | 497 | 1.0E-14 |
| sp|Q7KR10|CCD1D_DROME | Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 | 126 | 467 | 2.0E-14 |
| sp|Q64459|CP3AB_MOUSE | Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 | 297 | 467 | 2.0E-14 |
| sp|H1A981|C7263_MEDTR | 11-oxo-beta-amyrin 30-oxidase OS=Medicago truncatula GN=CYP72A63 PE=1 SV=1 | 63 | 467 | 2.0E-14 |
| sp|Q9XS28|CP19A_SHEEP | Aromatase OS=Ovis aries GN=CYP19A1 PE=2 SV=1 | 298 | 476 | 2.0E-14 |
| sp|Q6YI21|CP19A_CAPHI | Aromatase OS=Capra hircus GN=CYP19A1 PE=2 SV=1 | 298 | 476 | 2.0E-14 |
| sp|O42563|CP3AR_ONCMY | Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 | 297 | 467 | 3.0E-14 |
| sp|P51663|C11B1_SHEEP | Cytochrome P450 11B1, mitochondrial OS=Ovis aries GN=CYP11B1 PE=2 SV=2 | 127 | 467 | 3.0E-14 |
| sp|P97720|C11B1_MESAU | Cytochrome P450 11B1, mitochondrial OS=Mesocricetus auratus GN=CYP11B1 PE=2 SV=1 | 124 | 467 | 3.0E-14 |
| sp|O46054|C4AE1_DROME | Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 | 265 | 468 | 3.0E-14 |
| sp|Q5QQX7|CP19A_CANLF | Aromatase OS=Canis lupus familiaris GN=CYP19A1 PE=2 SV=1 | 291 | 467 | 3.0E-14 |
| sp|Q4G0S4|C27C1_HUMAN | Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 | 297 | 468 | 3.0E-14 |
| sp|P79102|CP3AS_BOVIN | Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 | 301 | 467 | 4.0E-14 |
| sp|Q27517|C13A3_CAEEL | Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 | 254 | 497 | 4.0E-14 |
| sp|Q9V4U9|C6A13_DROME | Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 | 297 | 452 | 5.0E-14 |
| sp|P51590|CP2J3_RAT | Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 | 239 | 467 | 5.0E-14 |
| sp|P48416|CP10_LYMST | Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 | 127 | 467 | 5.0E-14 |
| sp|P51589|CP2J2_HUMAN | Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 | 298 | 467 | 6.0E-14 |
| sp|Q6V0L0|CP26C_HUMAN | Cytochrome P450 26C1 OS=Homo sapiens GN=CYP26C1 PE=2 SV=2 | 247 | 452 | 6.0E-14 |
| sp|P46194|CP19A_BOVIN | Aromatase OS=Bos taurus GN=CYP19A1 PE=2 SV=3 | 291 | 476 | 7.0E-14 |
| sp|Q9V8M2|C12B2_DROME | Probable cytochrome P450 12b2, mitochondrial OS=Drosophila melanogaster GN=Cyp12b2 PE=2 SV=2 | 127 | 468 | 7.0E-14 |
| sp|Q9VL92|CP4E3_DROME | Cytochrome P450 4e3 OS=Drosophila melanogaster GN=Cyp4e3 PE=2 SV=1 | 291 | 468 | 7.0E-14 |
| sp|P15538|C11B1_HUMAN | Cytochrome P450 11B1, mitochondrial OS=Homo sapiens GN=CYP11B1 PE=1 SV=5 | 127 | 450 | 7.0E-14 |
| sp|Q8AXY5|C356_FUNHE | Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 | 297 | 467 | 8.0E-14 |
| sp|H1A988|C7254_GLYUR | 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 | 81 | 467 | 9.0E-14 |
| sp|P79739|CP26A_DANRE | Cytochrome P450 26A1 OS=Danio rerio GN=cyp26a1 PE=2 SV=1 | 182 | 452 | 9.0E-14 |
| sp|Q29527|C11B1_PAPHU | Cytochrome P450 11B1, mitochondrial OS=Papio hamadryas ursinus GN=CYP11B1 PE=3 SV=1 | 127 | 450 | 9.0E-14 |
| sp|P30437|CP17A_ONCMY | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oncorhynchus mykiss GN=cyp17a1 PE=2 SV=1 | 68 | 465 | 1.0E-13 |
| sp|Q9V559|CP4P3_DROME | Probable cytochrome P450 4p3 OS=Drosophila melanogaster GN=Cyp4p3 PE=2 SV=3 | 290 | 496 | 1.0E-13 |
| sp|Q64148|CP3AA_MESAU | Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 | 297 | 467 | 1.0E-13 |
| sp|Q09653|C13AA_CAEEL | Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 | 297 | 498 | 1.0E-13 |
| sp|Q9PVE8|C330_FUNHE | Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 | 297 | 467 | 1.0E-13 |
| sp|P15393|C11B1_RAT | Cytochrome P450 11B1, mitochondrial OS=Rattus norvegicus GN=Cyp11b1 PE=1 SV=1 | 126 | 468 | 1.0E-13 |
| sp|Q9VYY4|C4G15_DROME | Cytochrome P450 4g15 OS=Drosophila melanogaster GN=Cyp4g15 PE=2 SV=1 | 294 | 497 | 1.0E-13 |
| sp|Q09128|CP24A_RAT | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 | 127 | 468 | 2.0E-13 |
| sp|Q95031|CP6B6_HELAM | Cytochrome P450 6B6 OS=Helicoverpa armigera GN=CYP6B6 PE=2 SV=1 | 95 | 467 | 2.0E-13 |
| sp|Q6YTF1|C76M8_ORYSJ | Oryzalexin D synthase OS=Oryza sativa subsp. japonica GN=CYP76M8 PE=1 SV=1 | 247 | 468 | 2.0E-13 |
| sp|Q9CX98|CP2U1_MOUSE | Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 | 301 | 467 | 2.0E-13 |
| sp|Q9JMA7|CP341_MOUSE | Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 | 297 | 467 | 2.0E-13 |
| sp|Q29605|CP19A_RABIT | Aromatase OS=Oryctolagus cuniculus GN=CYP19A1 PE=2 SV=1 | 291 | 476 | 2.0E-13 |
| sp|Q95M61|CP19A_CALJA | Aromatase OS=Callithrix jacchus GN=CYP19A1 PE=2 SV=2 | 291 | 476 | 2.0E-13 |
| sp|P08682|CP2E1_RABIT | Cytochrome P450 2E1 OS=Oryctolagus cuniculus GN=CYP2E1 PE=2 SV=2 | 76 | 467 | 2.0E-13 |
| sp|P15539|C11B2_MOUSE | Cytochrome P450 11B2, mitochondrial OS=Mus musculus GN=Cyp11b2 PE=2 SV=3 | 293 | 468 | 2.0E-13 |
| sp|Q7KWN2|C525A_DICDI | Probable cytochrome P450 525A1 OS=Dictyostelium discoideum GN=cyp525A1 PE=3 SV=1 | 301 | 468 | 2.0E-13 |
| sp|Q9Y8G7|C505_FUSOX | Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 | 78 | 467 | 2.0E-13 |
| sp|Q9VB31|C6A18_DROME | Probable cytochrome P450 6a18 OS=Drosophila melanogaster GN=Cyp6a18 PE=2 SV=1 | 92 | 467 | 2.0E-13 |
| sp|Q27698|CP6D1_MUSDO | Cytochrome P450 6d1 OS=Musca domestica GN=CYP6D1 PE=1 SV=1 | 95 | 467 | 2.0E-13 |
| sp|O55127|CP26A_MOUSE | Cytochrome P450 26A1 OS=Mus musculus GN=Cyp26a1 PE=2 SV=1 | 182 | 452 | 2.0E-13 |
| sp|Q29552|C11B1_PIG | Cytochrome P450 11B1, mitochondrial OS=Sus scrofa GN=CYP11B1 PE=2 SV=1 | 127 | 467 | 3.0E-13 |
| sp|Q07973|CP24A_HUMAN | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 | 125 | 452 | 3.0E-13 |
| sp|P38364|PID6_FUSSO | Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 | 135 | 478 | 3.0E-13 |
| sp|B9G934|C14C3_ORYSJ | Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica GN=CYP714C3 PE=3 SV=2 | 78 | 467 | 3.0E-13 |
| sp|B6SSW8|C14B3_MAIZE | Cytochrome P450 714B3 OS=Zea mays GN=CYP714B3 PE=2 SV=1 | 296 | 467 | 3.0E-13 |
| sp|P29980|CPXN_NOSS1 | Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 | 294 | 468 | 3.0E-13 |
| sp|P19099|C11B2_HUMAN | Cytochrome P450 11B2, mitochondrial OS=Homo sapiens GN=CYP11B2 PE=1 SV=3 | 127 | 450 | 4.0E-13 |
| sp|Q0IIF9|CP2U1_BOVIN | Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 | 301 | 467 | 4.0E-13 |
| sp|Q9V558|CP4P1_DROME | Cytochrome P450 4p1 OS=Drosophila melanogaster GN=Cyp4p1 PE=2 SV=1 | 344 | 496 | 4.0E-13 |
| sp|Q69XM6|C7344_ORYSJ | Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 | 301 | 468 | 4.0E-13 |
| sp|Q9VGB3|CP133_DROME | Probable cytochrome P450 313a3 OS=Drosophila melanogaster GN=Cyp313a3 PE=3 SV=2 | 42 | 463 | 4.0E-13 |
| sp|P30099|C11B2_RAT | Cytochrome P450 11B2, mitochondrial OS=Rattus norvegicus GN=Cyp11b2 PE=1 SV=1 | 126 | 468 | 4.0E-13 |
| sp|O65782|C83B1_ARATH | Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 | 242 | 468 | 4.0E-13 |
| sp|Q2QYH7|C14C2_ORYSJ | Cytochrome P450 714C2 OS=Oryza sativa subsp. japonica GN=CYP714C2 PE=2 SV=1 | 78 | 468 | 5.0E-13 |
| sp|Q12645|PID9_FUSSO | Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 | 135 | 478 | 5.0E-13 |
| sp|Q6Z6D6|C7342_ORYSJ | Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 | 265 | 468 | 5.0E-13 |
| sp|Q27606|CP4E2_DROME | Cytochrome P450 4e2 OS=Drosophila melanogaster GN=Cyp4e2 PE=2 SV=2 | 290 | 468 | 5.0E-13 |
| sp|Q4V8D1|CP2U1_RAT | Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 | 301 | 467 | 5.0E-13 |
| sp|Q27594|CP6A9_DROME | Cytochrome P450 6a9 OS=Drosophila melanogaster GN=Cyp6a9 PE=2 SV=3 | 128 | 456 | 5.0E-13 |
| sp|Q69X58|C76M7_ORYSJ | Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 | 247 | 468 | 5.0E-13 |
| sp|Q9GMC8|CP17A_FELCA | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Felis catus GN=CYP17A1 PE=2 SV=1 | 47 | 468 | 5.0E-13 |
| sp|B5BSX1|BAMO_GLYUR | Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 | 247 | 471 | 6.0E-13 |
| sp|Q9STL0|C71AN_ARATH | Cytochrome P450 71A23 OS=Arabidopsis thaliana GN=CYP71A23 PE=2 SV=1 | 290 | 468 | 6.0E-13 |
| sp|Q09J78|ABAH2_ORYSI | Abscisic acid 8'-hydroxylase 2 OS=Oryza sativa subsp. indica GN=CYP707A6 PE=2 SV=1 | 284 | 498 | 6.0E-13 |
| sp|Q6ZDE3|ABAH2_ORYSJ | Abscisic acid 8'-hydroxylase 2 OS=Oryza sativa subsp. japonica GN=CYP707A6 PE=2 SV=1 | 284 | 498 | 6.0E-13 |
| sp|Q9WVK8|CP46A_MOUSE | Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=1 SV=1 | 269 | 468 | 7.0E-13 |
| sp|P30100|C11B3_RAT | Cytochrome P450 11B3, mitochondrial OS=Rattus norvegicus GN=Cyp11b3 PE=1 SV=1 | 126 | 468 | 7.0E-13 |
| sp|P22443|CP19A_RAT | Aromatase OS=Rattus norvegicus GN=Cyp19a1 PE=2 SV=1 | 298 | 467 | 7.0E-13 |
| sp|O35293|CP2F2_RAT | Cytochrome P450 2F2 OS=Rattus norvegicus GN=Cyp2f2 PE=2 SV=1 | 300 | 486 | 8.0E-13 |
| sp|Q69FB6|CP19A_LAGAC | Aromatase OS=Lagenorhynchus acutus GN=CYP19A1 PE=2 SV=1 | 298 | 476 | 8.0E-13 |
| sp|Q93Z79|C14A1_ARATH | Cytochrome P450 714A1 OS=Arabidopsis thaliana GN=CYP714A1 PE=2 SV=1 | 291 | 467 | 8.0E-13 |
| sp|O13820|ERG5_SCHPO | Cytochrome P450 61 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg5 PE=1 SV=3 | 191 | 471 | 8.0E-13 |
| sp|Q1ZXL7|C5083_DICDI | Probable cytochrome P450 508A3 OS=Dictyostelium discoideum GN=cyp508A3-1 PE=3 SV=1 | 109 | 498 | 9.0E-13 |
| sp|Q54DT2|C516A_DICDI | Probable cytochrome P450 516A1 OS=Dictyostelium discoideum GN=cyp516A1 PE=3 SV=2 | 34 | 472 | 9.0E-13 |
| sp|Q50EK1|C16B1_PICSI | Cytochrome P450 716B1 OS=Picea sitchensis GN=CYP716B1 PE=2 SV=1 | 294 | 468 | 1.0E-12 |
| sp|Q0DS59|C14B2_ORYSJ | Cytochrome P450 714B2 OS=Oryza sativa subsp. japonica GN=CYP714B2 PE=1 SV=2 | 296 | 467 | 1.0E-12 |
| sp|Q54KV0|C513B_DICDI | Probable cytochrome P450 513B1 OS=Dictyostelium discoideum GN=cyp513B1 PE=3 SV=1 | 183 | 498 | 1.0E-12 |
| sp|Q7Z449|CP2U1_HUMAN | Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 | 301 | 467 | 1.0E-12 |
| sp|P33267|CP2F2_MOUSE | Cytochrome P450 2F2 OS=Mus musculus GN=Cyp2f2 PE=1 SV=1 | 243 | 486 | 1.0E-12 |
| sp|O73686|CP192_CARAU | Ovarian aromatase OS=Carassius auratus GN=cyp19a2 PE=2 SV=1 | 294 | 454 | 1.0E-12 |
| sp|Q9V776|CP317_DROME | Probable cytochrome P450 317a1 OS=Drosophila melanogaster GN=Cyp317a1 PE=3 SV=2 | 95 | 451 | 1.0E-12 |
| sp|Q84KI1|T14H_TAXCU | Taxoid 14-beta-hydroxylase OS=Taxus cuspidata PE=1 SV=1 | 296 | 496 | 1.0E-12 |
| sp|O35132|CP27B_RAT | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 | 181 | 468 | 1.0E-12 |
| sp|Q9FF18|C7351_ARATH | Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A1 PE=1 SV=1 | 321 | 467 | 1.0E-12 |
| sp|P24903|CP2F1_HUMAN | Cytochrome P450 2F1 OS=Homo sapiens GN=CYP2F1 PE=1 SV=2 | 300 | 486 | 1.0E-12 |
| sp|Q9V5L3|C49A1_DROME | Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 | 256 | 474 | 1.0E-12 |
| sp|Q9VMS8|C4AC2_DROME | Probable cytochrome P450 4ac2 OS=Drosophila melanogaster GN=Cyp4ac2 PE=2 SV=4 | 278 | 468 | 2.0E-12 |
| sp|P11511|CP19A_HUMAN | Aromatase OS=Homo sapiens GN=CYP19A1 PE=1 SV=3 | 291 | 454 | 2.0E-12 |
| sp|O54750|CP2J6_MOUSE | Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 | 239 | 467 | 2.0E-12 |
| sp|Q50EK4|C75A1_PINTA | Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 | 226 | 472 | 2.0E-12 |
| sp|Q64441|CP24A_MOUSE | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 | 127 | 471 | 2.0E-12 |
| sp|Q9V4T5|CP4E1_DROME | Probable cytochrome P450 4e1 OS=Drosophila melanogaster GN=Cyp4e1 PE=2 SV=1 | 294 | 468 | 2.0E-12 |
| sp|Q29624|CP191_PIG | Aromatase 1 OS=Sus scrofa GN=CYP19A1 PE=2 SV=1 | 298 | 454 | 2.0E-12 |
| sp|Q964T2|CP9E2_BLAGE | Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9E2 PE=2 SV=1 | 290 | 456 | 2.0E-12 |
| sp|P48421|C83A1_ARATH | Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 | 233 | 473 | 2.0E-12 |
| sp|P85191|CP450_HELAN | Cytochrome P450 (Fragment) OS=Helianthus annuus PE=1 SV=1 | 345 | 468 | 3.0E-12 |
| sp|Q27514|C13A5_CAEEL | Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=3 SV=1 | 297 | 496 | 3.0E-12 |
| sp|Q9VMS9|C4AC1_DROME | Probable cytochrome P450 4ac1 OS=Drosophila melanogaster GN=Cyp4ac1 PE=2 SV=1 | 278 | 498 | 3.0E-12 |
| sp|Q92104|CP11B_LITCT | Cytochrome P450 11B, mitochondrial OS=Lithobates catesbeiana GN=CYP11B PE=2 SV=1 | 126 | 468 | 3.0E-12 |
| sp|Q92111|CP19A_ICTPU | Aromatase OS=Ictalurus punctatus GN=cyp19a1 PE=2 SV=1 | 294 | 453 | 3.0E-12 |
| sp|F4JW83|C84A4_ARATH | Cytochrome P450 84A4 OS=Arabidopsis thaliana GN=CYP84A4 PE=1 SV=1 | 244 | 467 | 3.0E-12 |
| sp|P9WPM5|CP137_MYCTU | Putative cytochrome P450 137 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp137 PE=1 SV=1 | 292 | 460 | 3.0E-12 |
| sp|P9WPM4|CP137_MYCTO | Putative cytochrome P450 137 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp137 PE=3 SV=1 | 292 | 460 | 3.0E-12 |
| sp|Q9V419|C28A5_DROME | Probable cytochrome P450 28a5 OS=Drosophila melanogaster GN=Cyp28a5 PE=2 SV=1 | 256 | 484 | 3.0E-12 |
| sp|Q7XHW5|C14B1_ORYSJ | Cytochrome P450 714B1 OS=Oryza sativa subsp. japonica GN=CYP714B1 PE=1 SV=2 | 296 | 468 | 4.0E-12 |
| sp|O42145|C19AA_DANRE | Aromatase OS=Danio rerio GN=cyp19a1a PE=2 SV=1 | 294 | 454 | 4.0E-12 |
| sp|P79304|CP193_PIG | Aromatase 3 OS=Sus scrofa GN=CYP19A3 PE=2 SV=2 | 298 | 468 | 4.0E-12 |
| sp|B5UAQ8|C7195_ESCCA | Cheilanthifoline synthase OS=Eschscholzia californica GN=CYP719A5 PE=1 SV=1 | 214 | 476 | 4.0E-12 |
| sp|Q9VXY0|CP4S3_DROME | Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 | 294 | 467 | 4.0E-12 |
| sp|Q50EK0|C16B2_PICSI | Cytochrome P450 716B2 OS=Picea sitchensis GN=CYP716B2 PE=2 SV=1 | 294 | 466 | 5.0E-12 |
| sp|Q50LH4|C7193_ESCCA | (S)-stylopine synthase 2 OS=Eschscholzia californica GN=CYP719A3 PE=1 SV=1 | 214 | 468 | 5.0E-12 |
| sp|Q9STK7|C71AQ_ARATH | Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 | 290 | 468 | 5.0E-12 |
| sp|Q05047|C72A1_CATRO | Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 | 304 | 468 | 5.0E-12 |
| sp|Q9LHA1|C8D11_ARATH | Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 | 169 | 468 | 5.0E-12 |
| sp|Q9VWR5|CP306_DROME | Cytochrome P450 306a1 OS=Drosophila melanogaster GN=phm PE=1 SV=1 | 277 | 467 | 5.0E-12 |
| sp|Q6VVW9|CP2R1_MOUSE | Vitamin D 25-hydroxylase OS=Mus musculus GN=Cyp2r1 PE=2 SV=1 | 244 | 468 | 6.0E-12 |
| sp|Q9VRB3|CP6V1_DROME | Probable cytochrome P450 6v1 OS=Drosophila melanogaster GN=Cyp6v1 PE=2 SV=1 | 288 | 455 | 6.0E-12 |
| sp|Q5UQ90|YL532_MIMIV | Cytochrome P450-like protein L532 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L532 PE=1 SV=1 | 288 | 468 | 6.0E-12 |
| sp|Q27664|CP6B2_HELAM | Cytochrome P450 6B2 OS=Helicoverpa armigera GN=CYP6B2 PE=2 SV=1 | 95 | 467 | 7.0E-12 |
| sp|O18809|CP2F3_CAPHI | Cytochrome P450 2F3 OS=Capra hircus GN=CYP2F3 PE=2 SV=1 | 300 | 486 | 7.0E-12 |
| sp|P05185|CP17A_BOVIN | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bos taurus GN=CYP17A1 PE=2 SV=1 | 304 | 468 | 7.0E-12 |
| sp|Q9V3S0|CP4G1_DROME | Cytochrome P450 4g1 OS=Drosophila melanogaster GN=Cyp4g1 PE=2 SV=1 | 290 | 498 | 8.0E-12 |
| sp|Q9STK8|C71AP_ARATH | Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 | 290 | 468 | 8.0E-12 |
| sp|O18596|C4D10_DROMT | Cytochrome P450 4d10 OS=Drosophila mettleri GN=Cyp4d10 PE=1 SV=1 | 294 | 498 | 9.0E-12 |
| sp|P58049|C71BB_ARATH | Cytochrome P450 71B11 OS=Arabidopsis thaliana GN=CYP71B11 PE=2 SV=1 | 192 | 459 | 9.0E-12 |
| sp|Q9GMC7|CP17A_BISBI | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bison bison GN=CYP17A1 PE=2 SV=1 | 304 | 468 | 1.0E-11 |
| sp|P28649|CP19A_MOUSE | Aromatase OS=Mus musculus GN=Cyp19a1 PE=2 SV=1 | 298 | 468 | 1.0E-11 |
| sp|Q27519|C13A7_CAEEL | Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 | 297 | 467 | 1.0E-11 |
| sp|P00176|CP2B1_RAT | Cytochrome P450 2B1 OS=Rattus norvegicus GN=Cyp2b1 PE=1 SV=1 | 72 | 467 | 1.0E-11 |
| sp|P13527|CP6A1_MUSDO | Cytochrome P450 6A1 OS=Musca domestica GN=CYP6A1 PE=2 SV=1 | 100 | 467 | 2.0E-11 |
| sp|P79430|CP192_PIG | Aromatase 2 OS=Sus scrofa GN=CYP19A2 PE=2 SV=1 | 298 | 454 | 2.0E-11 |
| sp|Q9VYT8|C28C1_DROME | Probable cytochrome P450 28c1 OS=Drosophila melanogaster GN=Cyp28c1 PE=2 SV=1 | 307 | 470 | 2.0E-11 |
| sp|Q9LSF8|C82G1_ARATH | Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 | 294 | 468 | 2.0E-11 |
| sp|Q42716|C71A8_MENPI | Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 | 241 | 468 | 2.0E-11 |
| sp|P12789|CP2B5_RABIT | Cytochrome P450 2B5 OS=Oryctolagus cuniculus GN=CYP2B5 PE=2 SV=1 | 76 | 467 | 2.0E-11 |
| sp|Q9ZW95|C7352_ARATH | Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A2 PE=1 SV=1 | 321 | 467 | 2.0E-11 |
| sp|P33266|CP2E1_MACFA | Cytochrome P450 2E1 (Fragment) OS=Macaca fascicularis GN=CYP2E1 PE=2 SV=1 | 76 | 467 | 2.0E-11 |
| sp|Q9W130|CP9C1_DROME | Cytochrome P450 9c1 OS=Drosophila melanogaster GN=Cyp9c1 PE=2 SV=1 | 63 | 456 | 2.0E-11 |
| sp|Q5KQH7|C14D1_ORYSJ | Cytochrome P450 714D1 OS=Oryza sativa subsp. japonica GN=CYP714D1 PE=1 SV=1 | 91 | 468 | 2.0E-11 |
| sp|Q964R1|CP6J1_BLAGE | Cytochrome P450 6j1 OS=Blattella germanica GN=CYP6J1 PE=2 SV=1 | 95 | 468 | 3.0E-11 |
| sp|P12790|CP2B9_MOUSE | Cytochrome P450 2B9 OS=Mus musculus GN=Cyp2b9 PE=1 SV=2 | 72 | 467 | 3.0E-11 |
| sp|Q27513|C13A4_CAEEL | Putative cytochrome P450 CYP13A4 OS=Caenorhabditis elegans GN=cyp-13A4 PE=3 SV=1 | 297 | 467 | 3.0E-11 |
| sp|Q9STL1|C71AM_ARATH | Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 | 290 | 468 | 3.0E-11 |
| sp|Q9LUC9|C7A11_ARATH | Cytochrome P450 72A11 OS=Arabidopsis thaliana GN=CYP72A11 PE=2 SV=1 | 91 | 467 | 3.0E-11 |
| sp|H2DH17|C7A22_PANGI | Cytochrome P450 CYP749A22 OS=Panax ginseng PE=2 SV=1 | 296 | 467 | 3.0E-11 |
| sp|Q9V774|C6A21_DROME | Probable cytochrome P450 6a21 OS=Drosophila melanogaster GN=Cyp6a21 PE=2 SV=1 | 307 | 468 | 3.0E-11 |
| sp|Q9VGB4|CP132_DROME | Probable cytochrome P450 313a2 OS=Drosophila melanogaster GN=Cyp313a2 PE=3 SV=3 | 65 | 468 | 3.0E-11 |
| sp|Q6WG30|T5H_TAXCU | Taxadiene 5-alpha hydroxylase OS=Taxus cuspidata PE=1 SV=2 | 296 | 496 | 3.0E-11 |
| sp|Q4WAW5|FTMC_ASPFU | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 | 290 | 480 | 3.0E-11 |
| sp|B9WZX1|FTMC_ASPFM | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 | 290 | 480 | 3.0E-11 |
| sp|Q27756|CP6B3_PAPPO | Cytochrome P450 6B3 OS=Papilio polyxenes GN=CYP6B3 PE=2 SV=1 | 99 | 452 | 4.0E-11 |
| sp|P14137|CP11A_RAT | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Rattus norvegicus GN=Cyp11a1 PE=2 SV=1 | 72 | 467 | 4.0E-11 |
| sp|P24461|CP2G1_RABIT | Cytochrome P450 2G1 OS=Oryctolagus cuniculus GN=CYP2G1 PE=1 SV=1 | 76 | 467 | 4.0E-11 |
| sp|O73853|CP17A_ICTPU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 | 227 | 467 | 4.0E-11 |
| sp|Q9V557|CP4P2_DROME | Probable cytochrome P450 4p2 OS=Drosophila melanogaster GN=Cyp4p2 PE=2 SV=1 | 290 | 496 | 4.0E-11 |
| sp|Q92087|CP19A_ORYLA | Aromatase OS=Oryzias latipes GN=cyp19a1 PE=2 SV=1 | 294 | 453 | 4.0E-11 |
| sp|P47787|THAS_PIG | Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 | 297 | 467 | 5.0E-11 |
| sp|O46512|CP19A_HORSE | Aromatase OS=Equus caballus GN=CYP19A1 PE=2 SV=1 | 298 | 454 | 5.0E-11 |
| sp|Q05556|CP2AB_RABIT | Cytochrome P450 2A11 OS=Oryctolagus cuniculus GN=CYP2A11 PE=1 SV=1 | 51 | 467 | 6.0E-11 |
| sp|Q8LIF2|C7345_ORYSJ | Cytochrome P450 734A5 OS=Oryza sativa subsp. japonica GN=CYP734A5 PE=2 SV=1 | 296 | 468 | 6.0E-11 |
| sp|Q9AXH9|KAO1_HORVU | Ent-kaurenoic acid oxidase 1 OS=Hordeum vulgare GN=KAO1 PE=1 SV=1 | 247 | 455 | 6.0E-11 |
| sp|Q9STK9|C71AO_ARATH | Cytochrome P450 71A24 OS=Arabidopsis thaliana GN=CYP71A24 PE=2 SV=3 | 290 | 468 | 6.0E-11 |
| sp|Q6QHT9|CP19A_ANGJA | Aromatase OS=Anguilla japonica GN=cyp19a1 PE=2 SV=1 | 298 | 453 | 6.0E-11 |
| sp|Q9V9L1|CP6W1_DROME | Probable cytochrome P450 6w1 OS=Drosophila melanogaster GN=Cyp6w1 PE=2 SV=1 | 267 | 456 | 7.0E-11 |
| sp|Q9V979|CP6U1_DROME | Probable cytochrome P450 6u1 OS=Drosophila melanogaster GN=Cyp6u1 PE=2 SV=3 | 297 | 457 | 7.0E-11 |
| sp|Q05JG2|ABAH1_ORYSJ | Abscisic acid 8'-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP707A5 PE=2 SV=1 | 292 | 467 | 7.0E-11 |
| sp|Q09J79|ABAH1_ORYSI | Abscisic acid 8'-hydroxylase 1 OS=Oryza sativa subsp. indica GN=CYP707A5 PE=2 SV=1 | 292 | 467 | 7.0E-11 |
| sp|Q556M5|C5081_DICDI | Probable cytochrome P450 508A1 OS=Dictyostelium discoideum GN=cyp508A1-1 PE=3 SV=1 | 296 | 498 | 7.0E-11 |
| sp|Q8WNE1|CP2F5_GORGO | Cytochrome P450 2F5 OS=Gorilla gorilla gorilla GN=CYP2F5 PE=3 SV=2 | 300 | 486 | 8.0E-11 |
| sp|P15540|CP21A_PIG | Steroid 21-hydroxylase OS=Sus scrofa GN=CYP21 PE=1 SV=2 | 76 | 497 | 9.0E-11 |
| sp|Q9SHG5|C72C1_ARATH | Cytochrome P450 72C1 OS=Arabidopsis thaliana GN=CYP72C1 PE=2 SV=2 | 294 | 467 | 9.0E-11 |
| sp|P00178|CP2B4_RABIT | Cytochrome P450 2B4 OS=Oryctolagus cuniculus GN=CYP2B4 PE=1 SV=1 | 76 | 467 | 9.0E-11 |
| sp|P21595|CP56_YEAST | Cytochrome P450-DIT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIT2 PE=1 SV=2 | 114 | 467 | 1.0E-10 |
| sp|P49430|THAS_RAT | Thromboxane-A synthase OS=Rattus norvegicus GN=Tbxas1 PE=2 SV=1 | 297 | 496 | 1.0E-10 |
| sp|Q54E98|C520B_DICDI | Putative cytochrome P450 520B1 OS=Dictyostelium discoideum GN=cyp520B1 PE=5 SV=1 | 267 | 485 | 1.0E-10 |
| sp|O13317|TRI11_FUSSP | Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 | 301 | 480 | 1.0E-10 |
| sp|O49858|C82A3_SOYBN | Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 | 299 | 468 | 1.0E-10 |
| sp|Q949P1|ABAH1_ARATH | Abscisic acid 8'-hydroxylase 1 OS=Arabidopsis thaliana GN=CYP707A1 PE=2 SV=1 | 294 | 467 | 1.0E-10 |
| sp|Q9VGZ0|C12E1_DROME | Probable cytochrome P450 12e1, mitochondrial OS=Drosophila melanogaster GN=Cyp12e1 PE=2 SV=4 | 127 | 468 | 1.0E-10 |
| sp|P27786|CP17A_MOUSE | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mus musculus GN=Cyp17a1 PE=1 SV=1 | 290 | 468 | 1.0E-10 |
| sp|Q6VVX0|CP2R1_HUMAN | Vitamin D 25-hydroxylase OS=Homo sapiens GN=CYP2R1 PE=1 SV=1 | 252 | 467 | 1.0E-10 |
| sp|O64638|C76C3_ARATH | Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2 | 250 | 468 | 1.0E-10 |
| sp|Q9LUC6|C7A14_ARATH | Cytochrome P450 72A14 OS=Arabidopsis thaliana GN=CYP72A14 PE=2 SV=1 | 90 | 467 | 1.0E-10 |
| sp|P58050|C71BD_ARATH | Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1 | 246 | 453 | 1.0E-10 |
| sp|B1NF18|C719B_PAPSO | Salutaridine synthase OS=Papaver somniferum GN=CYP719B1 PE=1 SV=1 | 274 | 468 | 1.0E-10 |
| sp|P79690|CP191_CARAU | Brain aromatase OS=Carassius auratus GN=cyp19a1 PE=2 SV=1 | 294 | 459 | 1.0E-10 |
| sp|P33272|CP2BC_RAT | Cytochrome P450 2B12 OS=Rattus norvegicus GN=Cyp2b12 PE=2 SV=1 | 66 | 467 | 2.0E-10 |
| sp|B9DFU2|MAX1_ARATH | Cytochrome P450 711A1 OS=Arabidopsis thaliana GN=CYP711A1 PE=2 SV=1 | 300 | 498 | 2.0E-10 |
| sp|P79699|CP19A_COTJA | Aromatase (Fragments) OS=Coturnix coturnix japonica GN=CYP19A1 PE=2 SV=2 | 298 | 454 | 2.0E-10 |
| sp|Q9FH76|ABAH3_ARATH | Abscisic acid 8'-hydroxylase 3 OS=Arabidopsis thaliana GN=CYP707A3 PE=1 SV=1 | 271 | 467 | 2.0E-10 |
| sp|O48927|C78A3_SOYBN | Cytochrome P450 78A3 OS=Glycine max GN=CYP78A3 PE=2 SV=1 | 237 | 497 | 2.0E-10 |
| sp|Q8HYN1|CP17A_PANTR | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Pan troglodytes GN=CYP17A1 PE=2 SV=1 | 256 | 468 | 2.0E-10 |
| sp|P05093|CP17A_HUMAN | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Homo sapiens GN=CYP17A1 PE=1 SV=1 | 256 | 468 | 2.0E-10 |
| sp|Q50LH3|C7192_ESCCA | (S)-stylopine synthase 1 OS=Eschscholzia californica GN=CYP719A2 PE=1 SV=1 | 320 | 468 | 2.0E-10 |
| sp|O93323|CP26A_XENLA | Cytochrome P450 26A1 OS=Xenopus laevis GN=cyp26a1 PE=2 SV=1 | 118 | 460 | 2.0E-10 |
| sp|O81077|ABAH2_ARATH | Abscisic acid 8'-hydroxylase 2 OS=Arabidopsis thaliana GN=CYP707A2 PE=2 SV=1 | 292 | 496 | 2.0E-10 |
| sp|Q8HYM9|CP17A_MACMU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca mulatta GN=CYP17A1 PE=2 SV=1 | 251 | 468 | 2.0E-10 |
| sp|Q2XVA1|CP17A_MACFA | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca fascicularis GN=CYP17A1 PE=2 SV=1 | 251 | 468 | 2.0E-10 |
| sp|Q8HYN0|CP17A_PAPCY | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio cynocephalus GN=CYP17A1 PE=2 SV=1 | 304 | 468 | 3.0E-10 |
| sp|Q29497|CP17A_SHEEP | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ovis aries GN=CYP17A1 PE=2 SV=2 | 304 | 468 | 3.0E-10 |
| sp|Q92113|CP17A_SQUAC | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 | 271 | 467 | 3.0E-10 |
| sp|P11509|CP2A6_HUMAN | Cytochrome P450 2A6 OS=Homo sapiens GN=CYP2A6 PE=1 SV=3 | 51 | 467 | 3.0E-10 |
| sp|Q1ZXF5|C5084_DICDI | Probable cytochrome P450 508A4 OS=Dictyostelium discoideum GN=cyp508A4 PE=3 SV=1 | 290 | 496 | 3.0E-10 |
| sp|B9GBJ9|C14C1_ORYSJ | Cytochrome P450 714C1 OS=Oryza sativa subsp. japonica GN=CYP714C1 PE=2 SV=1 | 78 | 467 | 3.0E-10 |
| sp|Q9V771|C6A23_DROME | Probable cytochrome P450 6a23 OS=Drosophila melanogaster GN=Cyp6a23 PE=2 SV=2 | 94 | 456 | 3.0E-10 |
| sp|P11715|CP17A_RAT | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rattus norvegicus GN=Cyp17a1 PE=1 SV=2 | 262 | 468 | 4.0E-10 |
| sp|Q92112|CP19A_TAEGU | Aromatase OS=Taeniopygia guttata GN=CYP19A1 PE=2 SV=1 | 298 | 454 | 4.0E-10 |
| sp|Q9V769|C6A22_DROME | Cytochrome P450 6a22 OS=Drosophila melanogaster GN=Cyp6a22 PE=2 SV=1 | 307 | 467 | 4.0E-10 |
| sp|P19098|CP19A_CHICK | Aromatase OS=Gallus gallus GN=CYP19A1 PE=2 SV=1 | 298 | 454 | 4.0E-10 |
| sp|O55071|CP2BJ_MOUSE | Cytochrome P450 2B19 OS=Mus musculus GN=Cyp2b19 PE=2 SV=1 | 239 | 467 | 4.0E-10 |
| sp|Q9PUB4|CP26A_CHICK | Cytochrome P450 26A1 OS=Gallus gallus GN=CYP26A1 PE=2 SV=1 | 71 | 452 | 5.0E-10 |
| sp|Q9VRI9|CP6T1_DROME | Probable cytochrome P450 6t1 OS=Drosophila melanogaster GN=Cyp6t1 PE=2 SV=1 | 307 | 455 | 5.0E-10 |
| sp|Q05421|CP2E1_MOUSE | Cytochrome P450 2E1 OS=Mus musculus GN=Cyp2e1 PE=1 SV=1 | 76 | 468 | 5.0E-10 |
| sp|Q9VGH1|CP315_DROME | Cytochrome P450 315a1, mitochondrial OS=Drosophila melanogaster GN=sad PE=2 SV=1 | 183 | 468 | 5.0E-10 |
| sp|P03940|CP21A_MOUSE | Steroid 21-hydroxylase OS=Mus musculus GN=Cyp21 PE=2 SV=3 | 76 | 467 | 6.0E-10 |
| sp|Q9ZU07|C71BC_ARATH | Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1 | 300 | 459 | 6.0E-10 |
| sp|O49342|C71AD_ARATH | Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 | 291 | 468 | 6.0E-10 |
| sp|P70687|CP17A_MESAU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mesocricetus auratus GN=CYP17A1 PE=2 SV=1 | 304 | 468 | 6.0E-10 |
| sp|P24456|CP2DA_MOUSE | Cytochrome P450 2D10 OS=Mus musculus GN=Cyp2d10 PE=1 SV=2 | 294 | 467 | 6.0E-10 |
| sp|I7C6E8|C7A52_PANGI | Beta-amyrin 28-oxidase OS=Panax ginseng PE=2 SV=1 | 294 | 468 | 7.0E-10 |
| sp|Q9N0U7|CP17A_CAPHI | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Capra hircus GN=CYP17A1 PE=2 SV=1 | 304 | 468 | 7.0E-10 |
| sp|P00191|CP21A_BOVIN | Steroid 21-hydroxylase OS=Bos taurus GN=CYP21 PE=1 SV=2 | 67 | 467 | 7.0E-10 |
| sp|P58051|C71BE_ARATH | Cytochrome P450 71B14 OS=Arabidopsis thaliana GN=CYP71B14 PE=2 SV=1 | 246 | 453 | 7.0E-10 |
| sp|Q95328|CP17A_HORSE | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Equus caballus GN=CYP17A1 PE=2 SV=1 | 76 | 497 | 8.0E-10 |
| sp|Q6YTF5|C76M5_ORYSJ | Cytochrome P450 76M5 OS=Oryza sativa subsp. japonica GN=CYP76M5 PE=1 SV=1 | 104 | 468 | 9.0E-10 |
| sp|Q9V674|CP6G1_DROME | Cytochrome P450 6g1 OS=Drosophila melanogaster GN=Cyp6g1 PE=2 SV=1 | 267 | 456 | 9.0E-10 |
| sp|S4UX02|CYPH1_SALMI | Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 | 241 | 468 | 9.0E-10 |
| sp|A1DA60|FTMC_NEOFI | Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 | 260 | 468 | 1.0E-09 |
| sp|Q0J185|ABAH3_ORYSJ | Abscisic acid 8'-hydroxylase 3 OS=Oryza sativa subsp. japonica GN=CYP707A7 PE=2 SV=1 | 296 | 496 | 1.0E-09 |
| sp|A2Z212|ABAH3_ORYSI | Abscisic acid 8'-hydroxylase 3 OS=Oryza sativa subsp. indica GN=CYP707A7 PE=3 SV=1 | 296 | 496 | 1.0E-09 |
| sp|P20853|CP2A7_HUMAN | Cytochrome P450 2A7 OS=Homo sapiens GN=CYP2A7 PE=2 SV=2 | 78 | 467 | 1.0E-09 |
| sp|P82711|C6A19_DROME | Probable cytochrome P450 6a19 OS=Drosophila melanogaster GN=Cyp6a19 PE=3 SV=1 | 297 | 467 | 1.0E-09 |
| sp|Q2LCM1|CP21A_CANLU | Steroid 21-hydroxylase OS=Canis lupus GN=CYP21 PE=3 SV=1 | 76 | 497 | 2.0E-09 |
| sp|Q8WNW0|CP21A_CANLF | Steroid 21-hydroxylase OS=Canis lupus familiaris GN=CYP21 PE=3 SV=1 | 76 | 497 | 2.0E-09 |
| sp|Q9SLP1|C78A9_ARATH | Cytochrome P450 78A9 OS=Arabidopsis thaliana GN=CYP78A9 PE=2 SV=1 | 240 | 468 | 2.0E-09 |
| sp|Q12609|STCF_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 | 142 | 468 | 2.0E-09 |
| sp|O81972|C82A2_SOYBN | Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1 | 293 | 471 | 2.0E-09 |
| sp|E3W9C4|C71A1_ZINZE | Alpha-humulene 10-hydroxylase OS=Zingiber zerumbet GN=CYP71BA1 PE=1 SV=1 | 298 | 468 | 2.0E-09 |
| sp|Q9MZY0|CP2E1_CANLF | Cytochrome P450 2E1 OS=Canis lupus familiaris GN=CYP2E1 PE=2 SV=1 | 10 | 468 | 2.0E-09 |
| sp|Q96SQ9|CP2S1_HUMAN | Cytochrome P450 2S1 OS=Homo sapiens GN=CYP2S1 PE=1 SV=2 | 76 | 467 | 2.0E-09 |
| sp|O81973|C93A3_SOYBN | Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 | 285 | 468 | 2.0E-09 |
| sp|Q9GLD2|CP17A_PAPHU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio hamadryas ursinus GN=CYP17A1 PE=1 SV=1 | 304 | 468 | 3.0E-09 |
| sp|Q9LTM0|C71BN_ARATH | Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1 | 247 | 453 | 3.0E-09 |
| sp|L7X3S1|MSH_PAPSO | Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 | 215 | 468 | 3.0E-09 |
| sp|Q42798|C93A1_SOYBN | 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 | 285 | 476 | 3.0E-09 |
| sp|Q9VJ71|CP310_DROME | Probable cytochrome P450 310a1 OS=Drosophila melanogaster GN=Cyp310a1 PE=2 SV=1 | 283 | 467 | 4.0E-09 |
| sp|Q42600|C84A1_ARATH | Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CYP84A1 PE=1 SV=1 | 291 | 467 | 4.0E-09 |
| sp|P13107|CP2B3_RAT | Cytochrome P450 2B3 OS=Rattus norvegicus GN=Cyp2b3 PE=2 SV=1 | 239 | 467 | 4.0E-09 |
| sp|Q9VMS7|C4AC3_DROME | Probable cytochrome P450 4ac3 OS=Drosophila melanogaster GN=Cyp4ac3 PE=2 SV=2 | 278 | 468 | 4.0E-09 |
| sp|Q9XHE8|C71DI_MENSP | Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1 | 298 | 468 | 5.0E-09 |
| sp|Q6WKZ1|C71DI_MENGR | Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1 | 298 | 468 | 5.0E-09 |
| sp|P11711|CP2A1_RAT | Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1 PE=1 SV=2 | 239 | 467 | 5.0E-09 |
| sp|Q9LUC5|C7A15_ARATH | Cytochrome P450 72A15 OS=Arabidopsis thaliana GN=CYP72A15 PE=2 SV=1 | 91 | 467 | 5.0E-09 |
| sp|Q42799|C93A2_SOYBN | Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 | 298 | 468 | 5.0E-09 |
| sp|Q6QNI4|C71AJ_AMMMJ | Psoralen synthase OS=Ammi majus GN=CYP71AJ1 PE=1 SV=1 | 244 | 468 | 6.0E-09 |
| sp|P56656|CP239_MOUSE | Cytochrome P450 2C39 OS=Mus musculus GN=Cyp2c39 PE=1 SV=2 | 298 | 468 | 6.0E-09 |
| sp|Q9V675|CP6G2_DROME | Probable cytochrome P450 6g2 OS=Drosophila melanogaster GN=Cyp6g2 PE=2 SV=1 | 297 | 496 | 7.0E-09 |
| sp|Q9LIP5|C71BW_ARATH | Cytochrome P450 71B35 OS=Arabidopsis thaliana GN=CYP71B35 PE=2 SV=1 | 291 | 468 | 7.0E-09 |
| sp|Q8W4T9|T13H_TAXCU | Taxane 13-alpha-hydroxylase OS=Taxus cuspidata GN=CYP725A2 PE=1 SV=1 | 290 | 496 | 7.0E-09 |
| sp|P15149|CP2A2_RAT | Cytochrome P450 2A2 OS=Rattus norvegicus GN=Cyp2a2 PE=1 SV=1 | 299 | 467 | 7.0E-09 |
| sp|Q92088|CP2M1_ONCMY | Cytochrome P450 2M1 OS=Oncorhynchus mykiss GN=cyp2m1 PE=1 SV=1 | 301 | 467 | 8.0E-09 |
| sp|O64637|C76C2_ARATH | Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 | 181 | 468 | 8.0E-09 |
| sp|P19100|CP17A_PIG | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Sus scrofa GN=CYP17A1 PE=2 SV=3 | 262 | 468 | 8.0E-09 |
| sp|P9WPM3|CP138_MYCTU | Putative cytochrome P450 138 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp138 PE=1 SV=1 | 291 | 498 | 9.0E-09 |
| sp|P9WPM2|CP138_MYCTO | Putative cytochrome P450 138 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp138 PE=3 SV=1 | 291 | 498 | 9.0E-09 |
| sp|P63718|CP138_MYCBO | Putative cytochrome P450 138 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp138 PE=3 SV=1 | 291 | 498 | 9.0E-09 |
| sp|P10634|CP2DQ_RAT | Cytochrome P450 2D26 OS=Rattus norvegicus GN=Cyp2d26 PE=1 SV=2 | 294 | 467 | 9.0E-09 |
| sp|Q64562|CP21A_RAT | Steroid 21-hydroxylase OS=Rattus norvegicus GN=Cyp21 PE=2 SV=1 | 76 | 467 | 9.0E-09 |
| sp|Q2LA59|CP21A_LYNLY | Steroid 21-hydroxylase OS=Lynx lynx GN=CYP21 PE=3 SV=1 | 76 | 467 | 9.0E-09 |
| sp|P33260|CP2CI_HUMAN | Cytochrome P450 2C18 OS=Homo sapiens GN=CYP2C18 PE=1 SV=3 | 239 | 468 | 9.0E-09 |
| sp|Q82IY3|PTLI_STRAW | Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 | 294 | 463 | 1.0E-08 |
| sp|Q29510|CP2CU_RABIT | Cytochrome P450 2C30 OS=Oryctolagus cuniculus GN=CYP2C30 PE=2 SV=1 | 239 | 467 | 1.0E-08 |
| sp|Q9M066|C90C1_ARATH | 3-epi-6-deoxocathasterone 23-monooxygenase OS=Arabidopsis thaliana GN=ROT3 PE=2 SV=3 | 226 | 455 | 1.0E-08 |
| sp|Q8CIM7|CP2DQ_MOUSE | Cytochrome P450 2D26 OS=Mus musculus GN=Cyp2d26 PE=1 SV=1 | 294 | 467 | 1.0E-08 |
| sp|O44220|C12B1_DROAC | Cytochrome P450 12b1, mitochondrial OS=Drosophila acanthoptera GN=Cyp12b1 PE=2 SV=1 | 259 | 468 | 1.0E-08 |
| sp|P08686|CP21A_HUMAN | Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1 | 301 | 467 | 1.0E-08 |
| sp|O65012|C78A4_PINRA | Cytochrome P450 78A4 OS=Pinus radiata GN=CYP78A4 PE=2 SV=1 | 235 | 468 | 1.0E-08 |
| sp|Q9LMX7|C78A5_ARATH | Cytochrome P450 78A5 OS=Arabidopsis thaliana GN=CYP78A5 PE=2 SV=1 | 307 | 495 | 1.0E-08 |
| sp|P11714|CP2D9_MOUSE | Cytochrome P450 2D9 OS=Mus musculus GN=Cyp2d9 PE=1 SV=2 | 300 | 467 | 1.0E-08 |
| sp|Q43246|C88A1_MAIZE | Cytochrome P450 88A1 OS=Zea mays GN=CYP88A1 PE=2 SV=1 | 290 | 455 | 1.0E-08 |
| sp|P56593|CP2AC_MOUSE | Cytochrome P450 2A12 OS=Mus musculus GN=Cyp2a12 PE=1 SV=2 | 299 | 467 | 1.0E-08 |
| sp|Q6WKZ0|C7D94_MENGR | Cytochrome P450 71D94 OS=Mentha gracilis GN=CYP71D94 PE=2 SV=1 | 298 | 468 | 1.0E-08 |
| sp|Q9VMT5|C28D1_DROME | Probable cytochrome P450 28d1 OS=Drosophila melanogaster GN=Cyp28d1 PE=2 SV=1 | 292 | 468 | 1.0E-08 |
| sp|H2DH21|C7A29_PANGI | Cytochrome P450 CYP72A219 OS=Panax ginseng PE=2 SV=1 | 301 | 467 | 1.0E-08 |
| sp|Q2LA60|CP21A_FELCA | Steroid 21-hydroxylase OS=Felis catus GN=CYP21 PE=3 SV=1 | 298 | 467 | 1.0E-08 |
| sp|P70085|CP17A_ORYLA | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzias latipes GN=cyp17a1 PE=2 SV=1 | 244 | 491 | 2.0E-08 |
| sp|P37118|C71A2_SOLME | Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 | 291 | 468 | 2.0E-08 |
| sp|P20852|CP2A5_MOUSE | Cytochrome P450 2A5 OS=Mus musculus GN=Cyp2a5 PE=2 SV=1 | 298 | 467 | 2.0E-08 |
| sp|Q947B7|MFS_MENPI | (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 | 279 | 476 | 2.0E-08 |
| sp|P15123|CP2CG_RABIT | Cytochrome P450 2C16 OS=Oryctolagus cuniculus GN=CYP2C16 PE=2 SV=1 | 239 | 468 | 2.0E-08 |
| sp|O48958|C71E1_SORBI | 4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor GN=CYP71E1 PE=2 SV=1 | 249 | 468 | 2.0E-08 |
| sp|P58046|C71AF_ARATH | Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=CYP71A15 PE=3 SV=1 | 91 | 468 | 2.0E-08 |
| sp|P93149|C93B1_GLYEC | Licodione synthase OS=Glycyrrhiza echinata GN=CYP93B1 PE=1 SV=2 | 285 | 476 | 3.0E-08 |
| sp|Q9T0K2|C71AK_ARATH | Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 | 290 | 471 | 3.0E-08 |
| sp|P33264|CP2CR_MESAU | Cytochrome P450 2C27 OS=Mesocricetus auratus GN=CYP2C27 PE=2 SV=1 | 239 | 468 | 3.0E-08 |
| sp|Q6IV13|C7D95_MENSP | Cytochrome P450 71D95 OS=Mentha spicata GN=CYP71D95 PE=1 SV=1 | 293 | 468 | 3.0E-08 |
| sp|Q9LIP6|C71BV_ARATH | Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 | 291 | 468 | 3.0E-08 |
| sp|P37120|C75A2_SOLME | Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1 | 298 | 468 | 3.0E-08 |
| sp|P33263|CP2CQ_MESAU | Cytochrome P450 2C26 OS=Mesocricetus auratus GN=CYP2C26 PE=2 SV=1 | 294 | 468 | 3.0E-08 |
| sp|Q6WKY9|C7D95_MENGR | Cytochrome P450 71D95 OS=Mentha gracilis GN=CYP71D95 PE=1 SV=1 | 293 | 468 | 4.0E-08 |
| sp|Q93ZB2|KO1_ARATH | Ent-kaurene oxidase, chloroplastic OS=Arabidopsis thaliana GN=KO PE=1 SV=2 | 78 | 486 | 4.0E-08 |
| sp|Q6XQ14|C71E7_MANES | 2-methylbutanal oxime monooxygenase OS=Manihot esculenta GN=CYP71E7 PE=1 SV=1 | 249 | 463 | 4.0E-08 |
| sp|P56654|CP237_MOUSE | Cytochrome P450 2C37 OS=Mus musculus GN=Cyp2c37 PE=1 SV=2 | 298 | 468 | 4.0E-08 |
| sp|A3A871|C71Z6_ORYSJ | Ent-isokaurene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z6 PE=1 SV=1 | 224 | 468 | 4.0E-08 |
| sp|P10612|CP11A_PIG | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Sus scrofa GN=CYP11A1 PE=1 SV=1 | 72 | 468 | 4.0E-08 |
| sp|O57525|CP17A_RANDY | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rana dybowskii GN=CYP17A1 PE=2 SV=1 | 285 | 467 | 4.0E-08 |
| sp|P9WPN1|C135A_MYCTU | Putative cytochrome P450 135A1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp135A1 PE=1 SV=1 | 253 | 467 | 4.0E-08 |
| sp|P9WPN0|C135A_MYCTO | Putative cytochrome P450 135A1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp135A1 PE=3 SV=1 | 253 | 467 | 4.0E-08 |
| sp|Q9VWR2|CP308_DROME | Probable cytochrome P450 308a1 OS=Drosophila melanogaster GN=Cyp308a1 PE=2 SV=2 | 301 | 455 | 4.0E-08 |
| sp|Q2PG45|THAS_MACFA | Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 | 297 | 468 | 4.0E-08 |
| sp|Q64410|CP17A_CAVPO | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Cavia porcellus GN=CYP17A1 PE=1 SV=1 | 304 | 468 | 5.0E-08 |
| sp|P08683|CP2CB_RAT | Cytochrome P450 2C11 OS=Rattus norvegicus GN=Cyp2c11 PE=1 SV=1 | 239 | 468 | 5.0E-08 |
| sp|F2Z9C1|P6H_ESCCA | Protopine 6-monooxygenase OS=Eschscholzia californica GN=CYP82N2v2 PE=1 SV=1 | 292 | 468 | 5.0E-08 |
| sp|P24457|CP2DB_MOUSE | Cytochrome P450 2D11 OS=Mus musculus GN=Cyp2d11 PE=2 SV=2 | 294 | 467 | 6.0E-08 |
| sp|O49340|C71AC_ARATH | Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=CYP71A12 PE=2 SV=1 | 291 | 468 | 6.0E-08 |
| sp|Q9VYQ5|CP318_DROME | Probable cytochrome P450 318a1 OS=Drosophila melanogaster GN=Cyp318a1 PE=2 SV=4 | 123 | 497 | 6.0E-08 |
| sp|P05179|CP2C7_RAT | Cytochrome P450 2C7 OS=Rattus norvegicus GN=Cyp2c7 PE=1 SV=2 | 298 | 468 | 6.0E-08 |
| sp|H2KYS3|DAF9_CAEEL | Cytochrome P450 daf-9 OS=Caenorhabditis elegans GN=daf-9 PE=1 SV=1 | 307 | 467 | 7.0E-08 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0004497 | monooxygenase activity | Yes |
| GO:0020037 | heme binding | Yes |
| GO:0005506 | iron ion binding | Yes |
| GO:0016705 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | Yes |
| GO:0003824 | catalytic activity | No |
| GO:0046872 | metal ion binding | No |
| GO:0046906 | tetrapyrrole binding | No |
| GO:0003674 | molecular_function | No |
| GO:0005488 | binding | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0016491 | oxidoreductase activity | No |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0043167 | ion binding | No |
| GO:0046914 | transition metal ion binding | No |
| GO:0043169 | cation binding | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| Yes | 1 - 20 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >OphauB2|6961 MPLTSLSLLSLTLFGLWRAIHRRRCQQAVSRAGGCQVARSQAPVRDPIIGLDFIYDVLFKPPEDRYLALSQQAHA RLGPTYTVRRWAWEVIYTCDSRNIKHLLASGFSDFALPRLRVAALETLVGRGIFTLNGQAWSRARARLKPLLARL DHEAAVEALEGHFQAMLNLICPCRDSLTAQVDLQPLFFRLAMEFAGSFLLGASTGMLHKSEAAEGFVRDYMTCST EVVRRLGCGPLQHLRFSPRCHKAKQRVFGYIERFIDDALATAAAPSRANKAPDSVLVRLAAVTPDRAALRDQVLH LLVASRDTTASMLSNLFFVLAQEPAVWTRLRHEVMAISGQTCPSVAQLRQMQYARWCVNESLRLHPVIPTNAREA TRDTTIPRGGGPDGTAPLLVRRGIVVVYNLYAMHRDANVFGPNPEAFVPERWAALRPGWGFLPFNGGARTCLGQQ LALTEALFVVARMAQTFERIHGLGGREWVELYALATTCRDGVEVKLQKG* |
| Coding | >OphauB2|6961 ATGCCTCTAACCTCCTTGTCTCTGCTTTCCCTCACCCTCTTTGGCCTTTGGCGCGCCATTCATAGACGCCGCTGC CAGCAGGCCGTGTCGCGCGCCGGCGGGTGTCAAGTCGCCCGCAGCCAAGCGCCAGTGCGCGACCCCATCATCGGC CTCGACTTCATCTACGACGTGCTCTTCAAGCCGCCCGAGGACCGCTATCTCGCCTTGTCCCAGCAAGCACATGCT CGCCTAGGACCAACCTACACGGTTCGCCGCTGGGCCTGGGAAGTCATTTATACGTGCGACAGCCGCAACATCAAG CATCTGCTCGCCAGCGGCTTCTCCGACTTTGCCCTGCCGCGCCTGCGCGTTGCAGCGCTTGAGACTCTGGTCGGT CGGGGCATCTTTACCCTCAACGGCCAAGCTTGGTCGCGAGCCAGAGCTCGTCTCAAGCCTCTGCTGGCCCGCCTG GACCATGAGGCTGCTGTCGAGGCGCTCGAGGGCCACTTCCAGGCCATGCTCAACTTGATTTGCCCATGCCGTGAC TCTCTGACAGCCCAAGTCGATCTACAGCCCCTCTTCTTCCGCCTGGCCATGGAGTTTGCCGGAAGCTTCTTGCTC GGCGCATCGACGGGCATGTTGCACAAGAGCGAGGCTGCCGAGGGCTTCGTGCGCGACTACATGACGTGCTCGACC GAAGTGGTGCGCAGACTGGGCTGCGGCCCGCTGCAGCACTTGCGCTTCAGCCCACGCTGCCACAAAGCCAAGCAG CGCGTGTTTGGGTACATTGAGCGCTTCATCGACGACGCCCTGGCCACGGCGGCGGCTCCAAGTAGAGCAAACAAA GCTCCAGACAGTGTGCTAGTCCGCCTGGCAGCCGTGACTCCAGACCGCGCGGCGCTGAGAGACCAGGTCTTGCAC CTGCTTGTCGCCAGTCGAGACACAACGGCCAGCATGCTGAGCAACCTGTTTTTTGTGCTGGCACAAGAGCCAGCC GTGTGGACACGACTGCGGCATGAAGTCATGGCCATTTCAGGGCAAACGTGTCCGTCGGTGGCGCAGCTGCGACAG ATGCAATATGCCCGTTGGTGCGTCAATGAATCATTGAGATTGCATCCTGTCATACCAACAAATGCCCGCGAGGCA ACTCGAGACACAACCATCCCCAGGGGAGGTGGACCTGACGGTACAGCGCCCTTGCTGGTGCGTCGCGGCATCGTT GTCGTGTACAACCTTTACGCCATGCACCGCGATGCCAATGTCTTTGGCCCCAACCCCGAGGCCTTTGTGCCGGAG AGATGGGCTGCCTTGCGTCCCGGATGGGGATTTCTGCCCTTTAATGGCGGCGCAAGAACATGTCTTGGGCAGCAG CTAGCCCTGACTGAGGCTCTCTTTGTGGTGGCGAGGATGGCGCAAACATTTGAAAGAATTCATGGGCTAGGCGGA AGGGAATGGGTCGAGCTGTATGCCCTGGCAACCACGTGTCGCGACGGCGTTGAAGTGAAGCTGCAAAAAGGATAG |
| Transcript | >OphauB2|6961 ATGCCTCTAACCTCCTTGTCTCTGCTTTCCCTCACCCTCTTTGGCCTTTGGCGCGCCATTCATAGACGCCGCTGC CAGCAGGCCGTGTCGCGCGCCGGCGGGTGTCAAGTCGCCCGCAGCCAAGCGCCAGTGCGCGACCCCATCATCGGC CTCGACTTCATCTACGACGTGCTCTTCAAGCCGCCCGAGGACCGCTATCTCGCCTTGTCCCAGCAAGCACATGCT CGCCTAGGACCAACCTACACGGTTCGCCGCTGGGCCTGGGAAGTCATTTATACGTGCGACAGCCGCAACATCAAG CATCTGCTCGCCAGCGGCTTCTCCGACTTTGCCCTGCCGCGCCTGCGCGTTGCAGCGCTTGAGACTCTGGTCGGT CGGGGCATCTTTACCCTCAACGGCCAAGCTTGGTCGCGAGCCAGAGCTCGTCTCAAGCCTCTGCTGGCCCGCCTG GACCATGAGGCTGCTGTCGAGGCGCTCGAGGGCCACTTCCAGGCCATGCTCAACTTGATTTGCCCATGCCGTGAC TCTCTGACAGCCCAAGTCGATCTACAGCCCCTCTTCTTCCGCCTGGCCATGGAGTTTGCCGGAAGCTTCTTGCTC GGCGCATCGACGGGCATGTTGCACAAGAGCGAGGCTGCCGAGGGCTTCGTGCGCGACTACATGACGTGCTCGACC GAAGTGGTGCGCAGACTGGGCTGCGGCCCGCTGCAGCACTTGCGCTTCAGCCCACGCTGCCACAAAGCCAAGCAG CGCGTGTTTGGGTACATTGAGCGCTTCATCGACGACGCCCTGGCCACGGCGGCGGCTCCAAGTAGAGCAAACAAA GCTCCAGACAGTGTGCTAGTCCGCCTGGCAGCCGTGACTCCAGACCGCGCGGCGCTGAGAGACCAGGTCTTGCAC CTGCTTGTCGCCAGTCGAGACACAACGGCCAGCATGCTGAGCAACCTGTTTTTTGTGCTGGCACAAGAGCCAGCC GTGTGGACACGACTGCGGCATGAAGTCATGGCCATTTCAGGGCAAACGTGTCCGTCGGTGGCGCAGCTGCGACAG ATGCAATATGCCCGTTGGTGCGTCAATGAATCATTGAGATTGCATCCTGTCATACCAACAAATGCCCGCGAGGCA ACTCGAGACACAACCATCCCCAGGGGAGGTGGACCTGACGGTACAGCGCCCTTGCTGGTGCGTCGCGGCATCGTT GTCGTGTACAACCTTTACGCCATGCACCGCGATGCCAATGTCTTTGGCCCCAACCCCGAGGCCTTTGTGCCGGAG AGATGGGCTGCCTTGCGTCCCGGATGGGGATTTCTGCCCTTTAATGGCGGCGCAAGAACATGTCTTGGGCAGCAG CTAGCCCTGACTGAGGCTCTCTTTGTGGTGGCGAGGATGGCGCAAACATTTGAAAGAATTCATGGGCTAGGCGGA AGGGAATGGGTCGAGCTGTATGCCCTGGCAACCACGTGTCGCGACGGCGTTGAAGTGAAGCTGCAAAAAGGATAG |
| Gene | >OphauB2|6961 ATGCCTCTAACCTCCTTGTCTCTGCTTTCCCTCACCCTCTTTGGCCTTTGGCGCGCCATTCATAGACGCCGCTGC CAGCAGGCCGTGTCGCGCGCCGGCGGGTGTCAAGTCGCCCGCAGCCAAGCGCCAGTGCGCGACCCCATCATCGGC CTCGACTTCATCTACGACGTGCTCTTCAAGCCGCCCGAGGACCGCTATCTCGCCTTGTCCCAGCAAGCACATGCT CGCCTAGGACCAACCTACACGGTTCGCCGCTGGGCCTGGGAAGTCATTTATACGTGCGACAGCCGCAACATCAAG CATCTGCTCGCCAGCGGCTTCTCCGACTTTGCCCTGCCGCGCCTGCGCGTTGCAGCGCTTGAGACTCTGGTCGGT CGGGGCATCTTTACCCTCAACGGCCAAGCTTGGTCGCGAGCCAGAGCTCGTCTCAAGCCTCTGCTGGCCCGCCTG GACCATGAGGCTGCTGTCGAGGCGCTCGAGGGCCACTTCCAGGCCATGCTCAACTTGATTTGCCCATGCCGTGAC TCTCTGACAGCCCAAGTCGATCTACAGCCCCTCTTCTTCCGCCTGGCCATGGAGTTTGCCGGAAGCTTCTTGCTC GGCGCATCGACGGGCATGTTGCACAAGAGCGAGGCTGCCGAGGGCTTCGTGCGCGACTACATGACGTGCTCGACC GAAGTGGTGCGCAGACTGGGCTGCGGCCCGCTGCAGCACTTGCGCTTCAGCCCACGCTGCCACAAAGCCAAGCAG CGCGTGTTTGGGTACATTGAGCGCTTCATCGACGACGCCCTGGCCACGGCGGCGGCTCCAAGTAGAGCAAACAAA GCTCCAGACAGTGTGCTAGTCCGCCTGGCAGCCGTGACTCCAGACCGCGCGGCGCTGAGAGACCAGGTCTTGCAC CTGCTTGTCGCCAGTCGAGACACAACGGCCAGCATGCTGAGCAACCTGTTTTTTGTGCTGGCACAAGAGCCAGCC GTGTGGACACGACTGCGGCATGAAGTCATGGCCATTTCAGGGCAAACGTGTCCGTCGGTGGCGCAGCTGCGACAG ATGCAATATGCCCGTTGGTGCGTCAATGAATGTGAGCCTCTTTTCCCCTCACAGGTGCGCCAGCCATTGCTGATG AGGGAGGGACCAACTAGCATTGAGATTGCATCCTGTCATACCAACAAATGCCCGCGAGGCAACTCGAGACACAAC CATCCCCAGGGGAGGTGGACCTGACGGTACAGCGCCCTTGCTGGTGCGTCGCGGCATCGTTGTCGTGTACAACCT TTACGCCATGCACCGCGATGCCAATGTCTTTGGCCCCAACCCCGAGGCCTTTGTGCCGGAGAGATGGGCTGCCTT GCGTCCCGGATGGGGATTTCTGCCCTTTAATGGCGGCGCAAGAACATGTCTTGGGCGTAAGGAATCCTCAAGTCT ATCTGTAAAACAAGGCCATGCTGACTTGCACATGGAACAGAGCAGCTAGCCCTGACTGAGGCTCTCTTTGTGGTG GCGAGGATGGCGCAAACATTTGAAAGAATTCATGGGCTAGGCGGAAGGGAATGGGTCGAGCTGTATGCCCTGGCA ACCACGTGTCGCGACGGCGTTGAAGTGAAGCTGCAAAAAGGATAG |