Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6959
Gene name
LocationContig_7:26048..26873
Strand+
Gene length (bp)825
Transcript length (bp)825
Coding sequence length (bp)825
Protein length (aa) 275

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09791 Oxidored-like Oxidoreductase-like protein, N-terminal 1.1E-24 160 203

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q02873|YP107_YEAST UPF0651 protein YPL107W, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL107W PE=1 SV=1 127 206 9.0E-16
sp|Q9USH2|YJH2_SCHPO UPF0651 protein P31B10.02, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCP31B10.02 PE=3 SV=1 162 205 2.0E-10

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2492
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7513
Ophiocordyceps australis map64 (Brazil) OphauB2|6959 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01114
Ophiocordyceps camponoti-rufipedis Ophun1|7193
Ophiocordyceps kimflemingae Ophio5|3624
Ophiocordyceps subramaniannii Hirsu2|3604

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6959
MSAPLRPAASRLGLSCPFSSATPRRCFTCSVRLAKNEQWPQRSPLGAYYSTILNDPTLYLGQPSRAQSLPSSSPS
PGPSFDDAPKKPKPQGKKKPGRKPKIAPIESVASPNPSAGTSPPVPSPPPKSAAEKARIVFGSRLLGPAEQADRL
ATKRSQSSYVAGVLVPPRPEEPDNCCMSGCVNCVWDRFREDMEEWTAKKSQAQRRLKQGSHGDSVDSDGGRTDVG
LNMPMADAHLTHDMWNDDIFKTLPVGIREFMKQEKRLKEKHERERSVAG*
Coding >OphauB2|6959
ATGTCAGCACCACTGAGACCAGCAGCAAGCCGTCTTGGCCTCTCCTGCCCCTTTTCTTCAGCAACACCCAGGCGC
TGCTTCACATGTAGCGTCCGCCTCGCCAAAAACGAGCAATGGCCACAACGAAGCCCTCTTGGCGCCTACTACAGT
ACCATTTTGAATGATCCGACTCTGTATCTTGGCCAGCCAAGTCGTGCGCAAAGTTTGCCGTCCTCGTCGCCGTCG
CCAGGGCCGTCGTTTGACGACGCGCCCAAAAAGCCCAAGCCTCAAGGCAAAAAGAAGCCCGGTCGCAAGCCAAAG
ATTGCTCCCATCGAGTCAGTTGCATCTCCAAATCCGTCTGCTGGCACATCGCCCCCGGTGCCCTCGCCGCCGCCC
AAGTCAGCTGCCGAGAAAGCACGAATCGTATTTGGCTCACGTCTTCTCGGCCCCGCAGAACAAGCTGATCGTCTG
GCCACGAAGCGCTCCCAGTCAAGTTATGTCGCCGGCGTACTTGTGCCTCCACGGCCCGAAGAGCCCGATAATTGT
TGCATGAGCGGTTGTGTCAACTGCGTCTGGGATCGCTTCCGCGAGGACATGGAGGAATGGACAGCTAAAAAGAGC
CAAGCACAGAGGCGACTGAAGCAGGGAAGCCATGGTGACAGCGTCGACTCGGATGGCGGCAGGACCGACGTGGGC
TTGAATATGCCCATGGCTGATGCACACTTGACACACGACATGTGGAACGACGACATATTCAAGACGTTGCCAGTG
GGCATCCGCGAGTTTATGAAGCAGGAAAAGAGGCTCAAGGAGAAGCACGAGCGCGAGAGAAGCGTTGCAGGATAA
Transcript >OphauB2|6959
ATGTCAGCACCACTGAGACCAGCAGCAAGCCGTCTTGGCCTCTCCTGCCCCTTTTCTTCAGCAACACCCAGGCGC
TGCTTCACATGTAGCGTCCGCCTCGCCAAAAACGAGCAATGGCCACAACGAAGCCCTCTTGGCGCCTACTACAGT
ACCATTTTGAATGATCCGACTCTGTATCTTGGCCAGCCAAGTCGTGCGCAAAGTTTGCCGTCCTCGTCGCCGTCG
CCAGGGCCGTCGTTTGACGACGCGCCCAAAAAGCCCAAGCCTCAAGGCAAAAAGAAGCCCGGTCGCAAGCCAAAG
ATTGCTCCCATCGAGTCAGTTGCATCTCCAAATCCGTCTGCTGGCACATCGCCCCCGGTGCCCTCGCCGCCGCCC
AAGTCAGCTGCCGAGAAAGCACGAATCGTATTTGGCTCACGTCTTCTCGGCCCCGCAGAACAAGCTGATCGTCTG
GCCACGAAGCGCTCCCAGTCAAGTTATGTCGCCGGCGTACTTGTGCCTCCACGGCCCGAAGAGCCCGATAATTGT
TGCATGAGCGGTTGTGTCAACTGCGTCTGGGATCGCTTCCGCGAGGACATGGAGGAATGGACAGCTAAAAAGAGC
CAAGCACAGAGGCGACTGAAGCAGGGAAGCCATGGTGACAGCGTCGACTCGGATGGCGGCAGGACCGACGTGGGC
TTGAATATGCCCATGGCTGATGCACACTTGACACACGACATGTGGAACGACGACATATTCAAGACGTTGCCAGTG
GGCATCCGCGAGTTTATGAAGCAGGAAAAGAGGCTCAAGGAGAAGCACGAGCGCGAGAGAAGCGTTGCAGGATAA
Gene >OphauB2|6959
ATGTCAGCACCACTGAGACCAGCAGCAAGCCGTCTTGGCCTCTCCTGCCCCTTTTCTTCAGCAACACCCAGGCGC
TGCTTCACATGTAGCGTCCGCCTCGCCAAAAACGAGCAATGGCCACAACGAAGCCCTCTTGGCGCCTACTACAGT
ACCATTTTGAATGATCCGACTCTGTATCTTGGCCAGCCAAGTCGTGCGCAAAGTTTGCCGTCCTCGTCGCCGTCG
CCAGGGCCGTCGTTTGACGACGCGCCCAAAAAGCCCAAGCCTCAAGGCAAAAAGAAGCCCGGTCGCAAGCCAAAG
ATTGCTCCCATCGAGTCAGTTGCATCTCCAAATCCGTCTGCTGGCACATCGCCCCCGGTGCCCTCGCCGCCGCCC
AAGTCAGCTGCCGAGAAAGCACGAATCGTATTTGGCTCACGTCTTCTCGGCCCCGCAGAACAAGCTGATCGTCTG
GCCACGAAGCGCTCCCAGTCAAGTTATGTCGCCGGCGTACTTGTGCCTCCACGGCCCGAAGAGCCCGATAATTGT
TGCATGAGCGGTTGTGTCAACTGCGTCTGGGATCGCTTCCGCGAGGACATGGAGGAATGGACAGCTAAAAAGAGC
CAAGCACAGAGGCGACTGAAGCAGGGAAGCCATGGTGACAGCGTCGACTCGGATGGCGGCAGGACCGACGTGGGC
TTGAATATGCCCATGGCTGATGCACACTTGACACACGACATGTGGAACGACGACATATTCAAGACGTTGCCAGTG
GGCATCCGCGAGTTTATGAAGCAGGAAAAGAGGCTCAAGGAGAAGCACGAGCGCGAGAGAAGCGTTGCAGGATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail