Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6953
Gene name
LocationContig_7:16484..17296
Strand+
Gene length (bp)812
Transcript length (bp)756
Coding sequence length (bp)756
Protein length (aa) 252

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6109
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3588
Ophiocordyceps australis 1348a (Ghana) OphauG2|3589
Ophiocordyceps australis map64 (Brazil) OphauB2|6953 (this protein)
Ophiocordyceps kimflemingae Ophio5|5697
Ophiocordyceps subramaniannii Hirsu2|3598

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6953
MRLPGRLLGRCSQPSYKTPGEGHGQGLGWHHGLRLLKLVDLPLDKRLSLVNHSHTLAPLIRLLHLIAQPVKRLEP
IFEDEDIYDQDYDFESGGTAVLGPHGVVVVGEPPEQVDEAAQAEQHEQRVYHAEEQSSAPKTLPRHTIYWTSASR
RRREYAAIDAATHGLSGWMKRKVLPKSMGGLRHIPFDNDDDDDASSVRRHRVSLQGVPEEIVFASADEEGAKTEI
EPLSPGRRKLLRRISFHKSSKMENKD*
Coding >OphauB2|6953
ATGAGGCTTCCAGGCCGGTTGCTGGGACGCTGTTCACAGCCCAGCTACAAAACACCAGGTGAAGGGCATGGCCAA
GGGCTGGGCTGGCATCATGGGCTGCGTCTACTTAAACTCGTGGACCTGCCCCTCGACAAGAGACTGAGCCTGGTC
AACCACTCGCACACTCTGGCGCCCTTGATCCGACTGCTACACTTGATTGCACAGCCCGTCAAGCGGCTCGAGCCC
ATCTTTGAGGACGAGGATATCTATGACCAAGACTATGACTTTGAGTCTGGAGGCACTGCGGTGCTTGGGCCTCAC
GGTGTAGTAGTAGTTGGTGAGCCCCCAGAGCAAGTGGACGAAGCAGCCCAAGCCGAGCAGCACGAGCAGCGCGTC
TACCATGCCGAGGAGCAATCCTCGGCACCCAAGACGCTGCCTCGGCACACCATTTACTGGACCAGCGCCAGCCGC
CGTCGCCGCGAGTATGCTGCCATTGACGCCGCCACTCACGGCCTGTCTGGCTGGATGAAGCGCAAAGTGCTCCCC
AAGAGCATGGGCGGCCTGCGCCACATTCCCTTTGACAACGATGACGACGACGACGCAAGCAGTGTGCGGCGCCAT
CGCGTCTCGCTCCAAGGTGTTCCCGAGGAAATCGTCTTTGCGAGCGCTGACGAGGAGGGGGCCAAGACGGAGATT
GAGCCGCTGTCCCCAGGCCGACGCAAGCTTCTGCGAAGAATCTCCTTCCACAAGAGCAGCAAGATGGAGAACAAA
GACTAA
Transcript >OphauB2|6953
ATGAGGCTTCCAGGCCGGTTGCTGGGACGCTGTTCACAGCCCAGCTACAAAACACCAGGTGAAGGGCATGGCCAA
GGGCTGGGCTGGCATCATGGGCTGCGTCTACTTAAACTCGTGGACCTGCCCCTCGACAAGAGACTGAGCCTGGTC
AACCACTCGCACACTCTGGCGCCCTTGATCCGACTGCTACACTTGATTGCACAGCCCGTCAAGCGGCTCGAGCCC
ATCTTTGAGGACGAGGATATCTATGACCAAGACTATGACTTTGAGTCTGGAGGCACTGCGGTGCTTGGGCCTCAC
GGTGTAGTAGTAGTTGGTGAGCCCCCAGAGCAAGTGGACGAAGCAGCCCAAGCCGAGCAGCACGAGCAGCGCGTC
TACCATGCCGAGGAGCAATCCTCGGCACCCAAGACGCTGCCTCGGCACACCATTTACTGGACCAGCGCCAGCCGC
CGTCGCCGCGAGTATGCTGCCATTGACGCCGCCACTCACGGCCTGTCTGGCTGGATGAAGCGCAAAGTGCTCCCC
AAGAGCATGGGCGGCCTGCGCCACATTCCCTTTGACAACGATGACGACGACGACGCAAGCAGTGTGCGGCGCCAT
CGCGTCTCGCTCCAAGGTGTTCCCGAGGAAATCGTCTTTGCGAGCGCTGACGAGGAGGGGGCCAAGACGGAGATT
GAGCCGCTGTCCCCAGGCCGACGCAAGCTTCTGCGAAGAATCTCCTTCCACAAGAGCAGCAAGATGGAGAACAAA
GACTAA
Gene >OphauB2|6953
ATGAGGCTTCCAGGCCGGTTGCTGGGACGCTGTTCACAGCCCAGCTACAAAACACCAGGTGAAGGGCATGGCCAA
GGGCTGGGCTGGCATCATGGGCTGCGTCTACTTAAACTCGTGGACCTGCCCCTCGACAAGAGACTGAGCCTGGTC
AACCACTCGCACACTCTGGCGCCCTTGATCCGACTGCTACACTTGATTGCACAGGTTTTTTCATACCCTCTCTTG
TAGTCATAAAAATGCATTCTGACAAGCGCAAGCAGCCCGTCAAGCGGCTCGAGCCCATCTTTGAGGACGAGGATA
TCTATGACCAAGACTATGACTTTGAGTCTGGAGGCACTGCGGTGCTTGGGCCTCACGGTGTAGTAGTAGTTGGTG
AGCCCCCAGAGCAAGTGGACGAAGCAGCCCAAGCCGAGCAGCACGAGCAGCGCGTCTACCATGCCGAGGAGCAAT
CCTCGGCACCCAAGACGCTGCCTCGGCACACCATTTACTGGACCAGCGCCAGCCGCCGTCGCCGCGAGTATGCTG
CCATTGACGCCGCCACTCACGGCCTGTCTGGCTGGATGAAGCGCAAAGTGCTCCCCAAGAGCATGGGCGGCCTGC
GCCACATTCCCTTTGACAACGATGACGACGACGACGCAAGCAGTGTGCGGCGCCATCGCGTCTCGCTCCAAGGTG
TTCCCGAGGAAATCGTCTTTGCGAGCGCTGACGAGGAGGGGGCCAAGACGGAGATTGAGCCGCTGTCCCCAGGCC
GACGCAAGCTTCTGCGAAGAATCTCCTTCCACAAGAGCAGCAAGATGGAGAACAAAGACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail