Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|695
Gene name
LocationContig_113:992..2828
Strand+
Gene length (bp)1836
Transcript length (bp)1836
Coding sequence length (bp)1836
Protein length (aa) 612

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain 3.9E-26 14 185
PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain 1.4E-13 192 284

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q16836|HCDH_HUMAN Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Homo sapiens GN=HADH PE=1 SV=3 12 283 2.0E-25
sp|P52041|HBD_CLOAB 3-hydroxybutyryl-CoA dehydrogenase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=hbd PE=1 SV=2 12 283 4.0E-24
sp|Q9WVK7|HCDH_RAT Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Hadh PE=2 SV=1 12 283 7.0E-23
sp|P00348|HCDH_PIG Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Sus scrofa GN=HADH PE=1 SV=2 12 283 9.0E-23
sp|Q61425|HCDH_MOUSE Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Mus musculus GN=Hadh PE=1 SV=2 12 283 1.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q16836|HCDH_HUMAN Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Homo sapiens GN=HADH PE=1 SV=3 12 283 2.0E-25
sp|P52041|HBD_CLOAB 3-hydroxybutyryl-CoA dehydrogenase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=hbd PE=1 SV=2 12 283 4.0E-24
sp|Q9WVK7|HCDH_RAT Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Hadh PE=2 SV=1 12 283 7.0E-23
sp|P00348|HCDH_PIG Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Sus scrofa GN=HADH PE=1 SV=2 12 283 9.0E-23
sp|Q61425|HCDH_MOUSE Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Mus musculus GN=Hadh PE=1 SV=2 12 283 1.0E-22
sp|P77851|HBD_THETC 3-hydroxybutyryl-CoA dehydrogenase OS=Thermoanaerobacterium thermosaccharolyticum (strain ATCC 7956 / DSM 571 / NCIB 9385 / NCA 3814) GN=hbd PE=3 SV=2 12 283 9.0E-22
sp|P34439|HCDH1_CAEEL Probable 3-hydroxyacyl-CoA dehydrogenase F54C8.1 OS=Caenorhabditis elegans GN=F54C8.1 PE=1 SV=1 12 283 3.0E-21
sp|P41938|HCDH2_CAEEL Probable 3-hydroxyacyl-CoA dehydrogenase B0272.3 OS=Caenorhabditis elegans GN=B0272.3 PE=3 SV=1 13 283 8.0E-20
sp|P9WNP7|FADB2_MYCTU 3-hydroxybutyryl-CoA dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadB2 PE=1 SV=1 16 283 3.0E-18
sp|P9WNP6|FADB2_MYCTO 3-hydroxybutyryl-CoA dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadB2 PE=3 SV=1 16 283 3.0E-18
sp|P45364|HBD_PEPDI 3-hydroxybutyryl-CoA dehydrogenase OS=Peptoclostridium difficile GN=hbd PE=3 SV=1 14 286 4.0E-18
sp|Q5RDZ2|CRYL1_PONAB Lambda-crystallin homolog OS=Pongo abelii GN=CRYL1 PE=2 SV=3 13 262 8.0E-18
sp|Q9Y2S2|CRYL1_HUMAN Lambda-crystallin homolog OS=Homo sapiens GN=CRYL1 PE=1 SV=3 13 262 1.0E-17
sp|P45856|HBD_BACSU Probable 3-hydroxybutyryl-CoA dehydrogenase OS=Bacillus subtilis (strain 168) GN=mmgB PE=2 SV=1 12 283 6.0E-17
sp|P76083|PAAH_ECOLI 3-hydroxyadipyl-CoA dehydrogenase OS=Escherichia coli (strain K12) GN=paaH PE=1 SV=1 12 283 7.0E-16
sp|D7B2S5|LCDH_NOCDD L-carnitine dehydrogenase OS=Nocardiopsis dassonvillei (strain ATCC 23218 / DSM 43111 / IMRU 509 / JCM 7437 / NCTC 10488) GN=lcdH PE=3 SV=1 12 234 3.0E-15
sp|Q9RVG1|HBD_DEIRA Probable 3-hydroxybutyryl-CoA dehydrogenase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=hbd PE=3 SV=1 16 283 1.0E-14
sp|Q99KP3|CRYL1_MOUSE Lambda-crystallin homolog OS=Mus musculus GN=Cryl1 PE=1 SV=3 14 262 8.0E-14
sp|Q811X6|CRYL1_RAT Lambda-crystallin homolog OS=Rattus norvegicus GN=Cryl1 PE=1 SV=3 14 252 1.0E-13
sp|Q8CUW0|LCDH_OCEIH L-carnitine dehydrogenase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=lcdH PE=3 SV=1 12 222 2.0E-13
sp|Q45223|HBD_BRADU 3-hydroxybutyryl-CoA dehydrogenase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hbdA PE=3 SV=1 12 283 2.0E-13
sp|Q4V182|LCDH_BACCZ L-carnitine dehydrogenase OS=Bacillus cereus (strain ZK / E33L) GN=lcdH PE=3 SV=1 12 227 7.0E-13
sp|P14755|CRYL1_RABIT Lambda-crystallin OS=Oryctolagus cuniculus GN=CRYL1 PE=1 SV=3 14 252 4.0E-12
sp|Q8SQ26|CRYL1_PIG Lambda-crystallin homolog OS=Sus scrofa GN=CRYL1 PE=2 SV=3 9 252 5.0E-12
sp|P07896|ECHP_RAT Peroxisomal bifunctional enzyme OS=Rattus norvegicus GN=Ehhadh PE=1 SV=2 13 283 7.0E-12
sp|Q08426|ECHP_HUMAN Peroxisomal bifunctional enzyme OS=Homo sapiens GN=EHHADH PE=1 SV=3 13 283 1.0E-11
sp|Q5LTH8|LCDH_RUEPO L-carnitine dehydrogenase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=lcdH PE=3 SV=1 34 222 1.0E-11
sp|Q93RX5|LCDH_STRCO L-carnitine dehydrogenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=lcdH PE=3 SV=1 12 227 2.0E-11
sp|Q8SPX7|CRYL1_BOVIN Lambda-crystallin homolog OS=Bos taurus GN=CRYL1 PE=2 SV=3 14 252 2.0E-11
sp|B1VLT7|LCDH_STRGG L-carnitine dehydrogenase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=lcdH PE=3 SV=1 12 227 2.0E-11
sp|Q5R5M8|ECHP_PONAB Peroxisomal bifunctional enzyme OS=Pongo abelii GN=EHHADH PE=2 SV=1 13 245 2.0E-11
sp|Q98CR3|LCDH_RHILO L-carnitine dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=lcdH PE=3 SV=1 34 223 4.0E-11
sp|O49809|MFPA_BRANA Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a OS=Brassica napus PE=2 SV=2 5 283 1.0E-10
sp|Q88R32|LCDH_PSEPK L-carnitine dehydrogenase OS=Pseudomonas putida (strain KT2440) GN=lcdH PE=3 SV=1 12 221 3.0E-10
sp|Q8W1L6|MFP_ORYSJ Peroxisomal fatty acid beta-oxidation multifunctional protein OS=Oryza sativa subsp. japonica GN=MFP PE=1 SV=2 12 283 3.0E-10
sp|Q39659|MFPA_CUCSA Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a OS=Cucumis sativus PE=1 SV=1 12 286 4.0E-10
sp|Q8CQB9|LCDH_STAES L-carnitine dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=lcdH PE=3 SV=1 16 222 4.0E-10
sp|Q9ZPI5|MFP2_ARATH Peroxisomal fatty acid beta-oxidation multifunctional protein MFP2 OS=Arabidopsis thaliana GN=MFP2 PE=1 SV=1 5 283 5.0E-10
sp|Q9DBM2|ECHP_MOUSE Peroxisomal bifunctional enzyme OS=Mus musculus GN=Ehhadh PE=1 SV=4 13 283 5.0E-10
sp|Q7D3B2|LCDH_AGRFC L-carnitine dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=lcdH PE=3 SV=2 33 223 1.0E-09
sp|A8A2L0|FADJ_ECOHS Fatty acid oxidation complex subunit alpha OS=Escherichia coli O9:H4 (strain HS) GN=fadJ PE=3 SV=1 13 283 5.0E-09
sp|O32178|FADN_BACSU Probable 3-hydroxyacyl-CoA dehydrogenase OS=Bacillus subtilis (strain 168) GN=fadN PE=2 SV=2 12 283 5.0E-09
sp|Q92NF5|LCDH_RHIME L-carnitine dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=lcdH PE=3 SV=1 9 223 6.0E-09
sp|D7URM0|LCDH_PSESP L-carnitine dehydrogenase OS=Pseudomonas sp. GN=lcdH PE=1 SV=1 12 221 8.0E-09
sp|D7UNT2|LCDH_RHISP L-carnitine dehydrogenase OS=Rhizobium sp. GN=lcdH PE=1 SV=1 17 223 1.0E-08
sp|Q62DG4|LCDH_BURMA L-carnitine dehydrogenase OS=Burkholderia mallei (strain ATCC 23344) GN=lcdH PE=3 SV=2 13 221 1.0E-08
sp|P55100|ECHP_CAVPO Peroxisomal bifunctional enzyme OS=Cavia porcellus GN=EHHADH PE=2 SV=2 13 245 1.0E-08
sp|A3QFP3|FADJ_SHELP Fatty acid oxidation complex subunit alpha OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=fadJ PE=3 SV=1 82 283 1.0E-08
sp|Q5QXM1|FADJ_IDILO Fatty acid oxidation complex subunit alpha OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=fadJ PE=3 SV=1 85 317 2.0E-08
sp|P83589|HCDH_DEIRA Probable 3-hydroxyacyl-CoA dehydrogenase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=DR_2477 PE=1 SV=2 78 249 2.0E-08
sp|Q63MT0|LCDH_BURPS L-carnitine dehydrogenase OS=Burkholderia pseudomallei (strain K96243) GN=lcdH PE=3 SV=1 13 221 3.0E-08
sp|Q9ZCZ1|FAD3_RICPR Putative fatty acid oxidation complex trifunctional enzyme OS=Rickettsia prowazekii (strain Madrid E) GN=RP560 PE=3 SV=1 12 289 4.0E-08
sp|Q4UL32|FAD3_RICFE Putative fatty acid oxidation complex trifunctional enzyme OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0890 PE=3 SV=1 12 318 4.0E-08
sp|A6WQ25|FADJ_SHEB8 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS185) GN=fadJ PE=3 SV=1 82 283 9.0E-08
sp|A3D684|FADJ_SHEB5 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=fadJ PE=3 SV=1 82 283 1.0E-07
sp|P40939|ECHA_HUMAN Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens GN=HADHA PE=1 SV=2 4 283 1.0E-07
sp|Q8ECP7|FADJ_SHEON Fatty acid oxidation complex subunit alpha OS=Shewanella oneidensis (strain MR-1) GN=fadJ PE=3 SV=2 82 283 2.0E-07
sp|Q64428|ECHA_RAT Trifunctional enzyme subunit alpha, mitochondrial OS=Rattus norvegicus GN=Hadha PE=1 SV=2 4 283 2.0E-07
sp|A1RI92|FADJ_SHESW Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain W3-18-1) GN=fadJ PE=3 SV=1 82 283 2.0E-07
sp|Q29554|ECHA_PIG Trifunctional enzyme subunit alpha, mitochondrial OS=Sus scrofa GN=HADHA PE=1 SV=1 82 283 2.0E-07
sp|B5R3R9|FADJ_SALEP Fatty acid oxidation complex subunit alpha OS=Salmonella enteritidis PT4 (strain P125109) GN=fadJ PE=3 SV=1 89 283 4.0E-07
sp|B5BBA1|FADJ_SALPK Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi A (strain AKU_12601) GN=fadJ PE=3 SV=1 89 283 4.0E-07
sp|Q5PCX6|FADJ_SALPA Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=fadJ PE=3 SV=1 89 283 4.0E-07
sp|B4TQC2|FADJ_SALSV Fatty acid oxidation complex subunit alpha OS=Salmonella schwarzengrund (strain CVM19633) GN=fadJ PE=3 SV=1 89 283 4.0E-07
sp|B4SZR0|FADJ_SALNS Fatty acid oxidation complex subunit alpha OS=Salmonella newport (strain SL254) GN=fadJ PE=3 SV=1 89 283 4.0E-07
sp|Q8ZNA7|FADJ_SALTY Fatty acid oxidation complex subunit alpha OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadJ PE=3 SV=1 89 283 4.0E-07
sp|Q8BMS1|ECHA_MOUSE Trifunctional enzyme subunit alpha, mitochondrial OS=Mus musculus GN=Hadha PE=1 SV=1 4 283 4.0E-07
sp|B4TCA8|FADJ_SALHS Fatty acid oxidation complex subunit alpha OS=Salmonella heidelberg (strain SL476) GN=fadJ PE=3 SV=1 89 283 4.0E-07
sp|B5EZR9|FADJ_SALA4 Fatty acid oxidation complex subunit alpha OS=Salmonella agona (strain SL483) GN=fadJ PE=3 SV=1 89 283 4.0E-07
sp|A9N453|FADJ_SALPB Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=fadJ PE=3 SV=1 89 283 4.0E-07
sp|Q0HKD1|FADJ_SHESM Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain MR-4) GN=fadJ PE=3 SV=1 82 301 4.0E-07
sp|Q8Z4Z0|FADJ_SALTI Fatty acid oxidation complex subunit alpha OS=Salmonella typhi GN=fadJ PE=3 SV=1 89 283 4.0E-07
sp|Q57LW6|FADJ_SALCH Fatty acid oxidation complex subunit alpha OS=Salmonella choleraesuis (strain SC-B67) GN=fadJ PE=3 SV=1 89 283 4.0E-07
sp|A0KV76|FADJ_SHESA Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain ANA-3) GN=fadJ PE=3 SV=1 82 283 5.0E-07
sp|B0TL21|FADJ_SHEHH Fatty acid oxidation complex subunit alpha OS=Shewanella halifaxensis (strain HAW-EB4) GN=fadJ PE=3 SV=1 82 283 5.0E-07
sp|Q4ZSC0|LCDH_PSEU2 L-carnitine dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=lcdH PE=3 SV=1 12 221 5.0E-07
sp|Q08A39|FADB_SHEFN Fatty acid oxidation complex subunit alpha OS=Shewanella frigidimarina (strain NCIMB 400) GN=fadB PE=3 SV=1 83 283 5.0E-07
sp|A4WCW6|FADJ_ENT38 Fatty acid oxidation complex subunit alpha OS=Enterobacter sp. (strain 638) GN=fadJ PE=3 SV=1 89 283 5.0E-07
sp|Q8FFG4|FADJ_ECOL6 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadJ PE=3 SV=1 89 283 6.0E-07
sp|Q9HTH8|LCDH_PSEAE L-carnitine dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lcdH PE=1 SV=1 9 221 6.0E-07
sp|Q0HWN3|FADJ_SHESR Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain MR-7) GN=fadJ PE=3 SV=1 82 283 6.0E-07
sp|B7LBJ5|FADJ_ECO55 Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain 55989 / EAEC) GN=fadJ PE=3 SV=1 89 283 6.0E-07
sp|Q5E3U1|FADJ_VIBF1 Fatty acid oxidation complex subunit alpha OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=fadJ PE=3 SV=2 89 283 6.0E-07
sp|Q0T2E6|FADJ_SHIF8 Fatty acid oxidation complex subunit alpha OS=Shigella flexneri serotype 5b (strain 8401) GN=fadJ PE=3 SV=1 89 283 7.0E-07
sp|Q3YZM2|FADJ_SHISS Fatty acid oxidation complex subunit alpha OS=Shigella sonnei (strain Ss046) GN=fadJ PE=3 SV=1 89 283 7.0E-07
sp|Q83QQ0|FADJ_SHIFL Fatty acid oxidation complex subunit alpha OS=Shigella flexneri GN=fadJ PE=3 SV=1 89 283 7.0E-07
sp|B7MY16|FADJ_ECO81 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O81 (strain ED1a) GN=fadJ PE=3 SV=1 89 283 9.0E-07
sp|B7LLD0|FADJ_ESCF3 Fatty acid oxidation complex subunit alpha OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=fadJ PE=3 SV=1 89 283 9.0E-07
sp|B1LME7|FADJ_ECOSM Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=fadJ PE=3 SV=1 89 283 1.0E-06
sp|B7NP24|FADJ_ECO7I Fatty acid oxidation complex subunit alpha OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=fadJ PE=3 SV=1 89 283 1.0E-06
sp|B7M6M2|FADJ_ECO8A Fatty acid oxidation complex subunit alpha OS=Escherichia coli O8 (strain IAI1) GN=fadJ PE=3 SV=1 89 283 1.0E-06
sp|B5XVW2|FADJ_KLEP3 Fatty acid oxidation complex subunit alpha OS=Klebsiella pneumoniae (strain 342) GN=fadJ PE=3 SV=1 89 287 1.0E-06
sp|A7ZPF8|FADJ_ECO24 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fadJ PE=3 SV=1 89 283 1.0E-06
sp|B6I6Q4|FADJ_ECOSE Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain SE11) GN=fadJ PE=3 SV=1 89 283 1.0E-06
sp|B5FPN1|FADJ_SALDC Fatty acid oxidation complex subunit alpha OS=Salmonella dublin (strain CT_02021853) GN=fadJ PE=3 SV=1 89 283 1.0E-06
sp|P98158|LRP2_RAT Low-density lipoprotein receptor-related protein 2 OS=Rattus norvegicus GN=Lrp2 PE=1 SV=1 315 519 1.0E-06
sp|Q32DJ4|FADJ_SHIDS Fatty acid oxidation complex subunit alpha OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=fadJ PE=3 SV=1 89 283 1.0E-06
sp|B1IXA5|FADJ_ECOLC Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=fadJ PE=3 SV=1 89 283 1.0E-06
sp|B5RCL3|FADJ_SALG2 Fatty acid oxidation complex subunit alpha OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=fadJ PE=3 SV=1 89 283 1.0E-06
sp|Q0TFA6|FADJ_ECOL5 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=fadJ PE=3 SV=1 89 283 1.0E-06
sp|B7MGV7|FADJ_ECO45 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=fadJ PE=3 SV=1 89 283 1.0E-06
sp|B7N5V2|FADJ_ECOLU Fatty acid oxidation complex subunit alpha OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=fadJ PE=3 SV=1 89 283 1.0E-06
sp|Q1R972|FADJ_ECOUT Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain UTI89 / UPEC) GN=fadJ PE=3 SV=1 89 283 1.0E-06
sp|A1ADI8|FADJ_ECOK1 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O1:K1 / APEC GN=fadJ PE=3 SV=1 89 283 1.0E-06
sp|B7UFZ8|FADJ_ECO27 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=fadJ PE=3 SV=1 89 283 2.0E-06
sp|Q8VI56|LRP4_MOUSE Low-density lipoprotein receptor-related protein 4 OS=Mus musculus GN=Lrp4 PE=1 SV=3 371 594 2.0E-06
sp|A1S7L6|FADJ_SHEAM Fatty acid oxidation complex subunit alpha OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=fadJ PE=3 SV=1 82 283 2.0E-06
sp|O75096|LRP4_HUMAN Low-density lipoprotein receptor-related protein 4 OS=Homo sapiens GN=LRP4 PE=1 SV=4 371 594 2.0E-06
sp|O75197|LRP5_HUMAN Low-density lipoprotein receptor-related protein 5 OS=Homo sapiens GN=LRP5 PE=1 SV=2 339 519 3.0E-06
sp|P77399|FADJ_ECOLI Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12) GN=fadJ PE=1 SV=1 89 283 3.0E-06
sp|B1X9L4|FADJ_ECODH Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12 / DH10B) GN=fadJ PE=3 SV=1 89 283 3.0E-06
sp|C4ZVN2|FADJ_ECOBW Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=fadJ PE=3 SV=1 89 283 3.0E-06
sp|Q9QYP1|LRP4_RAT Low-density lipoprotein receptor-related protein 4 OS=Rattus norvegicus GN=Lrp4 PE=1 SV=2 371 594 3.0E-06
sp|A8ADP2|FADJ_CITK8 Fatty acid oxidation complex subunit alpha OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=fadJ PE=3 SV=1 26 283 3.0E-06
sp|Q91VN0|LRP5_MOUSE Low-density lipoprotein receptor-related protein 5 OS=Mus musculus GN=Lrp5 PE=1 SV=3 339 519 4.0E-06
sp|B2TWV4|FADJ_SHIB3 Fatty acid oxidation complex subunit alpha OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=fadJ PE=3 SV=1 89 283 4.0E-06
sp|Q31YB7|FADJ_SHIBS Fatty acid oxidation complex subunit alpha OS=Shigella boydii serotype 4 (strain Sb227) GN=fadJ PE=3 SV=1 89 283 5.0E-06
sp|Q07ZP8|FADJ_SHEFN Fatty acid oxidation complex subunit alpha OS=Shewanella frigidimarina (strain NCIMB 400) GN=fadJ PE=3 SV=1 84 283 6.0E-06
sp|Q8XCP2|FADJ_ECO57 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 GN=fadJ PE=3 SV=1 89 283 6.0E-06
sp|O75096|LRP4_HUMAN Low-density lipoprotein receptor-related protein 4 OS=Homo sapiens GN=LRP4 PE=1 SV=4 356 519 7.0E-06
sp|B5YXY4|FADJ_ECO5E Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=fadJ PE=3 SV=1 89 283 7.0E-06
sp|A5F2P2|FADJ_VIBC3 Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=fadJ PE=3 SV=1 89 283 7.0E-06
sp|C6DAL7|FADJ_PECCP Fatty acid oxidation complex subunit alpha OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=fadJ PE=3 SV=1 82 283 7.0E-06
sp|Q9KT58|FADJ_VIBCH Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fadJ PE=3 SV=2 89 283 8.0E-06
sp|O75581|LRP6_HUMAN Low-density lipoprotein receptor-related protein 6 OS=Homo sapiens GN=LRP6 PE=1 SV=2 339 519 8.0E-06
sp|O88572|LRP6_MOUSE Low-density lipoprotein receptor-related protein 6 OS=Mus musculus GN=Lrp6 PE=1 SV=1 339 519 9.0E-06
sp|Q68WH7|FAD3_RICTY Putative fatty acid oxidation complex trifunctional enzyme OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0547 PE=3 SV=1 12 198 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0070403 NAD+ binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0006631 fatty acid metabolic process Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:1901265 nucleoside phosphate binding No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0019752 carboxylic acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043436 oxoacid metabolic process No
GO:0003824 catalytic activity No
GO:0097159 organic cyclic compound binding No
GO:0006629 lipid metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0044281 small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0036094 small molecule binding No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0032787 monocarboxylic acid metabolic process No
GO:0051287 NAD binding No
GO:0044238 primary metabolic process No
GO:0043168 anion binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup604
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1095
Ophiocordyceps australis 1348a (Ghana) OphauG2|2126
Ophiocordyceps australis map64 (Brazil) OphauB2|695 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02144
Ophiocordyceps camponoti-rufipedis Ophun1|6895
Ophiocordyceps kimflemingae Ophio5|3944
Ophiocordyceps subramaniannii Hirsu2|8320
Ophiocordyceps subramaniannii Hirsu2|8321

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|695
MASFKLPDTTGRSVVVLGGGVLGRRIAACWAAGGHEVRVRDPSAEQRAAAVKYVEDSYALYAPNIPVAVKPGTVT
AFEDLGKAVENAWLVIEAVPELLPLKISTFADLEKLAPKDALLCSNSSSYKSREMIDGLQEATKKRISNQHYYMP
PHVRIVELMTCSFTDESIFPFMTEKLRAVGLHPYTARKESTGLIFNRLWAAIKRESLNILAEGVSVPEEVDQMWV
EGLAKSSGPMRSMDSVGLDTVSFIEQHYVKERHLPDTPVKFLQKYIDEGRLGKKSPKGGLYPPSHTTQSADGKDA
PLLYFLDVGLNDPNFSNIMHGGRIVLGHPDGRAIRQLATGQVMPDGIDISVSAGKMFWTSMGIPSANDGSILSAN
LDGSDIKTIVAPGKVHTPKQLVVDEKNNKLYYADREGMRVFRCDFDGSNIETLVQAADWKDGDAKAKQTNWCVGV
AVSPATGKFFWTQKGYSKSNKGRIFCANIDFKKGETAATRTDIETIFQGLPEPIDLEVDEKGKMLYWTDRGELPL
GNSINRVSFDKMKPVEGTAPSLPGKNYELLVRNLHEAIGLKLDIKNGHMYATDLGGTLYRFDLDGGKRKKIYENL
GSFTGISLVYP*
Coding >OphauB2|695
ATGGCTTCTTTCAAACTACCAGACACTACAGGTCGTAGTGTTGTCGTACTTGGAGGTGGCGTTCTTGGCCGACGT
ATAGCTGCTTGTTGGGCAGCTGGAGGCCATGAGGTTCGGGTTCGTGACCCAAGCGCAGAGCAACGAGCGGCTGCA
GTGAAATACGTCGAAGACAGTTACGCCCTGTACGCACCAAACATTCCTGTGGCGGTCAAACCGGGCACAGTCACT
GCATTCGAAGATTTAGGCAAGGCTGTGGAAAACGCTTGGTTGGTTATTGAAGCCGTGCCAGAACTCCTACCGCTA
AAGATTTCGACATTTGCCGACTTGGAGAAACTGGCACCCAAGGATGCACTCCTTTGCAGCAATTCCTCGTCATAC
AAGTCGCGCGAGATGATTGATGGCCTCCAAGAGGCAACCAAGAAGCGCATATCCAACCAGCACTACTACATGCCC
CCACACGTTCGAATTGTTGAGCTCATGACTTGCAGCTTTACCGATGAAAGTATATTTCCCTTCATGACCGAGAAG
CTAAGGGCAGTTGGCCTGCATCCATATACAGCGCGCAAAGAGTCCACGGGCCTCATTTTCAACCGCCTTTGGGCC
GCCATCAAGCGAGAGAGTCTTAATATTCTTGCCGAGGGCGTCTCAGTTCCCGAGGAAGTCGACCAGATGTGGGTT
GAGGGACTGGCGAAATCTTCTGGCCCCATGCGCTCGATGGATTCTGTCGGCCTTGACACGGTGTCTTTTATCGAG
CAACACTACGTCAAAGAGCGTCACCTCCCTGATACGCCTGTCAAGTTCCTGCAAAAGTATATTGACGAGGGTCGT
CTGGGCAAAAAGTCTCCCAAGGGTGGTCTTTACCCCCCCAGCCATACCACCCAATCGGCAGATGGAAAGGACGCG
CCCTTGTTGTACTTTCTTGACGTTGGACTTAACGACCCCAATTTTTCAAATATTATGCACGGCGGCCGTATTGTT
CTTGGTCATCCTGACGGCCGAGCTATCAGGCAGCTCGCCACGGGTCAAGTGATGCCCGACGGCATTGATATTTCT
GTTTCTGCTGGTAAGATGTTTTGGACTAGCATGGGAATACCTTCGGCGAATGATGGCTCCATTCTCAGTGCCAAT
TTAGATGGCAGCGACATTAAGACCATTGTGGCACCTGGAAAGGTGCATACTCCCAAACAGCTCGTGGTGGATGAG
AAGAACAACAAGCTCTATTATGCCGACCGAGAGGGCATGCGCGTCTTCCGCTGCGACTTTGATGGATCCAATATC
GAGACCCTTGTCCAAGCTGCCGACTGGAAGGACGGAGATGCCAAGGCTAAACAGACCAACTGGTGTGTCGGCGTT
GCTGTTTCTCCCGCAACCGGAAAATTCTTTTGGACGCAAAAAGGATACTCAAAGAGCAACAAGGGCCGCATCTTT
TGCGCCAATATTGACTTCAAAAAGGGCGAGACCGCTGCCACCCGCACCGACATTGAGACCATCTTCCAGGGCCTA
CCAGAGCCCATCGACCTCGAAGTCGATGAAAAGGGCAAGATGTTGTACTGGACCGATCGTGGCGAGCTCCCCCTG
GGAAATAGCATCAACCGCGTCAGCTTTGACAAGATGAAGCCCGTTGAGGGAACGGCACCAAGCTTGCCCGGCAAG
AACTACGAGCTTCTTGTCCGTAACCTGCACGAAGCAATTGGTCTCAAGCTTGACATTAAGAATGGCCACATGTAT
GCCACGGATCTCGGTGGTACGCTGTATAGGTTTGATTTGGATGGCGGCAAGAGGAAGAAGATTTACGAAAACCTT
GGGTCGTTTACTGGCATTTCTCTTGTATATCCTTAG
Transcript >OphauB2|695
ATGGCTTCTTTCAAACTACCAGACACTACAGGTCGTAGTGTTGTCGTACTTGGAGGTGGCGTTCTTGGCCGACGT
ATAGCTGCTTGTTGGGCAGCTGGAGGCCATGAGGTTCGGGTTCGTGACCCAAGCGCAGAGCAACGAGCGGCTGCA
GTGAAATACGTCGAAGACAGTTACGCCCTGTACGCACCAAACATTCCTGTGGCGGTCAAACCGGGCACAGTCACT
GCATTCGAAGATTTAGGCAAGGCTGTGGAAAACGCTTGGTTGGTTATTGAAGCCGTGCCAGAACTCCTACCGCTA
AAGATTTCGACATTTGCCGACTTGGAGAAACTGGCACCCAAGGATGCACTCCTTTGCAGCAATTCCTCGTCATAC
AAGTCGCGCGAGATGATTGATGGCCTCCAAGAGGCAACCAAGAAGCGCATATCCAACCAGCACTACTACATGCCC
CCACACGTTCGAATTGTTGAGCTCATGACTTGCAGCTTTACCGATGAAAGTATATTTCCCTTCATGACCGAGAAG
CTAAGGGCAGTTGGCCTGCATCCATATACAGCGCGCAAAGAGTCCACGGGCCTCATTTTCAACCGCCTTTGGGCC
GCCATCAAGCGAGAGAGTCTTAATATTCTTGCCGAGGGCGTCTCAGTTCCCGAGGAAGTCGACCAGATGTGGGTT
GAGGGACTGGCGAAATCTTCTGGCCCCATGCGCTCGATGGATTCTGTCGGCCTTGACACGGTGTCTTTTATCGAG
CAACACTACGTCAAAGAGCGTCACCTCCCTGATACGCCTGTCAAGTTCCTGCAAAAGTATATTGACGAGGGTCGT
CTGGGCAAAAAGTCTCCCAAGGGTGGTCTTTACCCCCCCAGCCATACCACCCAATCGGCAGATGGAAAGGACGCG
CCCTTGTTGTACTTTCTTGACGTTGGACTTAACGACCCCAATTTTTCAAATATTATGCACGGCGGCCGTATTGTT
CTTGGTCATCCTGACGGCCGAGCTATCAGGCAGCTCGCCACGGGTCAAGTGATGCCCGACGGCATTGATATTTCT
GTTTCTGCTGGTAAGATGTTTTGGACTAGCATGGGAATACCTTCGGCGAATGATGGCTCCATTCTCAGTGCCAAT
TTAGATGGCAGCGACATTAAGACCATTGTGGCACCTGGAAAGGTGCATACTCCCAAACAGCTCGTGGTGGATGAG
AAGAACAACAAGCTCTATTATGCCGACCGAGAGGGCATGCGCGTCTTCCGCTGCGACTTTGATGGATCCAATATC
GAGACCCTTGTCCAAGCTGCCGACTGGAAGGACGGAGATGCCAAGGCTAAACAGACCAACTGGTGTGTCGGCGTT
GCTGTTTCTCCCGCAACCGGAAAATTCTTTTGGACGCAAAAAGGATACTCAAAGAGCAACAAGGGCCGCATCTTT
TGCGCCAATATTGACTTCAAAAAGGGCGAGACCGCTGCCACCCGCACCGACATTGAGACCATCTTCCAGGGCCTA
CCAGAGCCCATCGACCTCGAAGTCGATGAAAAGGGCAAGATGTTGTACTGGACCGATCGTGGCGAGCTCCCCCTG
GGAAATAGCATCAACCGCGTCAGCTTTGACAAGATGAAGCCCGTTGAGGGAACGGCACCAAGCTTGCCCGGCAAG
AACTACGAGCTTCTTGTCCGTAACCTGCACGAAGCAATTGGTCTCAAGCTTGACATTAAGAATGGCCACATGTAT
GCCACGGATCTCGGTGGTACGCTGTATAGGTTTGATTTGGATGGCGGCAAGAGGAAGAAGATTTACGAAAACCTT
GGGTCGTTTACTGGCATTTCTCTTGTATATCCTTAG
Gene >OphauB2|695
ATGGCTTCTTTCAAACTACCAGACACTACAGGTCGTAGTGTTGTCGTACTTGGAGGTGGCGTTCTTGGCCGACGT
ATAGCTGCTTGTTGGGCAGCTGGAGGCCATGAGGTTCGGGTTCGTGACCCAAGCGCAGAGCAACGAGCGGCTGCA
GTGAAATACGTCGAAGACAGTTACGCCCTGTACGCACCAAACATTCCTGTGGCGGTCAAACCGGGCACAGTCACT
GCATTCGAAGATTTAGGCAAGGCTGTGGAAAACGCTTGGTTGGTTATTGAAGCCGTGCCAGAACTCCTACCGCTA
AAGATTTCGACATTTGCCGACTTGGAGAAACTGGCACCCAAGGATGCACTCCTTTGCAGCAATTCCTCGTCATAC
AAGTCGCGCGAGATGATTGATGGCCTCCAAGAGGCAACCAAGAAGCGCATATCCAACCAGCACTACTACATGCCC
CCACACGTTCGAATTGTTGAGCTCATGACTTGCAGCTTTACCGATGAAAGTATATTTCCCTTCATGACCGAGAAG
CTAAGGGCAGTTGGCCTGCATCCATATACAGCGCGCAAAGAGTCCACGGGCCTCATTTTCAACCGCCTTTGGGCC
GCCATCAAGCGAGAGAGTCTTAATATTCTTGCCGAGGGCGTCTCAGTTCCCGAGGAAGTCGACCAGATGTGGGTT
GAGGGACTGGCGAAATCTTCTGGCCCCATGCGCTCGATGGATTCTGTCGGCCTTGACACGGTGTCTTTTATCGAG
CAACACTACGTCAAAGAGCGTCACCTCCCTGATACGCCTGTCAAGTTCCTGCAAAAGTATATTGACGAGGGTCGT
CTGGGCAAAAAGTCTCCCAAGGGTGGTCTTTACCCCCCCAGCCATACCACCCAATCGGCAGATGGAAAGGACGCG
CCCTTGTTGTACTTTCTTGACGTTGGACTTAACGACCCCAATTTTTCAAATATTATGCACGGCGGCCGTATTGTT
CTTGGTCATCCTGACGGCCGAGCTATCAGGCAGCTCGCCACGGGTCAAGTGATGCCCGACGGCATTGATATTTCT
GTTTCTGCTGGTAAGATGTTTTGGACTAGCATGGGAATACCTTCGGCGAATGATGGCTCCATTCTCAGTGCCAAT
TTAGATGGCAGCGACATTAAGACCATTGTGGCACCTGGAAAGGTGCATACTCCCAAACAGCTCGTGGTGGATGAG
AAGAACAACAAGCTCTATTATGCCGACCGAGAGGGCATGCGCGTCTTCCGCTGCGACTTTGATGGATCCAATATC
GAGACCCTTGTCCAAGCTGCCGACTGGAAGGACGGAGATGCCAAGGCTAAACAGACCAACTGGTGTGTCGGCGTT
GCTGTTTCTCCCGCAACCGGAAAATTCTTTTGGACGCAAAAAGGATACTCAAAGAGCAACAAGGGCCGCATCTTT
TGCGCCAATATTGACTTCAAAAAGGGCGAGACCGCTGCCACCCGCACCGACATTGAGACCATCTTCCAGGGCCTA
CCAGAGCCCATCGACCTCGAAGTCGATGAAAAGGGCAAGATGTTGTACTGGACCGATCGTGGCGAGCTCCCCCTG
GGAAATAGCATCAACCGCGTCAGCTTTGACAAGATGAAGCCCGTTGAGGGAACGGCACCAAGCTTGCCCGGCAAG
AACTACGAGCTTCTTGTCCGTAACCTGCACGAAGCAATTGGTCTCAAGCTTGACATTAAGAATGGCCACATGTAT
GCCACGGATCTCGGTGGTACGCTGTATAGGTTTGATTTGGATGGCGGCAAGAGGAAGAAGATTTACGAAAACCTT
GGGTCGTTTACTGGCATTTCTCTTGTATATCCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail