Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6927
Gene name
LocationContig_69:47552..49890
Strand-
Gene length (bp)2338
Transcript length (bp)2271
Coding sequence length (bp)2271
Protein length (aa) 757

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06602 Myotub-related Myotubularin-like phosphatase domain 5.0E-154 120 578

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13819|YMR1_SCHPO Phosphoinositide 3-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19A8.03 PE=3 SV=1 1 643 3.0E-152
sp|P47147|YMR1_YEAST Phosphoinositide 3-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR1 PE=1 SV=1 1 646 1.0E-122
sp|Q5REB9|MTMR2_PONAB Myotubularin-related protein 2 OS=Pongo abelii GN=MTMR2 PE=2 SV=1 84 608 8.0E-97
sp|Q9Y216|MTMR7_HUMAN Myotubularin-related protein 7 OS=Homo sapiens GN=MTMR7 PE=1 SV=3 21 642 3.0E-96
sp|Q5R6F6|MTMR7_PONAB Myotubularin-related protein 7 OS=Pongo abelii GN=MTMR7 PE=2 SV=1 21 642 3.0E-96
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13819|YMR1_SCHPO Phosphoinositide 3-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19A8.03 PE=3 SV=1 1 643 3.0E-152
sp|P47147|YMR1_YEAST Phosphoinositide 3-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR1 PE=1 SV=1 1 646 1.0E-122
sp|Q5REB9|MTMR2_PONAB Myotubularin-related protein 2 OS=Pongo abelii GN=MTMR2 PE=2 SV=1 84 608 8.0E-97
sp|Q9Y216|MTMR7_HUMAN Myotubularin-related protein 7 OS=Homo sapiens GN=MTMR7 PE=1 SV=3 21 642 3.0E-96
sp|Q5R6F6|MTMR7_PONAB Myotubularin-related protein 7 OS=Pongo abelii GN=MTMR7 PE=2 SV=1 21 642 3.0E-96
sp|Q9Z2C9|MTMR7_MOUSE Myotubularin-related protein 7 OS=Mus musculus GN=Mtmr7 PE=1 SV=2 21 637 2.0E-95
sp|Q13614|MTMR2_HUMAN Myotubularin-related protein 2 OS=Homo sapiens GN=MTMR2 PE=1 SV=4 84 608 2.0E-95
sp|Q9Z2C5|MTM1_MOUSE Myotubularin OS=Mus musculus GN=Mtm1 PE=1 SV=2 82 645 1.0E-94
sp|Q9Z2D1|MTMR2_MOUSE Myotubularin-related protein 2 OS=Mus musculus GN=Mtmr2 PE=1 SV=3 120 608 2.0E-94
sp|A6QLT2|MTMR2_BOVIN Myotubularin-related protein 2 OS=Bos taurus GN=MTMR2 PE=2 SV=1 84 608 2.0E-94
sp|Q13496|MTM1_HUMAN Myotubularin OS=Homo sapiens GN=MTM1 PE=1 SV=2 82 645 3.0E-94
sp|Q5R9S3|MTM1_PONAB Myotubularin OS=Pongo abelii GN=MTM1 PE=2 SV=1 82 645 1.0E-93
sp|Q5ZIV1|MTMR2_CHICK Myotubularin-related protein 2 OS=Gallus gallus GN=MTMR2 PE=2 SV=1 80 606 2.0E-93
sp|Q6AXQ4|MTM1_RAT Myotubularin OS=Rattus norvegicus GN=Mtm1 PE=2 SV=2 82 645 6.0E-93
sp|Q5F452|MTMR8_CHICK Myotubularin-related protein 8 OS=Gallus gallus GN=MTMR8 PE=2 SV=1 17 606 1.0E-92
sp|Q5EB32|MTM1_XENTR Myotubularin OS=Xenopus tropicalis GN=mtm1 PE=2 SV=1 82 645 3.0E-92
sp|Q52KU6|MTM1_XENLA Myotubularin OS=Xenopus laevis GN=mtm1 PE=2 SV=1 82 645 8.0E-92
sp|Q8VE11|MTMR6_MOUSE Myotubularin-related protein 6 OS=Mus musculus GN=Mtmr6 PE=1 SV=1 82 608 3.0E-91
sp|A6QLT4|MTM1_BOVIN Myotubularin OS=Bos taurus GN=MTM1 PE=2 SV=2 82 645 1.0E-90
sp|Q9Y217|MTMR6_HUMAN Myotubularin-related protein 6 OS=Homo sapiens GN=MTMR6 PE=1 SV=3 82 608 2.0E-89
sp|Q96EF0|MTMR8_HUMAN Myotubularin-related protein 8 OS=Homo sapiens GN=MTMR8 PE=1 SV=1 20 455 7.0E-76
sp|A0JMK5|MTMR2_DANRE Myotubularin-related protein 2 OS=Danio rerio GN=mtmr2 PE=2 SV=2 84 458 4.0E-70
sp|Q9Z2C4|MTMR1_MOUSE Myotubularin-related protein 1 OS=Mus musculus GN=Mtmr1 PE=1 SV=1 80 458 2.0E-68
sp|Q13613|MTMR1_HUMAN Myotubularin-related protein 1 OS=Homo sapiens GN=MTMR1 PE=1 SV=4 80 455 2.0E-68
sp|Q6TEL0|MTMR8_DANRE Myotubularin-related protein 8 OS=Danio rerio GN=mtmr8 PE=2 SV=1 80 455 3.0E-68
sp|F4J3T8|MYTM1_ARATH Phosphatidylinositol-3-phosphatase myotubularin-1 OS=Arabidopsis thaliana GN=MTM1 PE=1 SV=1 155 594 3.0E-65
sp|Q8K296|MTMR3_MOUSE Myotubularin-related protein 3 OS=Mus musculus GN=Mtmr3 PE=1 SV=2 82 608 3.0E-60
sp|F4JWB3|MYTM2_ARATH Phosphatidylinositol-3-phosphatase myotubularin-2 OS=Arabidopsis thaliana GN=MTM2 PE=1 SV=1 155 455 7.0E-55
sp|Q9NYA4|MTMR4_HUMAN Myotubularin-related protein 4 OS=Homo sapiens GN=MTMR4 PE=1 SV=2 74 453 2.0E-51
sp|Q91XS1|MTMR4_MOUSE Myotubularin-related protein 4 OS=Mus musculus GN=Mtmr4 PE=1 SV=1 74 458 2.0E-51
sp|Q7ZXF1|MTMR4_XENLA Myotubularin-related protein 4 OS=Xenopus laevis GN=mtmr4 PE=2 SV=1 74 458 9.0E-50
sp|Q13615|MTMR3_HUMAN Myotubularin-related protein 3 OS=Homo sapiens GN=MTMR3 PE=1 SV=3 82 458 6.0E-48
sp|Q5PQT2|MTMR3_RAT Myotubularin-related protein 3 OS=Rattus norvegicus GN=Mtmr3 PE=1 SV=1 82 458 2.0E-47
sp|Q96QG7|MTMR9_HUMAN Myotubularin-related protein 9 OS=Homo sapiens GN=MTMR9 PE=1 SV=1 79 453 9.0E-43
sp|Q9Z2D0|MTMR9_MOUSE Myotubularin-related protein 9 OS=Mus musculus GN=Mtmr9 PE=1 SV=2 79 453 1.0E-42
sp|Q22712|MTMR3_CAEEL Myotubularin-related protein 3 OS=Caenorhabditis elegans GN=mtm-3 PE=1 SV=2 145 445 3.0E-38
sp|Q2KJ24|MTMR9_BOVIN Myotubularin-related protein 9 OS=Bos taurus GN=MTMR9 PE=2 SV=1 21 453 1.0E-35
sp|O95248|MTMR5_HUMAN Myotubularin-related protein 5 OS=Homo sapiens GN=SBF1 PE=1 SV=3 160 453 9.0E-22
sp|Q86WG5|MTMRD_HUMAN Myotubularin-related protein 13 OS=Homo sapiens GN=SBF2 PE=1 SV=1 160 450 1.0E-21
sp|Q96EF0|MTMR8_HUMAN Myotubularin-related protein 8 OS=Homo sapiens GN=MTMR8 PE=1 SV=1 524 661 1.0E-20
sp|Q54GQ1|MTMR_DICDI Myotubularin-related protein DDB_G0290005 OS=Dictyostelium discoideum GN=DDB_G0290005 PE=3 SV=2 338 453 5.0E-20
sp|Q54GQ1|MTMR_DICDI Myotubularin-related protein DDB_G0290005 OS=Dictyostelium discoideum GN=DDB_G0290005 PE=3 SV=2 73 240 6.0E-20
sp|A0JMK5|MTMR2_DANRE Myotubularin-related protein 2 OS=Danio rerio GN=mtmr2 PE=2 SV=2 527 630 4.0E-18
sp|Q9Z2C4|MTMR1_MOUSE Myotubularin-related protein 1 OS=Mus musculus GN=Mtmr1 PE=1 SV=1 527 604 2.0E-17
sp|Q13613|MTMR1_HUMAN Myotubularin-related protein 1 OS=Homo sapiens GN=MTMR1 PE=1 SV=4 527 646 3.0E-17
sp|Q6TEL0|MTMR8_DANRE Myotubularin-related protein 8 OS=Danio rerio GN=mtmr8 PE=2 SV=1 523 643 1.0E-16
sp|Q6NTN5|MTMRD_XENLA Myotubularin-related protein 13 OS=Xenopus laevis GN=sbf2 PE=2 SV=1 370 594 7.0E-16
sp|Q5PQT2|MTMR3_RAT Myotubularin-related protein 3 OS=Rattus norvegicus GN=Mtmr3 PE=1 SV=1 528 608 1.0E-15
sp|Q6ZPE2|MTMR5_MOUSE Myotubularin-related protein 5 OS=Mus musculus GN=Sbf1 PE=1 SV=2 370 453 2.0E-15
sp|Q13615|MTMR3_HUMAN Myotubularin-related protein 3 OS=Homo sapiens GN=MTMR3 PE=1 SV=3 528 608 2.0E-15
sp|Q96QG7|MTMR9_HUMAN Myotubularin-related protein 9 OS=Homo sapiens GN=MTMR9 PE=1 SV=1 521 608 5.0E-15
sp|Q9Z2D0|MTMR9_MOUSE Myotubularin-related protein 9 OS=Mus musculus GN=Mtmr9 PE=1 SV=2 520 608 1.0E-14
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 375 460 1.0E-14
sp|A2BGG1|MTMRC_DANRE Myotubularin-related protein 12 OS=Danio rerio GN=mtmr12 PE=3 SV=1 370 458 3.0E-14
sp|Q9NYA4|MTMR4_HUMAN Myotubularin-related protein 4 OS=Homo sapiens GN=MTMR4 PE=1 SV=2 528 611 7.0E-13
sp|Q91XS1|MTMR4_MOUSE Myotubularin-related protein 4 OS=Mus musculus GN=Mtmr4 PE=1 SV=1 528 713 1.0E-12
sp|Q7ZXF1|MTMR4_XENLA Myotubularin-related protein 4 OS=Xenopus laevis GN=mtmr4 PE=2 SV=1 528 606 7.0E-12
sp|Q9NXD2|MTMRA_HUMAN Myotubularin-related protein 10 OS=Homo sapiens GN=MTMR10 PE=1 SV=3 370 458 7.0E-12
sp|Q54GQ1|MTMR_DICDI Myotubularin-related protein DDB_G0290005 OS=Dictyostelium discoideum GN=DDB_G0290005 PE=3 SV=2 528 620 2.0E-11
sp|Q2KJ24|MTMR9_BOVIN Myotubularin-related protein 9 OS=Bos taurus GN=MTMR9 PE=2 SV=1 523 591 2.0E-10
sp|Q22712|MTMR3_CAEEL Myotubularin-related protein 3 OS=Caenorhabditis elegans GN=mtm-3 PE=1 SV=2 527 690 3.0E-10
sp|Q7TPM9|MTMRA_MOUSE Myotubularin-related protein 10 OS=Mus musculus GN=Mtmr10 PE=1 SV=2 370 458 7.0E-10
sp|Q5FVM6|MTMRC_RAT Myotubularin-related protein 12 OS=Rattus norvegicus GN=Mtmr12 PE=1 SV=2 369 458 1.0E-09
sp|Q5R989|MTMRC_PONAB Myotubularin-related protein 12 OS=Pongo abelii GN=MTMR12 PE=2 SV=1 334 458 2.0E-09
sp|A0JMF6|MTMRA_DANRE Myotubularin-related protein 10 OS=Danio rerio GN=mtmr10 PE=2 SV=1 370 458 2.0E-09
sp|Q9C0I1|MTMRC_HUMAN Myotubularin-related protein 12 OS=Homo sapiens GN=MTMR12 PE=1 SV=2 334 458 2.0E-09
sp|Q5U581|MTRAA_XENLA Myotubularin-related protein 10-A OS=Xenopus laevis GN=mtmr10-a PE=2 SV=1 370 458 3.0E-09
sp|Q6NU08|MTRAB_XENLA Myotubularin-related protein 10-B OS=Xenopus laevis GN=mtmr10-b PE=2 SV=1 370 458 4.0E-09
sp|Q80TA6|MTMRC_MOUSE Myotubularin-related protein 12 OS=Mus musculus GN=Mtmr12 PE=1 SV=2 369 458 5.0E-09
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 527 606 8.0E-09
sp|Q6XHA7|ROCO9_DICDI Probable serine/threonine-protein kinase roco9 OS=Dictyostelium discoideum GN=roco9 PE=3 SV=1 527 606 2.0E-08
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 79 222 6.0E-08
sp|Q7TPM9|MTMRA_MOUSE Myotubularin-related protein 10 OS=Mus musculus GN=Mtmr10 PE=1 SV=2 527 671 4.0E-07
sp|Q5FVM6|MTMRC_RAT Myotubularin-related protein 12 OS=Rattus norvegicus GN=Mtmr12 PE=1 SV=2 528 593 9.0E-07
sp|Q5U581|MTRAA_XENLA Myotubularin-related protein 10-A OS=Xenopus laevis GN=mtmr10-a PE=2 SV=1 527 606 1.0E-06
sp|Q9NXD2|MTMRA_HUMAN Myotubularin-related protein 10 OS=Homo sapiens GN=MTMR10 PE=1 SV=3 527 606 1.0E-06
sp|Q86WG5|MTMRD_HUMAN Myotubularin-related protein 13 OS=Homo sapiens GN=SBF2 PE=1 SV=1 527 580 1.0E-06
sp|Q80TA6|MTMRC_MOUSE Myotubularin-related protein 12 OS=Mus musculus GN=Mtmr12 PE=1 SV=2 528 593 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6927
MEARKVIHNVQGIYGGQTTNGILRLTDFHMVFCAPAAQANEDSSAPAAQCPPRERWLTFPMLCYCALRPTPSVSR
QAPSIRVRCRDFTFVMFIFVDNDVARDVFDFIKARTCRLGTVERLFAFSHKPLRKEQEVNGWEIYDPRAEFRRQG
ISEKLPDKGWRITSINKDYTFCDTYPAVLVVPSKISDNVLKYAREFRSRNRIPVLSYIHPINNCTITRSSQPLAG
ITRKTNVQDEKLVAASFSAWMPGSFEETQLDVSDGGTPVAELSETERYEDEILSRPTAMYDDRTGERIAYGRQQF
NMIVDARPTINAMVNQVQGMGSENMDKYPFARKSFLSIENIHVMRNSLNKVTEALKDADVSPLPPNQELLNQSGW
LRHIQNVLDGSAIIARQIGIKHSNVLIHCSDGWDRTSQLSALAQIMLDPYYRTLEGFVVLIEKDWLSFGHMFRLR
CGHLNHEDWFVVQRDAFAGSKVHPGDGDGRNDALQNVLSGAKRFFNQSKDDADPSAISEAASGKVVDDEATTPKM
VSPVFHQFLDCTYQLLRQNPKRFEFNERFLRRLLYHLYSCQYGTFLFNSEKQRVDAKAKERTSSVWDYFLCRKAD
FSNPEYDATIDDRTRGRERLLLPKLKEIRWWHQLFGRSDDEMNAQLNAAALAEVDRQATVLGLTPTSPSHTPRCT
SASPALPGYASSSSVLAAVETPHAALNVADSPTRRHHALSSMQDNFASLSVVGNKLSNLHGSHDAPTSSPHRNDE
ELQEMT*
Coding >OphauB2|6927
ATGGAGGCGAGAAAGGTCATTCATAATGTCCAAGGCATTTACGGAGGCCAGACTACCAATGGAATCCTGCGACTC
ACAGACTTTCACATGGTTTTTTGTGCCCCGGCAGCCCAGGCGAATGAGGATTCGTCTGCTCCAGCTGCGCAATGT
CCACCACGCGAGCGGTGGCTTACCTTTCCCATGCTCTGCTACTGCGCCCTACGGCCCACTCCCTCCGTCTCCCGC
CAGGCGCCGTCTATCCGAGTCCGTTGTCGGGACTTTACATTTGTCATGTTTATCTTTGTCGACAACGATGTGGCG
CGAGACGTCTTCGATTTCATAAAGGCACGGACTTGCAGGCTCGGCACTGTCGAACGGCTCTTTGCCTTTAGTCAT
AAACCCCTGAGGAAGGAACAAGAGGTGAATGGCTGGGAAATTTACGACCCCAGGGCAGAGTTCAGGAGGCAAGGC
ATCAGCGAAAAACTGCCGGACAAAGGATGGAGGATAACAAGCATCAACAAGGATTATACCTTCTGCGATACCTAT
CCTGCCGTCTTGGTAGTCCCTTCCAAGATTTCGGACAATGTCCTCAAGTATGCCAGAGAGTTTCGCTCCCGAAAT
CGAATCCCCGTACTATCATATATCCACCCAATCAACAACTGCACCATTACAAGGAGCTCTCAACCGCTGGCTGGC
ATTACTCGCAAAACAAACGTCCAGGACGAGAAGCTGGTGGCAGCCTCTTTCTCGGCATGGATGCCCGGTAGCTTT
GAGGAGACGCAGCTTGATGTTTCTGACGGCGGCACACCAGTTGCAGAGCTGTCCGAGACGGAGCGCTACGAAGAC
GAGATTTTATCACGCCCAACGGCCATGTATGACGACAGAACTGGTGAGCGAATCGCATATGGGCGCCAACAGTTT
AACATGATTGTTGATGCTCGGCCAACCATCAACGCCATGGTCAATCAGGTCCAAGGCATGGGGTCCGAGAATATG
GATAAATATCCGTTTGCTAGGAAGTCTTTTCTGAGCATTGAAAATATTCACGTGATGCGCAACTCTCTCAACAAG
GTCACTGAGGCTCTCAAGGATGCTGATGTCTCTCCTCTGCCTCCAAACCAGGAACTCCTTAACCAGAGTGGCTGG
CTGCGTCACATTCAAAATGTCCTGGATGGCTCGGCCATTATAGCTCGCCAGATTGGAATCAAGCACTCGAATGTT
CTCATTCATTGCTCAGACGGCTGGGACCGCACCAGTCAGCTAAGCGCCTTGGCTCAGATTATGCTCGATCCCTAT
TACCGTACCCTTGAGGGATTCGTTGTGCTTATTGAAAAGGACTGGTTATCGTTTGGTCACATGTTTCGGCTTCGC
TGTGGGCACCTCAACCATGAAGATTGGTTCGTGGTGCAGAGGGATGCCTTTGCCGGATCCAAGGTGCATCCTGGA
GATGGTGACGGGCGAAATGATGCGCTTCAGAATGTCCTGAGCGGTGCCAAACGCTTCTTCAACCAGAGCAAGGAT
GACGCGGATCCCTCTGCCATTAGTGAGGCAGCATCCGGAAAGGTTGTGGACGACGAGGCCACTACGCCCAAAATG
GTCAGTCCTGTATTTCACCAATTCCTCGACTGCACCTATCAGCTTCTGCGCCAGAACCCGAAGCGCTTCGAGTTC
AATGAGCGCTTCTTGCGCCGACTCTTGTATCATTTGTACTCTTGCCAATATGGAACTTTTTTGTTCAACTCGGAG
AAGCAAAGGGTAGACGCCAAGGCAAAAGAAAGAACGTCGTCGGTCTGGGACTATTTTCTCTGCCGCAAGGCCGAC
TTTAGCAATCCCGAATACGATGCCACCATTGATGATCGAACAAGAGGCCGTGAGCGTTTGCTGCTCCCCAAACTC
AAGGAGATTAGATGGTGGCATCAGCTGTTTGGCAGAAGCGACGACGAGATGAATGCGCAGCTCAATGCAGCAGCC
CTGGCCGAAGTTGATCGCCAGGCAACAGTCTTGGGCCTGACCCCAACTAGCCCAAGCCACACGCCAAGATGCACG
TCTGCATCTCCAGCGCTTCCGGGATATGCTTCCAGCTCTTCAGTTCTTGCTGCCGTTGAGACGCCCCATGCGGCC
TTGAATGTGGCTGATTCGCCGACTCGCCGACACCACGCCCTTTCCAGTATGCAGGACAACTTTGCATCGTTGAGC
GTCGTAGGGAACAAGCTCTCCAATCTGCATGGCAGCCATGATGCTCCAACAAGCTCGCCCCATCGCAATGACGAG
GAGCTGCAAGAAATGACATAG
Transcript >OphauB2|6927
ATGGAGGCGAGAAAGGTCATTCATAATGTCCAAGGCATTTACGGAGGCCAGACTACCAATGGAATCCTGCGACTC
ACAGACTTTCACATGGTTTTTTGTGCCCCGGCAGCCCAGGCGAATGAGGATTCGTCTGCTCCAGCTGCGCAATGT
CCACCACGCGAGCGGTGGCTTACCTTTCCCATGCTCTGCTACTGCGCCCTACGGCCCACTCCCTCCGTCTCCCGC
CAGGCGCCGTCTATCCGAGTCCGTTGTCGGGACTTTACATTTGTCATGTTTATCTTTGTCGACAACGATGTGGCG
CGAGACGTCTTCGATTTCATAAAGGCACGGACTTGCAGGCTCGGCACTGTCGAACGGCTCTTTGCCTTTAGTCAT
AAACCCCTGAGGAAGGAACAAGAGGTGAATGGCTGGGAAATTTACGACCCCAGGGCAGAGTTCAGGAGGCAAGGC
ATCAGCGAAAAACTGCCGGACAAAGGATGGAGGATAACAAGCATCAACAAGGATTATACCTTCTGCGATACCTAT
CCTGCCGTCTTGGTAGTCCCTTCCAAGATTTCGGACAATGTCCTCAAGTATGCCAGAGAGTTTCGCTCCCGAAAT
CGAATCCCCGTACTATCATATATCCACCCAATCAACAACTGCACCATTACAAGGAGCTCTCAACCGCTGGCTGGC
ATTACTCGCAAAACAAACGTCCAGGACGAGAAGCTGGTGGCAGCCTCTTTCTCGGCATGGATGCCCGGTAGCTTT
GAGGAGACGCAGCTTGATGTTTCTGACGGCGGCACACCAGTTGCAGAGCTGTCCGAGACGGAGCGCTACGAAGAC
GAGATTTTATCACGCCCAACGGCCATGTATGACGACAGAACTGGTGAGCGAATCGCATATGGGCGCCAACAGTTT
AACATGATTGTTGATGCTCGGCCAACCATCAACGCCATGGTCAATCAGGTCCAAGGCATGGGGTCCGAGAATATG
GATAAATATCCGTTTGCTAGGAAGTCTTTTCTGAGCATTGAAAATATTCACGTGATGCGCAACTCTCTCAACAAG
GTCACTGAGGCTCTCAAGGATGCTGATGTCTCTCCTCTGCCTCCAAACCAGGAACTCCTTAACCAGAGTGGCTGG
CTGCGTCACATTCAAAATGTCCTGGATGGCTCGGCCATTATAGCTCGCCAGATTGGAATCAAGCACTCGAATGTT
CTCATTCATTGCTCAGACGGCTGGGACCGCACCAGTCAGCTAAGCGCCTTGGCTCAGATTATGCTCGATCCCTAT
TACCGTACCCTTGAGGGATTCGTTGTGCTTATTGAAAAGGACTGGTTATCGTTTGGTCACATGTTTCGGCTTCGC
TGTGGGCACCTCAACCATGAAGATTGGTTCGTGGTGCAGAGGGATGCCTTTGCCGGATCCAAGGTGCATCCTGGA
GATGGTGACGGGCGAAATGATGCGCTTCAGAATGTCCTGAGCGGTGCCAAACGCTTCTTCAACCAGAGCAAGGAT
GACGCGGATCCCTCTGCCATTAGTGAGGCAGCATCCGGAAAGGTTGTGGACGACGAGGCCACTACGCCCAAAATG
GTCAGTCCTGTATTTCACCAATTCCTCGACTGCACCTATCAGCTTCTGCGCCAGAACCCGAAGCGCTTCGAGTTC
AATGAGCGCTTCTTGCGCCGACTCTTGTATCATTTGTACTCTTGCCAATATGGAACTTTTTTGTTCAACTCGGAG
AAGCAAAGGGTAGACGCCAAGGCAAAAGAAAGAACGTCGTCGGTCTGGGACTATTTTCTCTGCCGCAAGGCCGAC
TTTAGCAATCCCGAATACGATGCCACCATTGATGATCGAACAAGAGGCCGTGAGCGTTTGCTGCTCCCCAAACTC
AAGGAGATTAGATGGTGGCATCAGCTGTTTGGCAGAAGCGACGACGAGATGAATGCGCAGCTCAATGCAGCAGCC
CTGGCCGAAGTTGATCGCCAGGCAACAGTCTTGGGCCTGACCCCAACTAGCCCAAGCCACACGCCAAGATGCACG
TCTGCATCTCCAGCGCTTCCGGGATATGCTTCCAGCTCTTCAGTTCTTGCTGCCGTTGAGACGCCCCATGCGGCC
TTGAATGTGGCTGATTCGCCGACTCGCCGACACCACGCCCTTTCCAGTATGCAGGACAACTTTGCATCGTTGAGC
GTCGTAGGGAACAAGCTCTCCAATCTGCATGGCAGCCATGATGCTCCAACAAGCTCGCCCCATCGCAATGACGAG
GAGCTGCAAGAAATGACATAG
Gene >OphauB2|6927
ATGGAGGCGAGAAAGGTTCGTGTTTTGCAGCTCTATATCTGTTTGTTACTGGCATTGCGAGCAGCATCCTGACCG
TGGTCAGGTCATTCATAATGTCCAAGGCATTTACGGAGGCCAGACTACCAATGGAATCCTGCGACTCACAGACTT
TCACATGGTTTTTTGTGCCCCGGCAGCCCAGGCGAATGAGGATTCGTCTGCTCCAGCTGCGCAATGTCCACCACG
CGAGCGGTGGCTTACCTTTCCCATGCTCTGCTACTGCGCCCTACGGCCCACTCCCTCCGTCTCCCGCCAGGCGCC
GTCTATCCGAGTCCGTTGTCGGGACTTTACATTTGTCATGTTTATCTTTGTCGACAACGATGTGGCGCGAGACGT
CTTCGATTTCATAAAGGCACGGACTTGCAGGCTCGGCACTGTCGAACGGCTCTTTGCCTTTAGTCATAAACCCCT
GAGGAAGGAACAAGAGGTGAATGGCTGGGAAATTTACGACCCCAGGGCAGAGTTCAGGAGGCAAGGCATCAGCGA
AAAACTGCCGGACAAAGGATGGAGGATAACAAGCATCAACAAGGATTATACCTTCTGCGATACCTATCCTGCCGT
CTTGGTAGTCCCTTCCAAGATTTCGGACAATGTCCTCAAGTATGCCAGAGAGTTTCGCTCCCGAAATCGAATCCC
CGTACTATCATATATCCACCCAATCAACAACTGCACCATTACAAGGAGCTCTCAACCGCTGGCTGGCATTACTCG
CAAAACAAACGTCCAGGACGAGAAGCTGGTGGCAGCCTCTTTCTCGGCATGGATGCCCGGTAGCTTTGAGGAGAC
GCAGCTTGATGTTTCTGACGGCGGCACACCAGTTGCAGAGCTGTCCGAGACGGAGCGCTACGAAGACGAGATTTT
ATCACGCCCAACGGCCATGTATGACGACAGAACTGGTGAGCGAATCGCATATGGGCGCCAACAGTTTAACATGAT
TGTTGATGCTCGGCCAACCATCAACGCCATGGTCAATCAGGTCCAAGGCATGGGGTCCGAGAATATGGATAAATA
TCCGTTTGCTAGGAAGTCTTTTCTGAGCATTGAAAATATTCACGTGATGCGCAACTCTCTCAACAAGGTCACTGA
GGCTCTCAAGGATGCTGATGTCTCTCCTCTGCCTCCAAACCAGGAACTCCTTAACCAGAGTGGCTGGCTGCGTCA
CATTCAAAATGTCCTGGATGGCTCGGCCATTATAGCTCGCCAGATTGGAATCAAGCACTCGAATGTTCTCATTCA
TTGCTCAGACGGCTGGGACCGCACCAGTCAGCTAAGCGCCTTGGCTCAGATTATGCTCGATCCCTATTACCGTAC
CCTTGAGGGATTCGTTGTGCTTATTGAAAAGGACTGGTTATCGTTTGGTCACATGTTTCGGCTTCGCTGTGGGCA
CCTCAACCATGAAGATTGGTTCGTGGTGCAGAGGGATGCCTTTGCCGGATCCAAGGTGCATCCTGGAGATGGTGA
CGGGCGAAATGATGCGCTTCAGAATGTCCTGAGCGGTGCCAAACGCTTCTTCAACCAGAGCAAGGATGACGCGGA
TCCCTCTGCCATTAGTGAGGCAGCATCCGGAAAGGTTGTGGACGACGAGGCCACTACGCCCAAAATGGTCAGTCC
TGTATTTCACCAATTCCTCGACTGCACCTATCAGCTTCTGCGCCAGAACCCGAAGCGCTTCGAGTTCAATGAGCG
CTTCTTGCGCCGACTCTTGTATCATTTGTACTCTTGCCAATATGGAACTTTTTTGTTCAACTCGGAGAAGCAAAG
GGTAGACGCCAAGGCAAAAGAAAGAACGTCGTCGGTCTGGGACTATTTTCTCTGCCGCAAGGCCGACTTTAGCAA
TCCCGAATACGATGCCACCATTGATGATCGAACAAGAGGCCGTGAGCGTTTGCTGCTCCCCAAACTCAAGGAGAT
TAGATGGTGGCATCAGCTGTTTGGCAGAAGCGACGACGAGATGAATGCGCAGCTCAATGCAGCAGCCCTGGCCGA
AGTTGATCGCCAGGCAACAGTCTTGGGCCTGACCCCAACTAGCCCAAGCCACACGCCAAGATGCACGTCTGCATC
TCCAGCGCTTCCGGGATATGCTTCCAGCTCTTCAGTTCTTGCTGCCGTTGAGACGCCCCATGCGGCCTTGAATGT
GGCTGATTCGCCGACTCGCCGACACCACGCCCTTTCCAGTATGCAGGACAACTTTGCATCGTTGAGCGTCGTAGG
GAACAAGCTCTCCAATCTGCATGGCAGCCATGATGCTCCAACAAGCTCGCCCCATCGCAATGACGAGGAGCTGCA
AGAAATGACATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail