Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6926
Gene name
LocationContig_69:44608..46601
Strand+
Gene length (bp)1993
Transcript length (bp)1833
Coding sequence length (bp)1833
Protein length (aa) 611

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17759 tRNA_synthFbeta Phenylalanyl tRNA synthetase beta chain CLM domain 4.9E-50 373 606
PF18262 PhetRS_B1 Phe-tRNA synthetase beta subunit B1 domain 1.2E-30 1 83
PF03483 B3_4 B3/4 domain 1.3E-25 112 272
PF03484 B5 tRNA synthetase B5 domain 2.3E-14 305 370

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13432|SYFB_CANAX Phenylalanine--tRNA ligase beta subunit OS=Candida albicans GN=FRS1 PE=2 SV=3 1 610 0.0E+00
sp|O42849|SYFB_SCHPO Phenylalanine--tRNA ligase beta subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=frs1 PE=3 SV=1 1 610 0.0E+00
sp|P15624|SYFB_YEAST Phenylalanine--tRNA ligase beta subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRS1 PE=1 SV=3 1 610 0.0E+00
sp|Q9WUA2|SYFB_MOUSE Phenylalanine--tRNA ligase beta subunit OS=Mus musculus GN=Farsb PE=1 SV=2 1 610 0.0E+00
sp|Q9VCA5|SYFB_DROME Phenylalanine--tRNA ligase beta subunit OS=Drosophila melanogaster GN=beta-PheRS PE=1 SV=1 1 610 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13432|SYFB_CANAX Phenylalanine--tRNA ligase beta subunit OS=Candida albicans GN=FRS1 PE=2 SV=3 1 610 0.0E+00
sp|O42849|SYFB_SCHPO Phenylalanine--tRNA ligase beta subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=frs1 PE=3 SV=1 1 610 0.0E+00
sp|P15624|SYFB_YEAST Phenylalanine--tRNA ligase beta subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRS1 PE=1 SV=3 1 610 0.0E+00
sp|Q9WUA2|SYFB_MOUSE Phenylalanine--tRNA ligase beta subunit OS=Mus musculus GN=Farsb PE=1 SV=2 1 610 0.0E+00
sp|Q9VCA5|SYFB_DROME Phenylalanine--tRNA ligase beta subunit OS=Drosophila melanogaster GN=beta-PheRS PE=1 SV=1 1 610 0.0E+00
sp|Q9NSD9|SYFB_HUMAN Phenylalanine--tRNA ligase beta subunit OS=Homo sapiens GN=FARSB PE=1 SV=3 1 610 0.0E+00
sp|Q5R7F7|SYFB_PONAB Phenylalanine--tRNA ligase beta subunit OS=Pongo abelii GN=FARSB PE=2 SV=1 1 610 0.0E+00
sp|Q9SGE9|SYFB_ARATH Phenylalanine--tRNA ligase beta subunit, cytoplasmic OS=Arabidopsis thaliana GN=At1g72550 PE=2 SV=1 1 610 0.0E+00
sp|Q19713|SYFB_CAEEL Phenylalanine--tRNA ligase beta subunit OS=Caenorhabditis elegans GN=frs-2 PE=3 SV=2 1 610 0.0E+00
sp|Q550D2|SYFB_DICDI Phenylalanine--tRNA ligase beta subunit OS=Dictyostelium discoideum GN=phesB PE=3 SV=2 1 608 1.0E-175
sp|Q8SS40|SYFB_ENCCU Probable phenylalanine--tRNA ligase beta subunit OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU04_0900 PE=3 SV=1 1 610 2.0E-103
sp|C4VA52|SYFB_NOSCE Probable phenylalanine--tRNA ligase beta subunit OS=Nosema ceranae (strain BRL01) GN=NCER_101490 PE=3 SV=1 1 516 1.0E-101
sp|A9CS50|SYFB_ENTBH Probable phenylalanine--tRNA ligase beta subunit OS=Enterocytozoon bieneusi (strain H348) GN=EBI_21956 PE=3 SV=1 1 607 5.0E-83
sp|A6UWT1|SYFB_META3 Phenylalanine--tRNA ligase beta subunit OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=pheT PE=3 SV=1 1 607 3.0E-75
sp|A0B993|SYFB_METTP Phenylalanine--tRNA ligase beta subunit OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=pheT PE=3 SV=1 56 608 1.0E-70
sp|Q0W0X4|SYFB_METAR Phenylalanine--tRNA ligase beta subunit OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=pheT PE=3 SV=1 1 606 1.0E-69
sp|O26864|SYFB_METTH Phenylalanine--tRNA ligase beta subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pheT PE=1 SV=2 1 607 8.0E-69
sp|Q58508|SYFB_METJA Phenylalanine--tRNA ligase beta subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pheT PE=3 SV=1 1 607 1.0E-68
sp|Q12YP2|SYFB_METBU Phenylalanine--tRNA ligase beta subunit OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=pheT PE=3 SV=1 36 606 1.0E-67
sp|B1L7C0|SYFB_KORCO Phenylalanine--tRNA ligase beta subunit OS=Korarchaeum cryptofilum (strain OPF8) GN=pheT PE=3 SV=1 18 608 2.0E-67
sp|A2ST82|SYFB_METLZ Phenylalanine--tRNA ligase beta subunit OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=pheT PE=3 SV=1 51 610 2.0E-67
sp|Q2NGX9|SYFB_METST Phenylalanine--tRNA ligase beta subunit OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=pheT PE=3 SV=1 1 606 2.0E-67
sp|C6A237|SYFB_THESM Phenylalanine--tRNA ligase beta subunit OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=pheT PE=3 SV=1 1 609 6.0E-66
sp|O73984|SYFB_PYRHO Phenylalanine--tRNA ligase beta subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pheT PE=1 SV=1 1 606 1.0E-65
sp|Q8U260|SYFB_PYRFU Phenylalanine--tRNA ligase beta subunit OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pheT PE=3 SV=1 1 607 1.0E-64
sp|Q6LXU2|SYFB_METMP Phenylalanine--tRNA ligase beta subunit OS=Methanococcus maripaludis (strain S2 / LL) GN=pheT PE=3 SV=1 1 607 5.0E-64
sp|A9AA58|SYFB_METM6 Phenylalanine--tRNA ligase beta subunit OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=pheT PE=3 SV=1 1 607 2.0E-63
sp|A7I615|SYFB_METB6 Phenylalanine--tRNA ligase beta subunit OS=Methanoregula boonei (strain 6A8) GN=pheT PE=3 SV=1 58 606 4.0E-63
sp|B6YTJ3|SYFB_THEON Phenylalanine--tRNA ligase beta subunit OS=Thermococcus onnurineus (strain NA1) GN=pheT PE=3 SV=1 1 606 3.0E-62
sp|A6VGJ4|SYFB_METM7 Phenylalanine--tRNA ligase beta subunit OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pheT PE=3 SV=1 56 607 3.0E-62
sp|C5A5Z0|SYFB_THEGJ Phenylalanine--tRNA ligase beta subunit OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pheT PE=3 SV=1 1 606 7.0E-62
sp|A4FWS3|SYFB_METM5 Phenylalanine--tRNA ligase beta subunit OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pheT PE=3 SV=1 1 607 1.0E-61
sp|Q2FLL1|SYFB_METHJ Phenylalanine--tRNA ligase beta subunit OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pheT PE=3 SV=1 24 610 2.0E-61
sp|Q468N7|SYFB_METBF Phenylalanine--tRNA ligase beta subunit OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=pheT PE=3 SV=1 52 606 3.0E-61
sp|A6UPQ4|SYFB_METVS Phenylalanine--tRNA ligase beta subunit OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pheT PE=3 SV=1 1 607 6.0E-61
sp|B8GEX4|SYFB_METPE Phenylalanine--tRNA ligase beta subunit OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=pheT PE=3 SV=1 58 606 7.0E-61
sp|O28848|SYFB_ARCFU Phenylalanine--tRNA ligase beta subunit OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pheT PE=3 SV=1 52 610 2.0E-60
sp|Q8TPF7|SYFB_METAC Phenylalanine--tRNA ligase beta subunit OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pheT PE=3 SV=1 58 606 5.0E-59
sp|Q76KA7|SYFB_THEKO Phenylalanine--tRNA ligase beta subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pheT PE=1 SV=1 1 606 9.0E-59
sp|Q971D8|SYFB_SULTO Phenylalanine--tRNA ligase beta subunit OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=pheT PE=3 SV=1 1 607 2.0E-58
sp|Q8PTA5|SYFB_METMA Phenylalanine--tRNA ligase beta subunit OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pheT PE=3 SV=1 58 606 4.0E-58
sp|B9LU47|SYFB_HALLT Phenylalanine--tRNA ligase beta subunit OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=pheT PE=3 SV=1 1 609 5.0E-58
sp|Q9UYX2|SYFB_PYRAB Phenylalanine--tRNA ligase beta subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pheT PE=3 SV=1 1 606 1.0E-57
sp|A3CT77|SYFB_METMJ Phenylalanine--tRNA ligase beta subunit OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pheT PE=3 SV=1 56 606 2.0E-57
sp|C3N028|SYFB_SULIA Phenylalanine--tRNA ligase beta subunit OS=Sulfolobus islandicus (strain M.16.27) GN=pheT PE=3 SV=1 1 604 4.0E-57
sp|C3MJ88|SYFB_SULIL Phenylalanine--tRNA ligase beta subunit OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=pheT PE=3 SV=1 1 604 1.0E-56
sp|C3MYY0|SYFB_SULIM Phenylalanine--tRNA ligase beta subunit OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=pheT PE=3 SV=1 1 604 1.0E-56
sp|C4KJ68|SYFB_SULIK Phenylalanine--tRNA ligase beta subunit OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=pheT PE=3 SV=1 1 604 1.0E-56
sp|C3N8B1|SYFB_SULIY Phenylalanine--tRNA ligase beta subunit OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=pheT PE=3 SV=1 1 604 2.0E-56
sp|C3NMS5|SYFB_SULIN Phenylalanine--tRNA ligase beta subunit OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=pheT PE=3 SV=1 1 604 2.0E-56
sp|Q4J8Q0|SYFB_SULAC Phenylalanine--tRNA ligase beta subunit OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=pheT PE=3 SV=1 1 607 4.0E-56
sp|Q8TX56|SYFB_METKA Phenylalanine--tRNA ligase beta subunit OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pheT PE=3 SV=1 1 606 1.0E-54
sp|Q9HMK3|SYFB_HALSA Phenylalanine--tRNA ligase beta subunit OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pheT PE=3 SV=1 1 609 4.0E-54
sp|B0R807|SYFB_HALS3 Phenylalanine--tRNA ligase beta subunit OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=pheT PE=3 SV=1 1 609 4.0E-54
sp|P95960|SYFB_SULSO Phenylalanine--tRNA ligase beta subunit OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pheT PE=3 SV=1 1 604 4.0E-54
sp|Q5UYF3|SYFB_HALMA Phenylalanine--tRNA ligase beta subunit OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=pheT PE=3 SV=1 1 609 4.0E-53
sp|Q3ITU5|SYFB_NATPD Phenylalanine--tRNA ligase beta subunit OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=pheT PE=3 SV=1 1 609 8.0E-52
sp|A4YIL0|SYFB_METS5 Phenylalanine--tRNA ligase beta subunit OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=pheT PE=3 SV=1 1 599 4.0E-49
sp|Q0SMZ4|SYFB_BORAP Phenylalanine--tRNA ligase beta subunit OS=Borrelia afzelii (strain PKo) GN=pheT PE=3 SV=1 1 606 2.0E-44
sp|A1RYS1|SYFB_THEPD Phenylalanine--tRNA ligase beta subunit OS=Thermofilum pendens (strain Hrk 5) GN=pheT PE=3 SV=1 112 610 3.0E-43
sp|Q661A7|SYFB_BORBP Phenylalanine--tRNA ligase beta subunit OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=pheT PE=3 SV=1 1 606 5.0E-41
sp|Q9Y9I3|SYFB_AERPE Phenylalanine--tRNA ligase beta subunit OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pheT PE=3 SV=1 1 609 1.0E-40
sp|B5RPL7|SYFB_BORRA Phenylalanine--tRNA ligase beta subunit OS=Borrelia recurrentis (strain A1) GN=pheT PE=3 SV=1 1 610 1.0E-40
sp|B7J278|SYFB_BORBZ Phenylalanine--tRNA ligase beta subunit OS=Borrelia burgdorferi (strain ZS7) GN=pheT PE=3 SV=1 1 606 2.0E-40
sp|P94283|SYFB_BORBU Phenylalanine--tRNA ligase beta subunit OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=pheT PE=3 SV=1 1 606 2.0E-40
sp|Q97B53|SYFB_THEVO Phenylalanine--tRNA ligase beta subunit OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=pheT PE=3 SV=1 25 607 3.0E-39
sp|B5RM71|SYFB_BORDL Phenylalanine--tRNA ligase beta subunit OS=Borrelia duttonii (strain Ly) GN=pheT PE=3 SV=1 1 610 3.0E-39
sp|A1QZU9|SYFB_BORT9 Phenylalanine--tRNA ligase beta subunit OS=Borrelia turicatae (strain 91E135) GN=pheT PE=3 SV=1 1 610 9.0E-39
sp|B2S0L6|SYFB_BORHD Phenylalanine--tRNA ligase beta subunit OS=Borrelia hermsii (strain HS1 / DAH) GN=pheT PE=3 SV=1 1 610 4.0E-38
sp|B2S1W3|SYFB_TREPS Phenylalanine--tRNA ligase beta subunit OS=Treponema pallidum subsp. pallidum (strain SS14) GN=pheT PE=3 SV=1 1 610 1.0E-35
sp|O83059|SYFB_TREPA Phenylalanine--tRNA ligase beta subunit OS=Treponema pallidum (strain Nichols) GN=pheT PE=3 SV=1 1 610 1.0E-35
sp|P57694|SYFB_THEAC Phenylalanine--tRNA ligase beta subunit OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=pheT PE=3 SV=1 21 610 1.0E-33
sp|Q8ZWQ7|SYFB_PYRAE Phenylalanine--tRNA ligase beta subunit OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=pheT PE=3 SV=1 1 560 7.0E-29
sp|Q505F5|LRC47_MOUSE Leucine-rich repeat-containing protein 47 OS=Mus musculus GN=Lrrc47 PE=1 SV=1 98 268 8.0E-24
sp|Q8N1G4|LRC47_HUMAN Leucine-rich repeat-containing protein 47 OS=Homo sapiens GN=LRRC47 PE=1 SV=1 101 268 2.0E-23
sp|Q39VS4|SYFB_GEOMG Phenylalanine--tRNA ligase beta subunit OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=pheT PE=3 SV=1 217 607 1.0E-15
sp|Q8RHB5|SYFB_FUSNN Phenylalanine--tRNA ligase beta subunit OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=pheT PE=3 SV=1 27 596 2.0E-15
sp|Q5KWE5|SYFB_GEOKA Phenylalanine--tRNA ligase beta subunit OS=Geobacillus kaustophilus (strain HTA426) GN=pheT PE=3 SV=1 56 596 3.0E-15
sp|Q6G5I2|SYFB_BARHE Phenylalanine--tRNA ligase beta subunit OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=pheT PE=3 SV=1 300 607 1.0E-14
sp|Q2JXF6|SYFB_SYNJA Phenylalanine--tRNA ligase beta subunit OS=Synechococcus sp. (strain JA-3-3Ab) GN=pheT PE=3 SV=1 225 610 1.0E-14
sp|Q97GL0|SYFB_CLOAB Phenylalanine--tRNA ligase beta subunit OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=pheT PE=3 SV=1 35 610 5.0E-14
sp|Q6G0Y3|SYFB_BARQU Phenylalanine--tRNA ligase beta subunit OS=Bartonella quintana (strain Toulouse) GN=pheT PE=3 SV=1 300 607 9.0E-14
sp|Q6HCW8|SYFB_BACHK Phenylalanine--tRNA ligase beta subunit OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=pheT PE=3 SV=1 56 596 2.0E-13
sp|Q81L31|SYFB_BACAN Phenylalanine--tRNA ligase beta subunit OS=Bacillus anthracis GN=pheT PE=3 SV=1 56 596 2.0E-13
sp|Q5GXY5|SYFB_XANOR Phenylalanine--tRNA ligase beta subunit OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=pheT PE=3 SV=1 27 500 4.0E-13
sp|Q2P100|SYFB_XANOM Phenylalanine--tRNA ligase beta subunit OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=pheT PE=3 SV=1 27 500 4.0E-13
sp|Q633N5|SYFB_BACCZ Phenylalanine--tRNA ligase beta subunit OS=Bacillus cereus (strain ZK / E33L) GN=pheT PE=3 SV=1 56 596 5.0E-13
sp|Q8Y7Q1|SYFB_LISMO Phenylalanine--tRNA ligase beta subunit OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pheT PE=3 SV=1 56 610 5.0E-13
sp|Q72ZI2|SYFB_BACC1 Phenylalanine--tRNA ligase beta subunit OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=pheT PE=3 SV=1 56 596 5.0E-13
sp|Q5GSH5|SYFB_WOLTR Phenylalanine--tRNA ligase beta subunit OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=pheT PE=3 SV=1 54 607 6.0E-13
sp|Q6GHU6|SYFB_STAAR Phenylalanine--tRNA ligase beta subunit OS=Staphylococcus aureus (strain MRSA252) GN=pheT PE=3 SV=1 225 610 7.0E-13
sp|Q2YX86|SYFB_STAAB Phenylalanine--tRNA ligase beta subunit OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=pheT PE=3 SV=1 225 610 9.0E-13
sp|Q817I7|SYFB_BACCR Phenylalanine--tRNA ligase beta subunit OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=pheT PE=3 SV=1 56 596 1.0E-12
sp|Q8CSY8|SYFB_STAES Phenylalanine--tRNA ligase beta subunit OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pheT PE=3 SV=1 225 596 1.0E-12
sp|Q8NX60|SYFB_STAAW Phenylalanine--tRNA ligase beta subunit OS=Staphylococcus aureus (strain MW2) GN=pheT PE=3 SV=1 225 610 1.0E-12
sp|Q6GA75|SYFB_STAAS Phenylalanine--tRNA ligase beta subunit OS=Staphylococcus aureus (strain MSSA476) GN=pheT PE=3 SV=1 225 610 1.0E-12
sp|P67041|SYFB_STAAN Phenylalanine--tRNA ligase beta subunit OS=Staphylococcus aureus (strain N315) GN=pheT PE=1 SV=1 225 610 1.0E-12
sp|P67040|SYFB_STAAM Phenylalanine--tRNA ligase beta subunit OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pheT PE=3 SV=1 225 610 1.0E-12
sp|Q720K7|SYFB_LISMF Phenylalanine--tRNA ligase beta subunit OS=Listeria monocytogenes serotype 4b (strain F2365) GN=pheT PE=3 SV=1 56 610 1.0E-12
sp|Q9AGR3|SYFB_STAAU Phenylalanine--tRNA ligase beta subunit OS=Staphylococcus aureus GN=pheT PE=3 SV=1 225 610 2.0E-12
sp|P17922|SYFB_BACSU Phenylalanine--tRNA ligase beta subunit OS=Bacillus subtilis (strain 168) GN=pheT PE=3 SV=2 303 527 2.0E-12
sp|Q73HW5|SYFB_WOLPM Phenylalanine--tRNA ligase beta subunit OS=Wolbachia pipientis wMel GN=pheT PE=3 SV=1 236 607 2.0E-12
sp|Q5M3S7|SYFB_STRT2 Phenylalanine--tRNA ligase beta subunit OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=pheT PE=3 SV=2 56 595 2.0E-12
sp|Q5LZ72|SYFB_STRT1 Phenylalanine--tRNA ligase beta subunit OS=Streptococcus thermophilus (strain CNRZ 1066) GN=pheT PE=3 SV=2 56 595 2.0E-12
sp|Q3BRU2|SYFB_XANC5 Phenylalanine--tRNA ligase beta subunit OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=pheT PE=3 SV=1 27 500 3.0E-12
sp|Q5HQ35|SYFB_STAEQ Phenylalanine--tRNA ligase beta subunit OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pheT PE=3 SV=1 225 596 4.0E-12
sp|Q83C15|SYFB_COXBU Phenylalanine--tRNA ligase beta subunit OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=pheT PE=3 SV=1 314 595 4.0E-12
sp|Q3K1I7|SYFB_STRA1 Phenylalanine--tRNA ligase beta subunit OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=pheT PE=3 SV=1 56 477 5.0E-12
sp|Q8E5U1|SYFB_STRA3 Phenylalanine--tRNA ligase beta subunit OS=Streptococcus agalactiae serotype III (strain NEM316) GN=pheT PE=3 SV=1 56 477 6.0E-12
sp|Q8E064|SYFB_STRA5 Phenylalanine--tRNA ligase beta subunit OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=pheT PE=3 SV=1 56 477 6.0E-12
sp|Q5HGU5|SYFB_STAAC Phenylalanine--tRNA ligase beta subunit OS=Staphylococcus aureus (strain COL) GN=pheT PE=3 SV=1 225 610 7.0E-12
sp|Q74CZ9|SYFB_GEOSL Phenylalanine--tRNA ligase beta subunit OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=pheT PE=3 SV=1 294 607 9.0E-12
sp|Q6MEA6|SYFB_PARUW Phenylalanine--tRNA ligase beta subunit OS=Protochlamydia amoebophila (strain UWE25) GN=pheT PE=3 SV=2 207 606 1.0E-11
sp|Q5WEJ6|SYFB_BACSK Phenylalanine--tRNA ligase beta subunit OS=Bacillus clausii (strain KSM-K16) GN=pheT PE=3 SV=1 56 610 1.0E-11
sp|Q5NMC3|SYFB_ZYMMO Phenylalanine--tRNA ligase beta subunit OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=pheT PE=3 SV=1 212 609 1.0E-11
sp|Q891T8|SYFB_CLOTE Phenylalanine--tRNA ligase beta subunit OS=Clostridium tetani (strain Massachusetts / E88) GN=pheT PE=3 SV=1 217 610 1.0E-11
sp|Q8R9C7|SYFB_CALS4 Phenylalanine--tRNA ligase beta subunit OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pheT PE=3 SV=1 216 607 3.0E-11
sp|Q48UC5|SYFB_STRPM Phenylalanine--tRNA ligase beta subunit OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=pheT PE=3 SV=1 56 595 3.0E-11
sp|Q2JHU3|SYFB_SYNJB Phenylalanine--tRNA ligase beta subunit OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=pheT PE=3 SV=1 309 610 3.0E-11
sp|Q8DL37|SYFB_THEEB Phenylalanine--tRNA ligase beta subunit OS=Thermosynechococcus elongatus (strain BP-1) GN=pheT PE=3 SV=2 319 610 4.0E-11
sp|Q9K896|SYFB_BACHD Phenylalanine--tRNA ligase beta subunit OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=pheT PE=3 SV=1 56 596 4.0E-11
sp|Q49WQ6|SYFB_STAS1 Phenylalanine--tRNA ligase beta subunit OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=pheT PE=3 SV=1 18 596 4.0E-11
sp|Q92CI6|SYFB_LISIN Phenylalanine--tRNA ligase beta subunit OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pheT PE=3 SV=1 341 610 5.0E-11
sp|Q2FHU2|SYFB_STAA3 Phenylalanine--tRNA ligase beta subunit OS=Staphylococcus aureus (strain USA300) GN=pheT PE=3 SV=1 225 610 7.0E-11
sp|Q836J5|SYFB_ENTFA Phenylalanine--tRNA ligase beta subunit OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=pheT PE=3 SV=1 344 595 9.0E-11
sp|Q9A0I0|SYFB_STRP1 Phenylalanine--tRNA ligase beta subunit OS=Streptococcus pyogenes serotype M1 GN=pheT PE=3 SV=1 56 595 1.0E-10
sp|Q2GAI7|SYFB_NOVAD Phenylalanine--tRNA ligase beta subunit OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=pheT PE=3 SV=1 212 607 1.0E-10
sp|Q9CEB5|SYFB_LACLA Phenylalanine--tRNA ligase beta subunit OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pheT PE=3 SV=1 56 477 1.0E-10
sp|Q9RRX5|SYFB_DEIRA Phenylalanine--tRNA ligase beta subunit OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pheT PE=3 SV=1 224 606 1.0E-10
sp|Q8CWX2|SYFB_STRMU Phenylalanine--tRNA ligase beta subunit OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=pheT PE=3 SV=1 305 487 1.0E-10
sp|Q5N5G8|SYFB_SYNP6 Phenylalanine--tRNA ligase beta subunit OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=pheT PE=3 SV=1 339 610 1.0E-10
sp|Q3A4N8|SYFB_PELCD Phenylalanine--tRNA ligase beta subunit OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=pheT PE=3 SV=1 22 610 1.0E-10
sp|P74764|SYFB_SYNE7 Phenylalanine--tRNA ligase beta subunit OS=Synechococcus elongatus (strain PCC 7942) GN=pheT PE=3 SV=2 339 610 1.0E-10
sp|Q8AA39|SYFB_BACTN Phenylalanine--tRNA ligase beta subunit OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=pheT PE=3 SV=1 343 605 2.0E-10
sp|Q828C6|SYFB_STRAW Phenylalanine--tRNA ligase beta subunit OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=pheT PE=3 SV=1 216 609 2.0E-10
sp|Q8PJE5|SYFB_XANAC Phenylalanine--tRNA ligase beta subunit OS=Xanthomonas axonopodis pv. citri (strain 306) GN=pheT PE=3 SV=1 27 500 2.0E-10
sp|Q5XCX3|SYFB_STRP6 Phenylalanine--tRNA ligase beta subunit OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=pheT PE=1 SV=2 56 595 2.0E-10
sp|Q8P1K0|SYFB_STRP8 Phenylalanine--tRNA ligase beta subunit OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=pheT PE=3 SV=1 56 595 3.0E-10
sp|Q65GD3|SYFB_BACLD Phenylalanine--tRNA ligase beta subunit OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=pheT PE=3 SV=1 56 550 3.0E-10
sp|Q2LR26|SYFB_SYNAS Phenylalanine--tRNA ligase beta subunit OS=Syntrophus aciditrophicus (strain SB) GN=pheT PE=3 SV=1 303 609 4.0E-10
sp|Q3ABT5|SYFB_CARHZ Phenylalanine--tRNA ligase beta subunit OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=pheT PE=3 SV=1 299 609 5.0E-10
sp|Q88WR2|SYFB_LACPL Phenylalanine--tRNA ligase beta subunit OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=pheT PE=3 SV=1 309 596 5.0E-10
sp|P0DG53|SYFB_STRPQ Phenylalanine--tRNA ligase beta subunit OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=pheT PE=3 SV=1 56 595 6.0E-10
sp|P0DG52|SYFB_STRP3 Phenylalanine--tRNA ligase beta subunit OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=pheT PE=3 SV=1 56 595 6.0E-10
sp|O88054|SYFB_STRCO Phenylalanine--tRNA ligase beta subunit OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pheT PE=3 SV=1 285 609 8.0E-10
sp|Q8EZ26|SYFB_LEPIN Phenylalanine--tRNA ligase beta subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=pheT PE=3 SV=1 255 599 9.0E-10
sp|Q72MG8|SYFB_LEPIC Phenylalanine--tRNA ligase beta subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=pheT PE=3 SV=2 255 599 1.0E-09
sp|Q6NDR9|SYFB_RHOPA Phenylalanine--tRNA ligase beta subunit OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=pheT PE=3 SV=1 224 607 1.0E-09
sp|Q38VV4|SYFB_LACSS Phenylalanine--tRNA ligase beta subunit OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=pheT PE=3 SV=1 216 596 3.0E-09
sp|Q5NG54|SYFB_FRATT Phenylalanine--tRNA ligase beta subunit OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=pheT PE=3 SV=1 21 610 3.0E-09
sp|Q9I0A4|SYFB_PSEAE Phenylalanine--tRNA ligase beta subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pheT PE=1 SV=1 345 606 4.0E-09
sp|Q9A9E5|SYFB_CAUCR Phenylalanine--tRNA ligase beta subunit OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=pheT PE=3 SV=1 307 609 4.0E-09
sp|Q97S34|SYFB_STRPN Phenylalanine--tRNA ligase beta subunit OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pheT PE=3 SV=1 339 500 5.0E-09
sp|Q7MXR4|SYFB_PORGI Phenylalanine--tRNA ligase beta subunit OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=pheT PE=1 SV=1 56 475 6.0E-09
sp|Q64T65|SYFB_BACFR Phenylalanine--tRNA ligase beta subunit OS=Bacteroides fragilis (strain YCH46) GN=pheT PE=3 SV=1 337 605 6.0E-09
sp|Q5LC76|SYFB_BACFN Phenylalanine--tRNA ligase beta subunit OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=pheT PE=1 SV=1 337 605 6.0E-09
sp|Q98CQ1|SYFB_RHILO Phenylalanine--tRNA ligase beta subunit OS=Rhizobium loti (strain MAFF303099) GN=pheT PE=3 SV=1 3 604 6.0E-09
sp|Q47ZS5|SYFB_COLP3 Phenylalanine--tRNA ligase beta subunit OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=pheT PE=3 SV=1 24 595 8.0E-09
sp|Q8YMH5|SYFB_NOSS1 Phenylalanine--tRNA ligase beta subunit OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=pheT PE=3 SV=1 345 610 9.0E-09
sp|Q8DQT6|SYFB_STRR6 Phenylalanine--tRNA ligase beta subunit OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pheT PE=3 SV=1 339 500 1.0E-08
sp|Q8Z6I4|SYFB_SALTI Phenylalanine--tRNA ligase beta subunit OS=Salmonella typhi GN=pheT PE=3 SV=1 346 605 1.0E-08
sp|Q8P7Z6|SYFB_XANCP Phenylalanine--tRNA ligase beta subunit OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=pheT PE=3 SV=1 27 500 1.0E-08
sp|Q4UW52|SYFB_XANC8 Phenylalanine--tRNA ligase beta subunit OS=Xanthomonas campestris pv. campestris (strain 8004) GN=pheT PE=3 SV=1 27 500 1.0E-08
sp|Q57PU8|SYFB_SALCH Phenylalanine--tRNA ligase beta subunit OS=Salmonella choleraesuis (strain SC-B67) GN=pheT PE=3 SV=1 346 605 1.0E-08
sp|P15434|SYFB_SALTY Phenylalanine--tRNA ligase beta subunit OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pheT PE=3 SV=3 346 605 1.0E-08
sp|Q5QXL8|SYFB_IDILO Phenylalanine--tRNA ligase beta subunit OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=pheT PE=3 SV=1 56 594 1.0E-08
sp|P47437|SYFB_MYCGE Phenylalanine--tRNA ligase beta subunit OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=pheT PE=3 SV=1 224 610 2.0E-08
sp|Q9KSN6|SYFB_VIBCH Phenylalanine--tRNA ligase beta subunit OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=pheT PE=3 SV=1 216 604 4.0E-08
sp|Q5PH85|SYFB_SALPA Phenylalanine--tRNA ligase beta subunit OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=pheT PE=3 SV=1 346 605 4.0E-08
sp|Q57AD9|SYFB_BRUAB Phenylalanine--tRNA ligase beta subunit OS=Brucella abortus biovar 1 (strain 9-941) GN=pheT PE=3 SV=1 14 503 5.0E-08
sp|Q2YQV4|SYFB_BRUA2 Phenylalanine--tRNA ligase beta subunit OS=Brucella abortus (strain 2308) GN=pheT PE=3 SV=1 14 503 5.0E-08
sp|Q3SWK8|SYFB_NITWN Phenylalanine--tRNA ligase beta subunit OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=pheT PE=3 SV=1 342 607 5.0E-08
sp|Q8XJ76|SYFB_CLOPE Phenylalanine--tRNA ligase beta subunit OS=Clostridium perfringens (strain 13 / Type A) GN=pheT PE=3 SV=1 339 609 6.0E-08
sp|Q6AGD6|SYFB_LEIXX Phenylalanine--tRNA ligase beta subunit OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=pheT PE=3 SV=1 307 477 6.0E-08
sp|Q8FXX4|SYFB_BRUSU Phenylalanine--tRNA ligase beta subunit OS=Brucella suis biovar 1 (strain 1330) GN=pheT PE=3 SV=1 14 503 8.0E-08
sp|Q04VV0|SYFB_LEPBJ Phenylalanine--tRNA ligase beta subunit OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=pheT PE=3 SV=1 293 599 1.0E-07
sp|Q30Y16|SYFB_DESAG Phenylalanine--tRNA ligase beta subunit OS=Desulfovibrio alaskensis (strain G20) GN=pheT PE=3 SV=1 336 519 1.0E-07
sp|Q8EPH5|SYFB_OCEIH Phenylalanine--tRNA ligase beta subunit OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=pheT PE=3 SV=1 225 595 1.0E-07
sp|Q04XL9|SYFB_LEPBL Phenylalanine--tRNA ligase beta subunit OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=pheT PE=3 SV=1 293 599 1.0E-07
sp|Q2RHN8|SYFB_MOOTA Phenylalanine--tRNA ligase beta subunit OS=Moorella thermoacetica (strain ATCC 39073) GN=pheT PE=3 SV=1 216 607 1.0E-07
sp|Q5HAU7|SYFB_EHRRW Phenylalanine--tRNA ligase beta subunit OS=Ehrlichia ruminantium (strain Welgevonden) GN=pheT PE=3 SV=1 54 606 2.0E-07
sp|Q3B4Z2|SYFB_CHLL7 Phenylalanine--tRNA ligase beta subunit OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=pheT PE=3 SV=1 310 474 2.0E-07
sp|Q7VLG3|SYFB_HAEDU Phenylalanine--tRNA ligase beta subunit OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=pheT PE=3 SV=1 365 596 3.0E-07
sp|Q3MAZ7|SYFB_ANAVT Phenylalanine--tRNA ligase beta subunit OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=pheT PE=3 SV=1 345 595 3.0E-07
sp|Q5FFS3|SYFB_EHRRG Phenylalanine--tRNA ligase beta subunit OS=Ehrlichia ruminantium (strain Gardel) GN=pheT PE=3 SV=1 54 606 3.0E-07
sp|Q63TM7|SYFB_BURPS Phenylalanine--tRNA ligase beta subunit OS=Burkholderia pseudomallei (strain K96243) GN=pheT PE=3 SV=1 27 483 4.0E-07
sp|Q62KI7|SYFB_BURMA Phenylalanine--tRNA ligase beta subunit OS=Burkholderia mallei (strain ATCC 23344) GN=pheT PE=3 SV=1 27 483 4.0E-07
sp|Q472N3|SYFB_CUPPJ Phenylalanine--tRNA ligase beta subunit OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=pheT PE=3 SV=1 15 481 5.0E-07
sp|P74296|SYFB_SYNY3 Phenylalanine--tRNA ligase beta subunit OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pheT PE=3 SV=1 309 502 6.0E-07
sp|Q2SVE3|SYFB_BURTA Phenylalanine--tRNA ligase beta subunit OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=pheT PE=3 SV=1 27 481 7.0E-07
sp|Q8YE74|SYFB_BRUME Phenylalanine--tRNA ligase beta subunit OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=pheT PE=3 SV=1 226 503 8.0E-07
sp|Q3JT07|SYFB_BURP1 Phenylalanine--tRNA ligase beta subunit OS=Burkholderia pseudomallei (strain 1710b) GN=pheT PE=3 SV=1 27 483 1.0E-06
sp|Q83L36|SYFB_SHIFL Phenylalanine--tRNA ligase beta subunit OS=Shigella flexneri GN=pheT PE=3 SV=1 348 605 1.0E-06
sp|Q6ANC2|SYFB_DESPS Phenylalanine--tRNA ligase beta subunit OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=pheT PE=3 SV=1 310 477 1.0E-06
sp|Q67QF2|SYFB_SYMTH Phenylalanine--tRNA ligase beta subunit OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=pheT PE=3 SV=1 335 485 1.0E-06
sp|Q6NHH1|SYFB_CORDI Phenylalanine--tRNA ligase beta subunit OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=pheT PE=3 SV=1 206 483 4.0E-06
sp|Q01SP7|SYFB_SOLUE Phenylalanine--tRNA ligase beta subunit OS=Solibacter usitatus (strain Ellin6076) GN=pheT PE=3 SV=1 308 475 5.0E-06
sp|Q39H50|SYFB_BURL3 Phenylalanine--tRNA ligase beta subunit OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=pheT PE=3 SV=1 27 485 6.0E-06
sp|Q5LMS3|SYFB_RUEPO Phenylalanine--tRNA ligase beta subunit OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=pheT PE=3 SV=1 54 599 6.0E-06
sp|Q5P7Y0|SYFB_AROAE Phenylalanine--tRNA ligase beta subunit OS=Aromatoleum aromaticum (strain EbN1) GN=pheT PE=3 SV=1 314 610 6.0E-06
sp|Q7W7C6|SYFB_BORPA Phenylalanine--tRNA ligase beta subunit OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=pheT PE=3 SV=1 364 609 8.0E-06
sp|Q89WI2|SYFB_BRADU Phenylalanine--tRNA ligase beta subunit OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=pheT PE=3 SV=1 342 607 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006432 phenylalanyl-tRNA aminoacylation Yes
GO:0003723 RNA binding Yes
GO:0005524 ATP binding Yes
GO:0000287 magnesium ion binding Yes
GO:0004826 phenylalanine-tRNA ligase activity Yes
GO:0034641 cellular nitrogen compound metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0006807 nitrogen compound metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043436 oxoacid metabolic process No
GO:0043038 amino acid activation No
GO:0032553 ribonucleotide binding No
GO:0006418 tRNA aminoacylation for protein translation No
GO:0006520 cellular amino acid metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0046872 metal ion binding No
GO:0004812 aminoacyl-tRNA ligase activity No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0006399 tRNA metabolic process No
GO:0008150 biological_process No
GO:0006082 organic acid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0032559 adenyl ribonucleotide binding No
GO:0016070 RNA metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0043168 anion binding No
GO:0046483 heterocycle metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0003676 nucleic acid binding No
GO:0043039 tRNA aminoacylation No
GO:0044238 primary metabolic process No
GO:0016874 ligase activity No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0036094 small molecule binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0044281 small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0090304 nucleic acid metabolic process No
GO:0043169 cation binding No
GO:0003824 catalytic activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6926
MPTISVDKYQLFEALGKNFTRDEFEELCFEYGLELDEDTEGDDRPIINGVQEPPKLKIEIPANRYDMLCFEGIAL
NLNIFLGRVKPPNFRLVEPKSQTEQTIVVAPETARVRPYVAGAVLRNIKFTQDRYDSFIALQDKLHQNLARNRTL
VSMGTHDLDTIQGPFTYEALPPKDISFAPLNQTKVMNAEELMTFYESDKHLGRYLHIIRDSPVYPVIYDANRVVC
SLPPIINGHHSRITLDTTNVFIEITATDVTKLKIVTDMLVTMFSAYCAEPFTVEPVQIVSEHNQMSCQTPSLHPR
LTHAQVDYLNSCTGLNESPDSICKLLAKMAYDSRPSDTDANILEVAIPPTRADVLHQCDIMEDLAVCYGFNKLPR
TAPTRSATIGAPLMVNKLSDIVRIEAAMAGWSEVMPLTLCSHDENFAWLNRKDDGNTVVRLANPKTLEYQVVRSS
LLPGLLKTIRENKGHSLPIKIFEVGDVVFKDESEERKARNQRHFAAAWCGKTSGFELVHGLLDRVLLMLRTAFVT
HDEGLVAAGSLDYQVKQNPAKSDGYWIQELNDDTFFPGHAAAVYLRLGGKEQRIGEFGILHPTVLDKFDLRYPVS
TLEVNLEVFL*
Coding >OphauB2|6926
ATGCCCACCATCTCTGTCGACAAGTACCAGCTCTTCGAGGCTCTAGGCAAAAACTTCACAAGAGACGAGTTTGAA
GAGCTCTGCTTCGAGTATGGCCTGGAGCTCGACGAGGATACCGAGGGCGACGACCGGCCCATCATCAACGGTGTC
CAGGAACCGCCCAAGCTCAAGATTGAAATCCCCGCCAACCGCTACGACATGCTCTGCTTCGAGGGCATTGCTCTC
AACCTCAACATCTTTTTGGGCCGCGTCAAGCCCCCAAACTTTCGCCTCGTCGAGCCAAAGTCGCAGACGGAGCAG
ACCATAGTCGTGGCGCCTGAAACGGCCAGAGTCCGCCCTTATGTCGCTGGCGCCGTTTTGCGCAACATCAAGTTC
ACCCAGGATCGCTACGACTCCTTCATTGCCCTCCAGGACAAGCTGCATCAAAACTTGGCCCGCAACCGCACTCTT
GTTTCCATGGGCACCCATGATCTCGACACCATTCAGGGCCCCTTTACCTACGAGGCACTCCCACCCAAGGACATT
TCCTTTGCGCCTCTCAACCAGACAAAGGTGATGAATGCCGAGGAACTCATGACCTTTTACGAATCCGATAAGCAT
TTGGGCCGCTACCTGCACATAATTCGCGACTCCCCCGTATATCCCGTCATTTATGATGCCAACCGTGTTGTCTGC
TCGCTGCCTCCAATCATCAATGGCCACCACTCGAGGATAACGCTCGACACGACAAATGTCTTTATCGAAATCACC
GCCACAGATGTCACCAAGCTCAAGATTGTCACCGACATGCTCGTCACCATGTTCTCCGCCTACTGCGCTGAGCCA
TTTACAGTCGAGCCCGTTCAAATAGTTTCCGAGCACAACCAAATGAGCTGCCAGACTCCGTCGCTTCATCCCAGA
CTGACACATGCCCAAGTCGACTACCTAAACAGCTGCACAGGTCTCAACGAGTCGCCAGACAGCATTTGCAAACTT
CTCGCCAAAATGGCTTATGATTCTCGTCCCTCAGATACAGACGCAAATATTTTGGAAGTCGCCATACCCCCGACG
CGTGCCGACGTTCTTCACCAATGCGACATCATGGAGGATCTTGCCGTTTGCTATGGCTTCAACAAGCTGCCTCGG
ACTGCTCCCACACGCAGCGCCACCATTGGTGCTCCGCTCATGGTCAATAAGCTCAGCGACATTGTGCGCATCGAG
GCCGCCATGGCTGGCTGGAGTGAGGTGATGCCGCTCACTCTGTGCAGCCACGACGAGAATTTTGCCTGGCTGAAC
CGCAAGGACGACGGCAACACCGTGGTGCGCCTGGCCAACCCCAAGACTCTAGAATACCAAGTCGTGCGCAGTTCG
CTGCTTCCTGGTCTTCTCAAGACTATTCGCGAGAACAAGGGACACAGCCTTCCCATCAAGATCTTCGAGGTGGGC
GATGTCGTCTTCAAGGACGAGTCGGAAGAGCGCAAGGCCCGCAACCAACGCCACTTTGCTGCCGCCTGGTGCGGC
AAGACGAGCGGCTTCGAGCTTGTCCATGGCCTCCTGGACAGGGTGCTGCTCATGCTGCGGACTGCATTTGTGACT
CACGACGAGGGCCTGGTGGCTGCCGGCTCGCTTGACTACCAGGTCAAACAAAATCCTGCCAAATCTGACGGTTAC
TGGATCCAAGAACTCAACGACGACACCTTTTTCCCCGGACACGCCGCTGCTGTTTACCTTCGCCTCGGAGGCAAG
GAGCAACGCATTGGCGAATTTGGCATCCTGCACCCGACAGTATTGGACAAGTTTGATCTGAGATACCCCGTCAGC
ACTCTAGAAGTCAACTTGGAGGTCTTTTTATAA
Transcript >OphauB2|6926
ATGCCCACCATCTCTGTCGACAAGTACCAGCTCTTCGAGGCTCTAGGCAAAAACTTCACAAGAGACGAGTTTGAA
GAGCTCTGCTTCGAGTATGGCCTGGAGCTCGACGAGGATACCGAGGGCGACGACCGGCCCATCATCAACGGTGTC
CAGGAACCGCCCAAGCTCAAGATTGAAATCCCCGCCAACCGCTACGACATGCTCTGCTTCGAGGGCATTGCTCTC
AACCTCAACATCTTTTTGGGCCGCGTCAAGCCCCCAAACTTTCGCCTCGTCGAGCCAAAGTCGCAGACGGAGCAG
ACCATAGTCGTGGCGCCTGAAACGGCCAGAGTCCGCCCTTATGTCGCTGGCGCCGTTTTGCGCAACATCAAGTTC
ACCCAGGATCGCTACGACTCCTTCATTGCCCTCCAGGACAAGCTGCATCAAAACTTGGCCCGCAACCGCACTCTT
GTTTCCATGGGCACCCATGATCTCGACACCATTCAGGGCCCCTTTACCTACGAGGCACTCCCACCCAAGGACATT
TCCTTTGCGCCTCTCAACCAGACAAAGGTGATGAATGCCGAGGAACTCATGACCTTTTACGAATCCGATAAGCAT
TTGGGCCGCTACCTGCACATAATTCGCGACTCCCCCGTATATCCCGTCATTTATGATGCCAACCGTGTTGTCTGC
TCGCTGCCTCCAATCATCAATGGCCACCACTCGAGGATAACGCTCGACACGACAAATGTCTTTATCGAAATCACC
GCCACAGATGTCACCAAGCTCAAGATTGTCACCGACATGCTCGTCACCATGTTCTCCGCCTACTGCGCTGAGCCA
TTTACAGTCGAGCCCGTTCAAATAGTTTCCGAGCACAACCAAATGAGCTGCCAGACTCCGTCGCTTCATCCCAGA
CTGACACATGCCCAAGTCGACTACCTAAACAGCTGCACAGGTCTCAACGAGTCGCCAGACAGCATTTGCAAACTT
CTCGCCAAAATGGCTTATGATTCTCGTCCCTCAGATACAGACGCAAATATTTTGGAAGTCGCCATACCCCCGACG
CGTGCCGACGTTCTTCACCAATGCGACATCATGGAGGATCTTGCCGTTTGCTATGGCTTCAACAAGCTGCCTCGG
ACTGCTCCCACACGCAGCGCCACCATTGGTGCTCCGCTCATGGTCAATAAGCTCAGCGACATTGTGCGCATCGAG
GCCGCCATGGCTGGCTGGAGTGAGGTGATGCCGCTCACTCTGTGCAGCCACGACGAGAATTTTGCCTGGCTGAAC
CGCAAGGACGACGGCAACACCGTGGTGCGCCTGGCCAACCCCAAGACTCTAGAATACCAAGTCGTGCGCAGTTCG
CTGCTTCCTGGTCTTCTCAAGACTATTCGCGAGAACAAGGGACACAGCCTTCCCATCAAGATCTTCGAGGTGGGC
GATGTCGTCTTCAAGGACGAGTCGGAAGAGCGCAAGGCCCGCAACCAACGCCACTTTGCTGCCGCCTGGTGCGGC
AAGACGAGCGGCTTCGAGCTTGTCCATGGCCTCCTGGACAGGGTGCTGCTCATGCTGCGGACTGCATTTGTGACT
CACGACGAGGGCCTGGTGGCTGCCGGCTCGCTTGACTACCAGGTCAAACAAAATCCTGCCAAATCTGACGGTTAC
TGGATCCAAGAACTCAACGACGACACCTTTTTCCCCGGACACGCCGCTGCTGTTTACCTTCGCCTCGGAGGCAAG
GAGCAACGCATTGGCGAATTTGGCATCCTGCACCCGACAGTATTGGACAAGTTTGATCTGAGATACCCCGTCAGC
ACTCTAGAAGTCAACTTGGAGGTCTTTTTATAA
Gene >OphauB2|6926
ATGCCCACCATCTCTGTCGACAAGTACCAGCTCTTCGAGGCTCTAGGCAAAAAGTAGGCCCTTGTCTGTCCCCCG
CCAGACATGGTGGATGCAGCTGACGCCCGCCAGCTTCACAAGAGACGAGTTTGAAGAGCTCTGCTTCGAGTATGG
CCTGGAGCTCGACGAGGATACCGAGGGCGACGACCGGCCCATCATCAACGGTGTCCAGGAACCGCCCAAGCTCAA
GATTGAAATCCCCGCCAACCGCTACGACATGCTCTGCTTCGAGGGCATTGCTCTCAACCTCAACATCTTTTTGGG
CCGCGTCAAGCCCCCAAACTTTCGCCTCGTCGAGCCAAAGTCGCAGACGGAGCAGACCATAGTCGTGGCGCCTGA
AACGGCCAGAGTCCGCCCTTATGTCGCTGGCGCCGTTTTGCGCAACATCAAGTTCACCCAGGATCGCTACGACTC
CTTCATTGCCCTCCAGGACAAGCTGCATCAAAACTTGGCCCGCAACCGCACTCTTGTTTCCATGGGCACCCATGA
TCTCGACACCATTCAGGGCCCCTTTACCTACGAGGCACTCCCACCCAAGGACATTTCCTTTGCGCCTCTCAACCA
GACAAAGGTGATGAATGCCGAGGAACTCATGACCTTTTACGAATCCGATAAGCATTTGGGCCGCTACCTGCACAT
AATTCGCGACTCCCCCGTATATCCCGTCATTTATGATGCCAACCGTGTTGTCTGCTCGCTGCCTCCAATCATCAA
TGGCCACCACTCGAGGATAACGCTCGACACGACAAATGTCTTTATCGAAATCACCGCCACAGATGTCACCAAGCT
CAAGATTGTCACCGACATGCTCGTCACCATGTTCTCCGCCTACTGCGCTGAGCCATTTACAGTCGAGCCCGTTCA
AATAGTTTCCGAGCACAACCAAATGAGCTGCCAGACTCCGTCGCTTCATCCCAGACTGACACATGCCCAAGTCGA
CTACCTAAACAGCTGCACAGGTCTCAACGAGTCGCCAGACAGCATTTGCAAACTTCTCGCCAAAATGGCTTATGA
TTCTCGTCCCTCAGATACAGACGCAAATATTTTGGAAGTCGCCATACCCCCGACGCGTGCCGACGTTCTTCACCA
ATGCGACATCATGGAGGATCTTGCCGTTTGCTATGGCTTCAACAAGCTGCCTCGGACTGCTCCCACACGCAGCGC
CACCATTGGTGCTCCGCTCATGGTCAATAAGCTCAGCGACATTGTGCGCATCGAGGCCGCCATGGCTGGCTGGAG
TGAGGTGATGCCGCTCACTCTGTGCAGCCACGACGAGAATTTTGCCTGGCTGAACCGCAAGGACGACGGCAACAC
CGTGGTGCGCCTGGCCAACCCCAAGACTCTAGAATACCAAGTCGTGCGCAGTTCGCTGCTTCCTGGTCTTCTCAA
GACTATTCGCGAGAACAAGGGACACAGCCTTCCCATCAAGATCTTCGAGGTGGGCGATGTCGTCTTCAAGGACGA
GTCGGAAGAGCGCAAGGCCCGCAACCAACGCCACTTTGCTGCCGCCTGGTGCGGCAAGACGAGCGGCTTCGAGCT
TGTCCATGGCCTCCTGGACAGGGTGCTGCTCATGCTGCGGACTGCATTTGTGACTCACGACGAGGGCCTGGTGGC
TGCCGGCTCGCTTGACTACCAGGTCAAACAAAATCCTGCCAAATCTGACGGTTACTGGATCCAAGAACTCAACGA
CGACACCTTTTTCCCCGGACACGCCGCTGCTGTTTACCTTCGCCTCGGAGGCAAGGAGCAACGCATTGGCGAATT
TGGCATCCTGCACCCGACAGTATTGGACAAGTTTGATCTGAGGTGCGTCTTGGCTTTTATTTCCATCATTATTCT
TTTGAGAGCACAGATTTCCCCCTCCATCAACAGTGTACATATGCCCCCGTGCTAACTAGTCTGGATGCCCAGATA
CCCCGTCAGCACTCTAGAAGTCAACTTGGAGGTCTTTTTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail