Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6924
Gene name
LocationContig_69:39866..40789
Strand+
Gene length (bp)923
Transcript length (bp)801
Coding sequence length (bp)801
Protein length (aa) 267

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13847 Methyltransf_31 Methyltransferase domain 7.8E-12 76 216
PF13649 Methyltransf_25 Methyltransferase domain 3.3E-07 82 150
PF13489 Methyltransf_23 Methyltransferase domain 1.4E-06 75 176
PF08241 Methyltransf_11 Methyltransferase domain 2.3E-05 82 201

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P40516|EFM4_YEAST Protein-lysine N-methyltransferase EFM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EFM4 PE=1 SV=1 5 265 2.0E-40
sp|Q9P7Z3|EFM4_SCHPO Protein-lysine N-methyltransferase efm4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=see1 PE=2 SV=1 12 264 2.0E-33
sp|Q5D013|MET10_DANRE Protein-lysine N-methyltransferase mettl10 OS=Danio rerio GN=mettl10 PE=2 SV=1 14 266 2.0E-30
sp|Q9D853|MET10_MOUSE Protein-lysine N-methyltransferase Mettl10 OS=Mus musculus GN=Mettl10 PE=1 SV=1 14 265 9.0E-29
sp|Q5JPI9|MET10_HUMAN Protein-lysine N-methyltransferase METTL10 OS=Homo sapiens GN=METTL10 PE=1 SV=2 14 222 8.0E-23

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6924
MSGSQAHHPAHLEPSELGTKEYWDKLYANEVSNHAADPDDIGTVWFDDSDAQASIVDYLDSLAAPCSADDGSALL
SKQASLLDLGCGNGSLLLALRAAGWSGRALGVDYSQQGIALARSVAAHASSCHARLLAPDFLHWDIINGPLDALA
TSPACPALGWDLVLDKGTFDAISLAHDVDAHGRRLADCYRQRVLRLVRPNGGLFLITSCNWTDAELHAWFADQAE
PSAPDAAPDGRFQVAGHVKYKTFSFGGVKGQTISTVLFQKV*
Coding >OphauB2|6924
ATGTCTGGCTCGCAGGCCCATCACCCAGCTCACCTCGAACCATCCGAGCTGGGCACCAAGGAGTACTGGGACAAG
CTCTACGCAAACGAAGTCTCCAACCACGCGGCGGACCCAGACGACATTGGCACCGTGTGGTTTGACGACTCGGAC
GCCCAGGCCAGCATCGTCGACTATCTCGACAGCCTTGCCGCTCCGTGCTCGGCAGACGACGGCTCAGCACTCCTC
TCCAAACAAGCCTCCCTCCTCGATCTCGGCTGTGGCAACGGCTCGCTCCTGCTCGCCTTGCGCGCGGCGGGCTGG
TCTGGCCGCGCCCTCGGCGTCGACTATAGCCAGCAAGGCATCGCCCTCGCCCGTAGTGTCGCCGCGCACGCTTCC
AGCTGCCACGCCCGCCTGCTTGCTCCAGACTTTTTGCACTGGGACATCATCAATGGGCCCCTTGACGCCCTTGCC
ACATCGCCTGCTTGTCCTGCCTTGGGGTGGGATCTCGTTCTCGACAAGGGCACCTTTGATGCCATTTCCCTTGCC
CACGACGTCGATGCCCATGGCCGCCGTCTGGCCGACTGCTACCGCCAGCGCGTCCTCCGCCTCGTCCGCCCCAAT
GGCGGCCTCTTCCTCATCACCAGCTGCAACTGGACAGATGCCGAGCTCCACGCTTGGTTCGCCGACCAAGCTGAG
CCCTCGGCGCCTGATGCGGCACCCGACGGCCGTTTTCAAGTCGCCGGACACGTCAAATACAAGACGTTTAGCTTT
GGCGGCGTCAAGGGCCAGACCATCAGTACCGTCTTATTTCAAAAGGTCTAG
Transcript >OphauB2|6924
ATGTCTGGCTCGCAGGCCCATCACCCAGCTCACCTCGAACCATCCGAGCTGGGCACCAAGGAGTACTGGGACAAG
CTCTACGCAAACGAAGTCTCCAACCACGCGGCGGACCCAGACGACATTGGCACCGTGTGGTTTGACGACTCGGAC
GCCCAGGCCAGCATCGTCGACTATCTCGACAGCCTTGCCGCTCCGTGCTCGGCAGACGACGGCTCAGCACTCCTC
TCCAAACAAGCCTCCCTCCTCGATCTCGGCTGTGGCAACGGCTCGCTCCTGCTCGCCTTGCGCGCGGCGGGCTGG
TCTGGCCGCGCCCTCGGCGTCGACTATAGCCAGCAAGGCATCGCCCTCGCCCGTAGTGTCGCCGCGCACGCTTCC
AGCTGCCACGCCCGCCTGCTTGCTCCAGACTTTTTGCACTGGGACATCATCAATGGGCCCCTTGACGCCCTTGCC
ACATCGCCTGCTTGTCCTGCCTTGGGGTGGGATCTCGTTCTCGACAAGGGCACCTTTGATGCCATTTCCCTTGCC
CACGACGTCGATGCCCATGGCCGCCGTCTGGCCGACTGCTACCGCCAGCGCGTCCTCCGCCTCGTCCGCCCCAAT
GGCGGCCTCTTCCTCATCACCAGCTGCAACTGGACAGATGCCGAGCTCCACGCTTGGTTCGCCGACCAAGCTGAG
CCCTCGGCGCCTGATGCGGCACCCGACGGCCGTTTTCAAGTCGCCGGACACGTCAAATACAAGACGTTTAGCTTT
GGCGGCGTCAAGGGCCAGACCATCAGTACCGTCTTATTTCAAAAGGTCTAG
Gene >OphauB2|6924
ATGTCTGGCTCGCAGGCCCATCACCCAGCTCACCTCGAACCATCCGAGCTGGGCACCAAGGAGTAGTACGTCTTT
TCCTTTTTTTTTTAATACTTTCCCCCTTTTTCACCCTCTCAGCTAGACGAGGGACCTGAAGGAAAAAAAAAAAAA
AAGACAAGAATCAAAACTGACACTCGGCCGGCACAAGCTGGGACAAGCTCTACGCAAACGAAGTCTCCAACCACG
CGGCGGACCCAGACGACATTGGCACCGTGTGGTTTGACGACTCGGACGCCCAGGCCAGCATCGTCGACTATCTCG
ACAGCCTTGCCGCTCCGTGCTCGGCAGACGACGGCTCAGCACTCCTCTCCAAACAAGCCTCCCTCCTCGATCTCG
GCTGTGGCAACGGCTCGCTCCTGCTCGCCTTGCGCGCGGCGGGCTGGTCTGGCCGCGCCCTCGGCGTCGACTATA
GCCAGCAAGGCATCGCCCTCGCCCGTAGTGTCGCCGCGCACGCTTCCAGCTGCCACGCCCGCCTGCTTGCTCCAG
ACTTTTTGCACTGGGACATCATCAATGGGCCCCTTGACGCCCTTGCCACATCGCCTGCTTGTCCTGCCTTGGGGT
GGGATCTCGTTCTCGACAAGGGCACCTTTGATGCCATTTCCCTTGCCCACGACGTCGATGCCCATGGCCGCCGTC
TGGCCGACTGCTACCGCCAGCGCGTCCTCCGCCTCGTCCGCCCCAATGGCGGCCTCTTCCTCATCACCAGCTGCA
ACTGGACAGATGCCGAGCTCCACGCTTGGTTCGCCGACCAAGCTGAGCCCTCGGCGCCTGATGCGGCACCCGACG
GCCGTTTTCAAGTCGCCGGACACGTCAAATACAAGACGTTTAGCTTTGGCGGCGTCAAGGGCCAGACCATCAGTA
CCGTCTTATTTCAAAAGGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail