Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6919
Gene name
LocationContig_69:29213..30560
Strand-
Gene length (bp)1347
Transcript length (bp)1284
Coding sequence length (bp)1284
Protein length (aa) 428

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01873 eIF-5_eIF-2B Domain found in IF2B/IF5 4.0E-38 8 126
PF02020 W2 eIF4-gamma/eIF5/eIF2-epsilon 4.0E-23 339 424

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09689|IF5_SCHPO Probable eukaryotic translation initiation factor 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif5 PE=3 SV=1 1 414 6.0E-103
sp|P38431|IF5_YEAST Eukaryotic translation initiation factor 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIF5 PE=1 SV=1 4 414 3.0E-99
sp|Q9VXK6|IF5_DROME Eukaryotic translation initiation factor 5 OS=Drosophila melanogaster GN=eIF5 PE=1 SV=1 1 417 6.0E-73
sp|Q07205|IF5_RAT Eukaryotic translation initiation factor 5 OS=Rattus norvegicus GN=Eif5 PE=1 SV=1 4 417 3.0E-69
sp|P55010|IF5_HUMAN Eukaryotic translation initiation factor 5 OS=Homo sapiens GN=EIF5 PE=1 SV=2 4 417 4.0E-69
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09689|IF5_SCHPO Probable eukaryotic translation initiation factor 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif5 PE=3 SV=1 1 414 6.0E-103
sp|P38431|IF5_YEAST Eukaryotic translation initiation factor 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIF5 PE=1 SV=1 4 414 3.0E-99
sp|Q9VXK6|IF5_DROME Eukaryotic translation initiation factor 5 OS=Drosophila melanogaster GN=eIF5 PE=1 SV=1 1 417 6.0E-73
sp|Q07205|IF5_RAT Eukaryotic translation initiation factor 5 OS=Rattus norvegicus GN=Eif5 PE=1 SV=1 4 417 3.0E-69
sp|P55010|IF5_HUMAN Eukaryotic translation initiation factor 5 OS=Homo sapiens GN=EIF5 PE=1 SV=2 4 417 4.0E-69
sp|P59325|IF5_MOUSE Eukaryotic translation initiation factor 5 OS=Mus musculus GN=Eif5 PE=1 SV=1 4 417 5.0E-69
sp|Q22918|IF5_CAEEL Eukaryotic translation initiation factor 5 OS=Caenorhabditis elegans GN=C37C3.2 PE=3 SV=2 4 162 9.0E-52
sp|Q5R4L0|IF5_PONAB Eukaryotic translation initiation factor 5 OS=Pongo abelii GN=EIF5 PE=2 SV=1 4 145 4.0E-51
sp|Q9S825|IF5Z_ARATH Probable eukaryotic translation initiation factor 5-2 OS=Arabidopsis thaliana GN=At1g77840 PE=2 SV=1 1 417 1.0E-46
sp|P48724|IF5_PHAVU Eukaryotic translation initiation factor 5 OS=Phaseolus vulgaris GN=EIF5 PE=2 SV=1 1 425 2.0E-45
sp|P55876|IF5_MAIZE Eukaryotic translation initiation factor 5 OS=Zea mays GN=EIF5 PE=2 SV=1 1 160 4.0E-42
sp|Q54LA1|IF5_DICDI Eukaryotic translation initiation factor 5 OS=Dictyostelium discoideum GN=eif5 PE=3 SV=1 1 154 1.0E-41
sp|Q9C8F1|IF5Y_ARATH Probable eukaryotic translation initiation factor 5-1 OS=Arabidopsis thaliana GN=At1g36730 PE=2 SV=1 1 145 4.0E-40
sp|Q26891|IF5_TRICA Eukaryotic translation initiation factor 5 (Fragment) OS=Tribolium castaneum PE=2 SV=1 90 253 2.0E-15
sp|Q8TWR5|IF2B_METKA Translation initiation factor 2 subunit beta OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=eif2b PE=3 SV=1 16 135 2.0E-11
sp|Q2NHD9|IF2B_METST Translation initiation factor 2 subunit beta OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=eif2b PE=3 SV=1 16 128 7.0E-10
sp|Q8PWV1|IF2B_METMA Translation initiation factor 2 subunit beta OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=eif2b PE=3 SV=1 32 142 4.0E-09
sp|A2SSW2|IF2B_METLZ Translation initiation factor 2 subunit beta OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=eif2b PE=3 SV=1 16 133 6.0E-09
sp|A0B5K5|IF2B_METTP Translation initiation factor 2 subunit beta OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=eif2b PE=3 SV=1 32 133 1.0E-08
sp|Q8TU91|IF2B_METAC Translation initiation factor 2 subunit beta OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=eif2b PE=3 SV=1 32 142 1.0E-08
sp|A5UKI8|IF2B_METS3 Translation initiation factor 2 subunit beta OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=eif2b PE=3 SV=1 16 127 1.0E-08
sp|Q74M98|IF2B_NANEQ Translation initiation factor 2 subunit beta OS=Nanoarchaeum equitans (strain Kin4-M) GN=eif2b PE=3 SV=1 34 134 3.0E-08
sp|O27797|IF2B_METTH Translation initiation factor 2 subunit beta OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=eif2b PE=1 SV=1 16 127 6.0E-08
sp|O27958|IF2B_ARCFU Translation initiation factor 2 subunit beta OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=eif2b PE=3 SV=1 16 130 7.0E-08
sp|P56329|IF2B_SCHPO Probable eukaryotic translation initiation factor 2 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif212 PE=1 SV=2 32 130 7.0E-08
sp|O24473|IF2B_WHEAT Eukaryotic translation initiation factor 2 subunit beta OS=Triticum aestivum PE=1 SV=1 34 130 8.0E-08
sp|A7I5J0|IF2B_METB6 Translation initiation factor 2 subunit beta OS=Methanoregula boonei (strain 6A8) GN=eif2b PE=3 SV=1 16 125 1.0E-07
sp|Q41969|IF2B_ARATH Eukaryotic translation initiation factor 2 subunit beta OS=Arabidopsis thaliana GN=EMB1401 PE=1 SV=3 34 130 1.0E-07
sp|A3CXJ3|IF2B_METMJ Translation initiation factor 2 subunit beta OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=eif2b PE=3 SV=1 16 161 1.0E-07
sp|Q6L0E6|IF2B_PICTO Translation initiation factor 2 subunit beta OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=eif2b PE=3 SV=1 32 125 2.0E-07
sp|P41375|IF2B_DROME Eukaryotic translation initiation factor 2 subunit 2 OS=Drosophila melanogaster GN=eIF-2beta PE=1 SV=1 34 130 2.0E-07
sp|Q54T27|IF2B_DICDI Eukaryotic translation initiation factor 2 subunit 2 OS=Dictyostelium discoideum GN=eif2s2 PE=3 SV=1 34 130 6.0E-07
sp|P55871|IF2B_MALDO Eukaryotic translation initiation factor 2 subunit beta OS=Malus domestica PE=2 SV=2 34 159 6.0E-07
sp|Q9HQ97|IF2B_HALSA Translation initiation factor 2 subunit beta OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=eif2b PE=3 SV=1 9 130 7.0E-07
sp|B0R583|IF2B_HALS3 Translation initiation factor 2 subunit beta OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=eif2b PE=3 SV=1 9 130 7.0E-07
sp|A3DNI8|IF2B_STAMF Translation initiation factor 2 subunit beta OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=eif2b PE=3 SV=1 32 131 1.0E-06
sp|Q6M0H3|IF2B_METMP Translation initiation factor 2 subunit beta OS=Methanococcus maripaludis (strain S2 / LL) GN=eif2b PE=3 SV=1 16 125 2.0E-06
sp|Q97B05|IF2B_THEVO Translation initiation factor 2 subunit beta OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=eif2b PE=3 SV=2 32 125 2.0E-06
sp|A6VIT7|IF2B_METM7 Translation initiation factor 2 subunit beta OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=eif2b PE=3 SV=1 16 125 2.0E-06
sp|A9A7T1|IF2B_METM6 Translation initiation factor 2 subunit beta OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=eif2b PE=3 SV=1 16 125 2.0E-06
sp|A6UX55|IF2B_META3 Translation initiation factor 2 subunit beta OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=eif2b PE=3 SV=1 16 132 2.0E-06
sp|Q5V323|IF2B_HALMA Translation initiation factor 2 subunit beta OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=eif2b PE=3 SV=1 29 128 5.0E-06
sp|O58312|IF2B_PYRHO Translation initiation factor 2 subunit beta OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=eif2b PE=3 SV=1 32 130 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006413 translational initiation Yes
GO:0005515 protein binding Yes
GO:0003743 translation initiation factor activity Yes
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0045182 translation regulator activity No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0008135 translation factor activity, RNA binding No
GO:0008150 biological_process No
GO:0044237 cellular metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0090079 translation regulator activity, nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6919
MSLINVRRDVSDAFYRYKMERLQTKIEGKGNGIKTVIVNLPSIAASLARPPSYINKYFGFELGAMINNDPKDDRW
IINGAHESGKLQDHLDGFINKFVLCKKCKNPETDVNINNDRILLDCKACGQRTNVDLRLKLSGYILKTQPSKKGK
MDKAERRAAKKAKQQQNGNGAKENGTGSGGDEISENGSNDVEENGEVVMSDDEFQKMQAAAPEAVDIEVQDDEWA
VDMSEEAVKARQAQLPGEFKQKLSFNEDEDDEGESGGNTVYDEFGNWIQQEADNKGGIDGVESINIYLKAKELNI
ESKHRTVLVLAQTLFDTNVCAQIPKRTSMLKQIVTSERHEKALLGGTERLLGGLNKEHPEILQNIVKILQLYYHH
DLISEEVVTKWGTKASKKYTDLQTSRKIRKAAEPFLKWLEEADEEESSEEED*
Coding >OphauB2|6919
ATGTCTCTCATCAATGTCCGTCGCGATGTCAGCGATGCATTCTATCGCTACAAGATGGAGCGCCTGCAGACCAAA
ATTGAGGGCAAAGGTAACGGCATAAAGACCGTCATCGTCAATCTGCCAAGCATCGCCGCCTCGCTCGCTCGACCG
CCCTCCTACATCAACAAGTATTTTGGCTTTGAGCTGGGTGCCATGATCAACAACGACCCCAAGGACGATCGCTGG
ATCATCAACGGTGCTCATGAATCGGGCAAACTGCAGGATCATCTTGACGGCTTCATTAACAAGTTTGTCCTCTGC
AAAAAGTGCAAGAACCCTGAAACCGATGTCAACATCAACAATGATCGCATACTGCTTGATTGTAAGGCTTGCGGC
CAGCGTACCAATGTCGATCTTCGCCTCAAACTCAGTGGCTACATTCTCAAGACTCAGCCCAGCAAAAAGGGCAAA
ATGGACAAGGCTGAGCGCCGCGCTGCCAAGAAGGCCAAGCAGCAACAGAATGGCAATGGTGCCAAGGAGAATGGC
ACTGGCAGTGGTGGCGATGAAATTTCTGAGAATGGGTCCAACGATGTTGAAGAAAATGGGGAAGTCGTCATGAGC
GATGACGAGTTCCAGAAAATGCAGGCAGCCGCTCCTGAAGCTGTCGACATTGAGGTTCAGGACGATGAATGGGCC
GTTGACATGAGCGAGGAAGCAGTCAAGGCCCGCCAGGCTCAGCTTCCCGGGGAATTCAAACAAAAGCTTAGCTTC
AATGAAGATGAAGACGACGAAGGCGAGAGCGGTGGCAATACTGTCTACGACGAATTCGGCAACTGGATTCAGCAG
GAAGCCGACAACAAAGGTGGCATTGATGGCGTCGAATCAATTAATATCTATCTCAAGGCTAAGGAGCTCAATATT
GAGTCCAAGCATCGCACTGTCTTGGTTCTTGCTCAGACGCTCTTTGATACGAATGTTTGCGCCCAGATTCCAAAG
CGCACGAGCATGCTTAAACAGATTGTTACCAGTGAACGCCACGAAAAGGCTCTGCTTGGTGGTACTGAGCGACTT
CTTGGTGGGCTGAATAAGGAGCACCCCGAGATCCTCCAGAATATTGTCAAGATTTTGCAGCTCTACTATCACCAC
GACCTCATTTCTGAGGAGGTAGTCACCAAGTGGGGAACCAAGGCCAGCAAGAAGTACACGGACCTACAGACTTCG
CGCAAAATCCGCAAGGCCGCCGAGCCATTTCTCAAATGGCTCGAGGAGGCTGACGAGGAGGAATCCTCCGAGGAA
GAAGACTAA
Transcript >OphauB2|6919
ATGTCTCTCATCAATGTCCGTCGCGATGTCAGCGATGCATTCTATCGCTACAAGATGGAGCGCCTGCAGACCAAA
ATTGAGGGCAAAGGTAACGGCATAAAGACCGTCATCGTCAATCTGCCAAGCATCGCCGCCTCGCTCGCTCGACCG
CCCTCCTACATCAACAAGTATTTTGGCTTTGAGCTGGGTGCCATGATCAACAACGACCCCAAGGACGATCGCTGG
ATCATCAACGGTGCTCATGAATCGGGCAAACTGCAGGATCATCTTGACGGCTTCATTAACAAGTTTGTCCTCTGC
AAAAAGTGCAAGAACCCTGAAACCGATGTCAACATCAACAATGATCGCATACTGCTTGATTGTAAGGCTTGCGGC
CAGCGTACCAATGTCGATCTTCGCCTCAAACTCAGTGGCTACATTCTCAAGACTCAGCCCAGCAAAAAGGGCAAA
ATGGACAAGGCTGAGCGCCGCGCTGCCAAGAAGGCCAAGCAGCAACAGAATGGCAATGGTGCCAAGGAGAATGGC
ACTGGCAGTGGTGGCGATGAAATTTCTGAGAATGGGTCCAACGATGTTGAAGAAAATGGGGAAGTCGTCATGAGC
GATGACGAGTTCCAGAAAATGCAGGCAGCCGCTCCTGAAGCTGTCGACATTGAGGTTCAGGACGATGAATGGGCC
GTTGACATGAGCGAGGAAGCAGTCAAGGCCCGCCAGGCTCAGCTTCCCGGGGAATTCAAACAAAAGCTTAGCTTC
AATGAAGATGAAGACGACGAAGGCGAGAGCGGTGGCAATACTGTCTACGACGAATTCGGCAACTGGATTCAGCAG
GAAGCCGACAACAAAGGTGGCATTGATGGCGTCGAATCAATTAATATCTATCTCAAGGCTAAGGAGCTCAATATT
GAGTCCAAGCATCGCACTGTCTTGGTTCTTGCTCAGACGCTCTTTGATACGAATGTTTGCGCCCAGATTCCAAAG
CGCACGAGCATGCTTAAACAGATTGTTACCAGTGAACGCCACGAAAAGGCTCTGCTTGGTGGTACTGAGCGACTT
CTTGGTGGGCTGAATAAGGAGCACCCCGAGATCCTCCAGAATATTGTCAAGATTTTGCAGCTCTACTATCACCAC
GACCTCATTTCTGAGGAGGTAGTCACCAAGTGGGGAACCAAGGCCAGCAAGAAGTACACGGACCTACAGACTTCG
CGCAAAATCCGCAAGGCCGCCGAGCCATTTCTCAAATGGCTCGAGGAGGCTGACGAGGAGGAATCCTCCGAGGAA
GAAGACTAA
Gene >OphauB2|6919
ATGTCTCTCATCAATGTCCGTCGCGATGTCAGCGATGCATTCTATCGCTACAAGATGGAGCGCCTGCAGACCAAA
ATTGAGGGCAAAGGTAACGGCATAAAGACCGTCATCGTCAATCTGCCAAGCATCGCCGCCTCGCTCGCTCGACCG
CCCTCCTACATCAACAAGTATTTTGGCTTTGAGCTGGGTGCCATGATCAACAACGACCCCAAGGACGATCGCTGG
ATCATCAACGGTGCTCATGAATCGGGCAAACTGCAGGATCATCTTGACGGCTTCATTAACAAGTTTGTCCTCTGC
AAAAAGTGCAAGAACCCTGAAACCGATGTCAACATCAACAATGATCGCATACTGCTTGATTGTAAGGCTTGCGGC
CAGCGTACCAATGTCGATCTTCGCCTCAAACTCAGTGGCTACATTCTCAAGACTCAGCCCAGCAAAAAGGGCAAA
ATGGACAAGGCTGAGCGCCGCGCTGCCAAGAAGGCCAAGCAGCAACAGAATGGCAATGGTGCCAAGGAGAATGGC
ACTGGCAGTGGTGGCGATGAAATTTCTGAGAATGGGTCCAACGATGTTGAAGAAAATGGGGAAGTCGTCATGAGC
GATGACGAGTTCCAGAAAATGCAGGCAGCCGCTCCTGAAGCTGTCGACATTGAGGTTCAGGACGATGAATGGGCC
GTTGACATGAGCGAGGAAGCAGTCAAGGCCCGCCAGGCTCAGCTTCCCGGGGAATTCAAACAAAAGCTTAGCTTC
AATGAAGATGAAGACGACGAAGGCGAGAGCGGTGGCAATACTGTCTACGACGAATTCGGCAACTGGATTCAGCAG
GAAGCCGACAACAAAGGTGGCATTGATGGCGTCGAATCAATTAATATCTATCTCAAGGCTAAGGAGCTCAATATT
GAGTCCAAGCATCGCACTGTCTTGGTTCTTGCTCAGACGCTCTTTGATACGAATGTTTGCGCCCAGATTCCAAAG
CGCACGAGCATGCTTAAACAGGTGTGTTGCTAAGAAGCAGTTGATGAATGGTCAAGTGTTTATGCGATGCTGACT
GCGGCTCAGATTGTTACCAGTGAACGCCACGAAAAGGCTCTGCTTGGTGGTACTGAGCGACTTCTTGGTGGGCTG
AATAAGGAGCACCCCGAGATCCTCCAGAATATTGTCAAGATTTTGCAGCTCTACTATCACCACGACCTCATTTCT
GAGGAGGTAGTCACCAAGTGGGGAACCAAGGCCAGCAAGAAGTACACGGACCTACAGACTTCGCGCAAAATCCGC
AAGGCCGCCGAGCCATTTCTCAAATGGCTCGAGGAGGCTGACGAGGAGGAATCCTCCGAGGAAGAAGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail