Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6916
Gene name
LocationContig_69:20603..22743
Strand-
Gene length (bp)2140
Transcript length (bp)1887
Coding sequence length (bp)1887
Protein length (aa) 629

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13087 AAA_12 AAA domain 1.7E-27 322 514
PF13086 AAA_11 AAA domain 2.5E-22 48 313
PF13245 AAA_19 AAA domain 5.0E-06 48 307
PF04851 ResIII Type III restriction enzyme, res subunit 5.7E-05 57 108

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8CFQ3|AQR_MOUSE Intron-binding protein aquarius OS=Mus musculus GN=Aqr PE=1 SV=2 28 577 0.0E+00
sp|O60306|AQR_HUMAN Intron-binding protein aquarius OS=Homo sapiens GN=AQR PE=1 SV=4 28 604 0.0E+00
sp|O94508|CWF11_SCHPO Pre-mRNA-splicing factor cwf11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf11 PE=1 SV=1 37 581 3.0E-74
sp|Q8R151|ZNFX1_MOUSE NFX1-type zinc finger-containing protein 1 OS=Mus musculus GN=Znfx1 PE=1 SV=3 235 554 3.0E-31
sp|Q9P2E3|ZNFX1_HUMAN NFX1-type zinc finger-containing protein 1 OS=Homo sapiens GN=ZNFX1 PE=2 SV=2 235 554 1.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8CFQ3|AQR_MOUSE Intron-binding protein aquarius OS=Mus musculus GN=Aqr PE=1 SV=2 28 577 0.0E+00
sp|O60306|AQR_HUMAN Intron-binding protein aquarius OS=Homo sapiens GN=AQR PE=1 SV=4 28 604 0.0E+00
sp|O94508|CWF11_SCHPO Pre-mRNA-splicing factor cwf11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf11 PE=1 SV=1 37 581 3.0E-74
sp|Q8R151|ZNFX1_MOUSE NFX1-type zinc finger-containing protein 1 OS=Mus musculus GN=Znfx1 PE=1 SV=3 235 554 3.0E-31
sp|Q9P2E3|ZNFX1_HUMAN NFX1-type zinc finger-containing protein 1 OS=Homo sapiens GN=ZNFX1 PE=2 SV=2 235 554 1.0E-28
sp|Q9FJR0|RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana GN=UPF1 PE=1 SV=2 235 544 3.0E-26
sp|Q54I89|RENT1_DICDI Regulator of nonsense transcripts 1 OS=Dictyostelium discoideum GN=upf1 PE=3 SV=1 224 544 6.0E-24
sp|Q00416|SEN1_YEAST Helicase SEN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN1 PE=1 SV=2 36 514 4.0E-23
sp|P30771|NAM7_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM7 PE=1 SV=1 235 566 4.0E-22
sp|P34243|HCS1_YEAST DNA polymerase alpha-associated DNA helicase A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HCS1 PE=1 SV=1 44 520 1.0E-21
sp|Q09820|RENT1_SCHPO ATP-dependent helicase upf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=upf1 PE=3 SV=2 235 550 1.0E-21
sp|Q92900|RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens GN=UPF1 PE=1 SV=2 221 544 1.0E-21
sp|Q9EPU0|RENT1_MOUSE Regulator of nonsense transcripts 1 OS=Mus musculus GN=Upf1 PE=1 SV=2 221 544 2.0E-21
sp|Q86YA3|ZGRF1_HUMAN Protein ZGRF1 OS=Homo sapiens GN=ZGRF1 PE=2 SV=3 231 513 2.0E-21
sp|Q9HEH1|RENT1_NEUCR Regulator of nonsense transcripts 1 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=2E4.130 PE=3 SV=1 221 544 1.0E-20
sp|Q0VGT4|ZGRF1_MOUSE Protein ZGRF1 OS=Mus musculus GN=Zgrf1 PE=1 SV=2 232 512 2.0E-20
sp|O74465|HRR1_SCHPO Helicase required for RNAi-mediated heterochromatin assembly 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrr1 PE=1 SV=2 226 532 2.0E-20
sp|Q57568|Y104_METJA Uncharacterized ATP-dependent helicase MJ0104 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0104 PE=3 SV=1 60 512 2.0E-19
sp|O76512|RENT1_CAEEL Regulator of nonsense transcripts 1 OS=Caenorhabditis elegans GN=smg-2 PE=1 SV=1 235 517 5.0E-19
sp|Q9VYS3|RENT1_DROME Regulator of nonsense transcripts 1 homolog OS=Drosophila melanogaster GN=Upf1 PE=1 SV=2 225 517 7.0E-19
sp|O94247|HCS1_SCHPO DNA polymerase alpha-associated DNA helicase A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hcs1 PE=3 SV=1 44 512 2.0E-17
sp|P32644|ECM32_YEAST Putative ATP-dependent RNA helicase ECM32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM32 PE=1 SV=1 226 517 2.0E-16
sp|O94387|YGSA_SCHPO Uncharacterized ATP-dependent helicase C29A10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.10c PE=3 SV=1 54 512 3.0E-16
sp|Q98TR3|RENT1_TAKRU Putative regulator of nonsense transcripts 1 OS=Takifugu rubripes GN=rent1 PE=3 SV=1 221 544 1.0E-15
sp|Q7Z333|SETX_HUMAN Probable helicase senataxin OS=Homo sapiens GN=SETX PE=1 SV=4 54 512 5.0E-15
sp|Q92355|SEN1_SCHPO Helicase sen1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sen1 PE=1 SV=1 228 519 7.0E-15
sp|B6SFA4|MAA3_ARATH Probable helicase MAGATAMA 3 OS=Arabidopsis thaliana GN=MAA3 PE=2 SV=1 229 533 7.0E-14
sp|A2AKX3|SETX_MOUSE Probable helicase senataxin OS=Mus musculus GN=Setx PE=1 SV=1 54 512 8.0E-14
sp|Q86AS0|Y4399_DICDI Probable helicase DDB_G0274399 OS=Dictyostelium discoideum GN=DDB_G0274399 PE=3 SV=1 234 512 2.0E-13
sp|P38859|DNA2_YEAST DNA replication ATP-dependent helicase/nuclease DNA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNA2 PE=1 SV=1 263 533 1.0E-11
sp|P38935|SMBP2_HUMAN DNA-binding protein SMUBP-2 OS=Homo sapiens GN=IGHMBP2 PE=1 SV=3 226 530 1.0E-11
sp|Q60560|SMBP2_MESAU DNA-binding protein SMUBP-2 OS=Mesocricetus auratus GN=IGHMBP2 PE=1 SV=1 262 511 2.0E-11
sp|Q9EQN5|SMBP2_RAT DNA-binding protein SMUBP-2 OS=Rattus norvegicus GN=Ighmbp2 PE=1 SV=1 262 511 6.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0005524 ATP binding Yes
GO:0004386 helicase activity Yes
GO:0003677 DNA binding Yes
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0140657 ATP-dependent activity No
GO:0003676 nucleic acid binding No
GO:0030554 adenyl nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6916
MFLAASARQPTLKAQVETVKVSTYRPLNNGPYPTDEPRKNTVRFTPAQVEAIKSGSQPGLTIVVGPPGTGKTDVA
TQIIGNIYHDFPQQKTLLIAHSNQALNQLFAKIVALDIDERHLLRLGHGEEDLGTEGAHENSAETAGYFNEVYVQ
PAWSSFLQTETSENSTVGDLIKEFPFHGYFADAPQPLFPPEADRSAVLEIAHGCYRHISKIFSQLMDIVPFEVLR
RERDKANYLLTKEARIIAMTTTHAAMRRSETASLGFHYDNVIIEEAAQITEAETFLPLTMQKPINGEMKLQRVVL
CGDHLQNSPVIQSLAFRHYANLEQSLFSRLVRLGVPTITLDRQGRARPSIAKLYHWRYPKLGDLTEVQKESQYIQ
ANAGFRFDYQFINVPAYKGRGEVEPSPHFIQNLGEAEYAVAIYQYMRLLGYPADKISILTTYAGQRALVRDVLSH
RCAQNPIFGMPKAVSTVDKYQGEQNDYIILSLTRTSRVGYLRDVRRMTVAVSRARLGLYVLGRREVFEACPELRP
AFELLLQRPEKLMLVTGELWPTQRLCAHDESPIEGQVAMESVEHLGKYVFEMTQTKSKQLQEGRASVVENLTSIS
EEGQTASYEDGEQALEVDILEVDDADRA*
Coding >OphauB2|6916
ATGTTTCTGGCAGCTTCGGCCCGCCAGCCGACGCTCAAGGCCCAAGTCGAGACGGTCAAAGTTTCGACATACAGG
CCTCTCAACAACGGGCCGTATCCTACGGATGAGCCACGCAAGAATACGGTGCGCTTCACTCCTGCGCAGGTTGAG
GCAATCAAGTCTGGCTCGCAGCCAGGTCTCACCATCGTCGTCGGCCCCCCTGGGACGGGCAAGACAGATGTTGCT
ACGCAAATCATTGGCAACATATACCACGATTTTCCTCAGCAAAAGACCTTGTTAATAGCTCACAGCAACCAGGCA
TTGAACCAGCTCTTTGCCAAGATTGTTGCATTAGACATTGATGAGAGGCATTTGCTACGCTTGGGTCACGGAGAG
GAAGACCTTGGTACTGAAGGTGCCCATGAAAACTCGGCTGAAACTGCGGGCTACTTCAACGAGGTTTATGTGCAG
CCAGCATGGTCGAGTTTCCTACAAACCGAGACATCAGAAAACTCAACAGTGGGCGACCTGATCAAGGAATTTCCA
TTCCATGGCTACTTTGCCGATGCTCCTCAGCCTCTATTCCCGCCAGAGGCAGATCGTTCGGCCGTGTTGGAAATT
GCTCATGGCTGCTACCGCCACATCTCCAAGATCTTCTCGCAACTGATGGATATTGTACCTTTTGAGGTGCTGCGG
CGAGAGCGAGACAAAGCCAATTATCTGCTCACCAAAGAGGCTCGCATCATTGCCATGACGACGACACATGCTGCC
ATGAGGAGGAGTGAAACTGCCTCGCTCGGATTCCACTATGACAATGTCATAATCGAAGAAGCAGCACAAATCACT
GAAGCCGAGACATTTCTACCTCTGACGATGCAGAAGCCGATAAACGGCGAGATGAAGCTTCAGAGAGTGGTTCTG
TGCGGCGATCATCTACAAAACTCTCCCGTCATTCAAAGTCTGGCCTTTCGGCATTACGCGAATCTCGAGCAGTCC
TTGTTTTCGCGTCTTGTGCGCTTGGGAGTGCCAACAATTACCCTGGATCGTCAAGGCCGAGCTCGGCCATCAATT
GCCAAGCTTTATCACTGGCGATACCCCAAACTGGGGGACTTGACCGAGGTACAGAAAGAATCCCAATATATCCAG
GCCAATGCCGGCTTCAGATTCGACTACCAATTCATCAATGTCCCTGCATACAAGGGCCGCGGAGAAGTCGAACCG
TCTCCACACTTTATCCAGAACTTGGGCGAGGCTGAATACGCTGTCGCCATCTACCAATACATGCGGCTACTTGGT
TACCCTGCCGACAAGATTAGCATTCTGACTACATATGCTGGACAGCGAGCTCTGGTGAGGGATGTGCTCTCTCAT
AGGTGTGCCCAGAACCCTATTTTTGGTATGCCAAAGGCTGTCTCGACGGTAGACAAGTACCAAGGCGAGCAGAAT
GACTACATCATCCTCTCGCTAACGCGTACGTCGCGAGTGGGATACCTGCGCGATGTGCGGCGTATGACGGTGGCT
GTCTCGCGTGCCAGACTAGGGCTCTATGTCCTAGGCAGGCGTGAGGTCTTCGAGGCGTGTCCTGAGCTTCGGCCG
GCCTTTGAGTTGCTACTGCAAAGACCAGAGAAGCTGATGCTTGTGACGGGCGAGCTGTGGCCCACACAAAGACTC
TGCGCTCACGATGAATCACCGATAGAGGGGCAAGTGGCTATGGAAAGCGTGGAACATTTGGGAAAGTATGTCTTC
GAGATGACACAGACCAAGTCAAAGCAGCTGCAAGAGGGAAGAGCATCAGTAGTGGAAAACCTGACATCCATTTCT
GAAGAGGGACAGACGGCCAGCTATGAGGATGGCGAGCAAGCTTTGGAGGTAGATATATTGGAGGTGGATGACGCA
GACAGGGCATAG
Transcript >OphauB2|6916
ATGTTTCTGGCAGCTTCGGCCCGCCAGCCGACGCTCAAGGCCCAAGTCGAGACGGTCAAAGTTTCGACATACAGG
CCTCTCAACAACGGGCCGTATCCTACGGATGAGCCACGCAAGAATACGGTGCGCTTCACTCCTGCGCAGGTTGAG
GCAATCAAGTCTGGCTCGCAGCCAGGTCTCACCATCGTCGTCGGCCCCCCTGGGACGGGCAAGACAGATGTTGCT
ACGCAAATCATTGGCAACATATACCACGATTTTCCTCAGCAAAAGACCTTGTTAATAGCTCACAGCAACCAGGCA
TTGAACCAGCTCTTTGCCAAGATTGTTGCATTAGACATTGATGAGAGGCATTTGCTACGCTTGGGTCACGGAGAG
GAAGACCTTGGTACTGAAGGTGCCCATGAAAACTCGGCTGAAACTGCGGGCTACTTCAACGAGGTTTATGTGCAG
CCAGCATGGTCGAGTTTCCTACAAACCGAGACATCAGAAAACTCAACAGTGGGCGACCTGATCAAGGAATTTCCA
TTCCATGGCTACTTTGCCGATGCTCCTCAGCCTCTATTCCCGCCAGAGGCAGATCGTTCGGCCGTGTTGGAAATT
GCTCATGGCTGCTACCGCCACATCTCCAAGATCTTCTCGCAACTGATGGATATTGTACCTTTTGAGGTGCTGCGG
CGAGAGCGAGACAAAGCCAATTATCTGCTCACCAAAGAGGCTCGCATCATTGCCATGACGACGACACATGCTGCC
ATGAGGAGGAGTGAAACTGCCTCGCTCGGATTCCACTATGACAATGTCATAATCGAAGAAGCAGCACAAATCACT
GAAGCCGAGACATTTCTACCTCTGACGATGCAGAAGCCGATAAACGGCGAGATGAAGCTTCAGAGAGTGGTTCTG
TGCGGCGATCATCTACAAAACTCTCCCGTCATTCAAAGTCTGGCCTTTCGGCATTACGCGAATCTCGAGCAGTCC
TTGTTTTCGCGTCTTGTGCGCTTGGGAGTGCCAACAATTACCCTGGATCGTCAAGGCCGAGCTCGGCCATCAATT
GCCAAGCTTTATCACTGGCGATACCCCAAACTGGGGGACTTGACCGAGGTACAGAAAGAATCCCAATATATCCAG
GCCAATGCCGGCTTCAGATTCGACTACCAATTCATCAATGTCCCTGCATACAAGGGCCGCGGAGAAGTCGAACCG
TCTCCACACTTTATCCAGAACTTGGGCGAGGCTGAATACGCTGTCGCCATCTACCAATACATGCGGCTACTTGGT
TACCCTGCCGACAAGATTAGCATTCTGACTACATATGCTGGACAGCGAGCTCTGGTGAGGGATGTGCTCTCTCAT
AGGTGTGCCCAGAACCCTATTTTTGGTATGCCAAAGGCTGTCTCGACGGTAGACAAGTACCAAGGCGAGCAGAAT
GACTACATCATCCTCTCGCTAACGCGTACGTCGCGAGTGGGATACCTGCGCGATGTGCGGCGTATGACGGTGGCT
GTCTCGCGTGCCAGACTAGGGCTCTATGTCCTAGGCAGGCGTGAGGTCTTCGAGGCGTGTCCTGAGCTTCGGCCG
GCCTTTGAGTTGCTACTGCAAAGACCAGAGAAGCTGATGCTTGTGACGGGCGAGCTGTGGCCCACACAAAGACTC
TGCGCTCACGATGAATCACCGATAGAGGGGCAAGTGGCTATGGAAAGCGTGGAACATTTGGGAAAGTATGTCTTC
GAGATGACACAGACCAAGTCAAAGCAGCTGCAAGAGGGAAGAGCATCAGTAGTGGAAAACCTGACATCCATTTCT
GAAGAGGGACAGACGGCCAGCTATGAGGATGGCGAGCAAGCTTTGGAGGTAGATATATTGGAGGTGGATGACGCA
GACAGGGCATAG
Gene >OphauB2|6916
ATGTTTCTGGCAGCTTCGGCCCGCCGTATGTTTTGGAGGAAGTAAGCAATGCAGCAACATCAGGCGCTGTCAAGC
CGTCTAAAAAACGCCGACGGGATGCAGAGCCGACGCTCAAGGCCCAAGTCGAGACGGTCAAAGTTTCGACATACA
GGCCTCTCAACAACGGGCCGTATCCTACGGATGAGCCACGCAAGAATACGGTGCGCTTCACTCCTGCGCAGGTTG
AGGCAATCAAGTCTGGCTCGCAGCCAGGTCTCACCATCGTCGTCGGCCCCCCTGGGACGGGCAAGACAGATGTTG
CTACGCAAATCATTGGCAACATATACCACGATTTTCCTCAGCAAAAGACCTTGTTAATAGCTCACAGCAACCAGG
CATTGAACCAGCTCTTTGCCAAGATTGTTGCATTAGACATTGATGAGAGGCATTTGCTACGCTTGGGTCACGGAG
AGGAAGACCTTGGTACTGAAGGTAGCTTCAGCAAGCATGGCCGCATAGAATCTTTTTTCGAAAACCGGCAGCGAC
TGCTACTAGAAGTCAGAAGGCTCGCTGTGAGCCTCGCCGCACCAGGTGCCCATGAAAACTCGGCTGAAACTGCGG
GCTACTTCAACGAGGTTTATGTGCAGCCAGCATGGTCGAGTTTCCTACAAACCGAGACATCAGAAAACTCAACAG
TGGGCGACCTGATCAAGGAATTTCCATTCCATGGCTACTTTGCCGATGCTCCTCAGCCTCTATTCCCGCCAGAGG
CAGATCGTTCGGCCGTGTTGGAAATTGCTCATGGCTGCTACCGCCACATCTCCAAGATCTTCTCGCAACTGATGG
ATATTGTACCTTTTGAGGTGCTGCGGCGAGAGCGAGACAAAGCCAATTATCTGCTCACCAAAGAGGCTCGCATCA
TTGCCATGACGACGACACATGCTGCCATGAGGAGGAGTGAAACTGCCTCGCTCGGATTCCACTATGACAATGTCA
TAATCGAAGAAGCAGCACAAATCACTGAAGCCGAGACATTTCTACCTCTGACGATGCAGAAGCCGATAAACGGCG
AGATGAAGCTTCAGAGAGTGGTTCTGTGCGGCGATCATCTACAAAACTCTCCCGTCATTCAAAGTCTGGCCTTTC
GGCATTACGCGAATCTCGAGCAGTCCTTGTTTTCGCGTCTTGTGCGCTTGGGAGTGCCAACAATTACCCTGGATC
GTCAAGGCCGAGCTCGGCCATCAATTGCCAAGCTTTATCACTGGCGATACCCCAAACTGGGGGACTTGACCGAGG
TACAGAAAGAATCCCAATATATCCAGGCCAATGCCGGCTTCAGATTCGACTACCAATTCATCAATGTCCCTGCAT
ACAAGGGCCGCGGAGAAGTCGAACCGTCTCCACACTTTATCCAGAACTTGGGCGAGGCTGAATACGCTGTCGCCA
TCTACCAATACATGCGGCTACTTGGTTACCCTGCCGACAAGATTAGCATTCTGACTACATATGCTGGACAGCGAG
CTCTGGTGAGGGATGTGCTCTCTCATAGGTGTGCCCAGAACCCTATTTTTGGTATGCCAAAGGCTGTCTCGACGG
TAGACAAGTACCAAGGCGAGCAGAATGACTGTAGGTTGAATCACAGGCCCTGGGTCCCCATTTCTATTTAACAAG
CCACCTATCTGACTTTGCAAATGCTTTTCCAGACATCATCCTCTCGCTAACGCGTACGTCGCGAGTGGGATACCT
GCGCGATGTGCGGCGTATGACGGTGGCTGTCTCGCGTGCCAGACTAGGGCTCTATGTCCTAGGCAGGCGTGAGGT
CTTCGAGGCGTGTCCTGAGCTTCGGCCGGCCTTTGAGTTGCTACTGCAAAGACCAGAGAAGCTGATGCTTGTGAC
GGGCGAGCTGTGGCCCACACAAAGACTCTGCGCTCACGATGAATCACCGATAGAGGGGCAAGTGGCTATGGAAAG
CGTGGAACATTTGGGAAAGTATGTCTTCGAGATGACACAGACCAAGTCAAAGCAGCTGCAAGAGGGAAGAGCATC
AGTAGTGGAAAACCTGACATCCATTTCTGAAGAGGGACAGACGGCCAGCTATGAGGATGGCGAGCAAGCTTTGGA
GGTAGATATATTGGAGGTGGATGACGCAGACAGGGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail