Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6916
Gene name
LocationContig_69:20603..22743
Strand-
Gene length (bp)2140
Transcript length (bp)1887
Coding sequence length (bp)1887
Protein length (aa) 629

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13087 AAA_12 AAA domain 1.7E-27 322 514
PF13086 AAA_11 AAA domain 2.5E-22 48 313
PF13245 AAA_19 AAA domain 5.0E-06 48 307
PF04851 ResIII Type III restriction enzyme, res subunit 5.7E-05 57 108

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8CFQ3|AQR_MOUSE Intron-binding protein aquarius OS=Mus musculus GN=Aqr PE=1 SV=2 28 577 0.0E+00
sp|O60306|AQR_HUMAN Intron-binding protein aquarius OS=Homo sapiens GN=AQR PE=1 SV=4 28 604 0.0E+00
sp|O94508|CWF11_SCHPO Pre-mRNA-splicing factor cwf11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf11 PE=1 SV=1 37 581 3.0E-74
sp|Q8R151|ZNFX1_MOUSE NFX1-type zinc finger-containing protein 1 OS=Mus musculus GN=Znfx1 PE=1 SV=3 235 554 3.0E-31
sp|Q9P2E3|ZNFX1_HUMAN NFX1-type zinc finger-containing protein 1 OS=Homo sapiens GN=ZNFX1 PE=2 SV=2 235 554 1.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8CFQ3|AQR_MOUSE Intron-binding protein aquarius OS=Mus musculus GN=Aqr PE=1 SV=2 28 577 0.0E+00
sp|O60306|AQR_HUMAN Intron-binding protein aquarius OS=Homo sapiens GN=AQR PE=1 SV=4 28 604 0.0E+00
sp|O94508|CWF11_SCHPO Pre-mRNA-splicing factor cwf11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf11 PE=1 SV=1 37 581 3.0E-74
sp|Q8R151|ZNFX1_MOUSE NFX1-type zinc finger-containing protein 1 OS=Mus musculus GN=Znfx1 PE=1 SV=3 235 554 3.0E-31
sp|Q9P2E3|ZNFX1_HUMAN NFX1-type zinc finger-containing protein 1 OS=Homo sapiens GN=ZNFX1 PE=2 SV=2 235 554 1.0E-28
sp|Q9FJR0|RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana GN=UPF1 PE=1 SV=2 235 544 3.0E-26
sp|Q54I89|RENT1_DICDI Regulator of nonsense transcripts 1 OS=Dictyostelium discoideum GN=upf1 PE=3 SV=1 224 544 6.0E-24
sp|Q00416|SEN1_YEAST Helicase SEN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN1 PE=1 SV=2 36 514 4.0E-23
sp|P30771|NAM7_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM7 PE=1 SV=1 235 566 4.0E-22
sp|P34243|HCS1_YEAST DNA polymerase alpha-associated DNA helicase A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HCS1 PE=1 SV=1 44 520 1.0E-21
sp|Q09820|RENT1_SCHPO ATP-dependent helicase upf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=upf1 PE=3 SV=2 235 550 1.0E-21
sp|Q92900|RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens GN=UPF1 PE=1 SV=2 221 544 1.0E-21
sp|Q9EPU0|RENT1_MOUSE Regulator of nonsense transcripts 1 OS=Mus musculus GN=Upf1 PE=1 SV=2 221 544 2.0E-21
sp|Q86YA3|ZGRF1_HUMAN Protein ZGRF1 OS=Homo sapiens GN=ZGRF1 PE=2 SV=3 231 513 2.0E-21
sp|Q9HEH1|RENT1_NEUCR Regulator of nonsense transcripts 1 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=2E4.130 PE=3 SV=1 221 544 1.0E-20
sp|Q0VGT4|ZGRF1_MOUSE Protein ZGRF1 OS=Mus musculus GN=Zgrf1 PE=1 SV=2 232 512 2.0E-20
sp|O74465|HRR1_SCHPO Helicase required for RNAi-mediated heterochromatin assembly 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrr1 PE=1 SV=2 226 532 2.0E-20
sp|Q57568|Y104_METJA Uncharacterized ATP-dependent helicase MJ0104 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0104 PE=3 SV=1 60 512 2.0E-19
sp|O76512|RENT1_CAEEL Regulator of nonsense transcripts 1 OS=Caenorhabditis elegans GN=smg-2 PE=1 SV=1 235 517 5.0E-19
sp|Q9VYS3|RENT1_DROME Regulator of nonsense transcripts 1 homolog OS=Drosophila melanogaster GN=Upf1 PE=1 SV=2 225 517 7.0E-19
sp|O94247|HCS1_SCHPO DNA polymerase alpha-associated DNA helicase A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hcs1 PE=3 SV=1 44 512 2.0E-17
sp|P32644|ECM32_YEAST Putative ATP-dependent RNA helicase ECM32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM32 PE=1 SV=1 226 517 2.0E-16
sp|O94387|YGSA_SCHPO Uncharacterized ATP-dependent helicase C29A10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.10c PE=3 SV=1 54 512 3.0E-16
sp|Q98TR3|RENT1_TAKRU Putative regulator of nonsense transcripts 1 OS=Takifugu rubripes GN=rent1 PE=3 SV=1 221 544 1.0E-15
sp|Q7Z333|SETX_HUMAN Probable helicase senataxin OS=Homo sapiens GN=SETX PE=1 SV=4 54 512 5.0E-15
sp|Q92355|SEN1_SCHPO Helicase sen1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sen1 PE=1 SV=1 228 519 7.0E-15
sp|B6SFA4|MAA3_ARATH Probable helicase MAGATAMA 3 OS=Arabidopsis thaliana GN=MAA3 PE=2 SV=1 229 533 7.0E-14
sp|A2AKX3|SETX_MOUSE Probable helicase senataxin OS=Mus musculus GN=Setx PE=1 SV=1 54 512 8.0E-14
sp|Q86AS0|Y4399_DICDI Probable helicase DDB_G0274399 OS=Dictyostelium discoideum GN=DDB_G0274399 PE=3 SV=1 234 512 2.0E-13
sp|P38859|DNA2_YEAST DNA replication ATP-dependent helicase/nuclease DNA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNA2 PE=1 SV=1 263 533 1.0E-11
sp|P38935|SMBP2_HUMAN DNA-binding protein SMUBP-2 OS=Homo sapiens GN=IGHMBP2 PE=1 SV=3 226 530 1.0E-11
sp|Q60560|SMBP2_MESAU DNA-binding protein SMUBP-2 OS=Mesocricetus auratus GN=IGHMBP2 PE=1 SV=1 262 511 2.0E-11
sp|Q9EQN5|SMBP2_RAT DNA-binding protein SMUBP-2 OS=Rattus norvegicus GN=Ighmbp2 PE=1 SV=1 262 511 6.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0005524 ATP binding Yes
GO:0004386 helicase activity Yes
GO:0003677 DNA binding Yes
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0140657 ATP-dependent activity No
GO:0003676 nucleic acid binding No
GO:0030554 adenyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup765
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5491
Ophiocordyceps australis map64 (Brazil) OphauB2|6916 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6917
Ophiocordyceps camponoti-floridani Ophcf2|05676
Ophiocordyceps camponoti-rufipedis Ophun1|5022
Ophiocordyceps kimflemingae Ophio5|8233
Ophiocordyceps subramaniannii Hirsu2|2592
Ophiocordyceps subramaniannii Hirsu2|2593

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6916
MFLAASARQPTLKAQVETVKVSTYRPLNNGPYPTDEPRKNTVRFTPAQVEAIKSGSQPGLTIVVGPPGTGKTDVA
TQIIGNIYHDFPQQKTLLIAHSNQALNQLFAKIVALDIDERHLLRLGHGEEDLGTEGAHENSAETAGYFNEVYVQ
PAWSSFLQTETSENSTVGDLIKEFPFHGYFADAPQPLFPPEADRSAVLEIAHGCYRHISKIFSQLMDIVPFEVLR
RERDKANYLLTKEARIIAMTTTHAAMRRSETASLGFHYDNVIIEEAAQITEAETFLPLTMQKPINGEMKLQRVVL
CGDHLQNSPVIQSLAFRHYANLEQSLFSRLVRLGVPTITLDRQGRARPSIAKLYHWRYPKLGDLTEVQKESQYIQ
ANAGFRFDYQFINVPAYKGRGEVEPSPHFIQNLGEAEYAVAIYQYMRLLGYPADKISILTTYAGQRALVRDVLSH
RCAQNPIFGMPKAVSTVDKYQGEQNDYIILSLTRTSRVGYLRDVRRMTVAVSRARLGLYVLGRREVFEACPELRP
AFELLLQRPEKLMLVTGELWPTQRLCAHDESPIEGQVAMESVEHLGKYVFEMTQTKSKQLQEGRASVVENLTSIS
EEGQTASYEDGEQALEVDILEVDDADRA*
Coding >OphauB2|6916
ATGTTTCTGGCAGCTTCGGCCCGCCAGCCGACGCTCAAGGCCCAAGTCGAGACGGTCAAAGTTTCGACATACAGG
CCTCTCAACAACGGGCCGTATCCTACGGATGAGCCACGCAAGAATACGGTGCGCTTCACTCCTGCGCAGGTTGAG
GCAATCAAGTCTGGCTCGCAGCCAGGTCTCACCATCGTCGTCGGCCCCCCTGGGACGGGCAAGACAGATGTTGCT
ACGCAAATCATTGGCAACATATACCACGATTTTCCTCAGCAAAAGACCTTGTTAATAGCTCACAGCAACCAGGCA
TTGAACCAGCTCTTTGCCAAGATTGTTGCATTAGACATTGATGAGAGGCATTTGCTACGCTTGGGTCACGGAGAG
GAAGACCTTGGTACTGAAGGTGCCCATGAAAACTCGGCTGAAACTGCGGGCTACTTCAACGAGGTTTATGTGCAG
CCAGCATGGTCGAGTTTCCTACAAACCGAGACATCAGAAAACTCAACAGTGGGCGACCTGATCAAGGAATTTCCA
TTCCATGGCTACTTTGCCGATGCTCCTCAGCCTCTATTCCCGCCAGAGGCAGATCGTTCGGCCGTGTTGGAAATT
GCTCATGGCTGCTACCGCCACATCTCCAAGATCTTCTCGCAACTGATGGATATTGTACCTTTTGAGGTGCTGCGG
CGAGAGCGAGACAAAGCCAATTATCTGCTCACCAAAGAGGCTCGCATCATTGCCATGACGACGACACATGCTGCC
ATGAGGAGGAGTGAAACTGCCTCGCTCGGATTCCACTATGACAATGTCATAATCGAAGAAGCAGCACAAATCACT
GAAGCCGAGACATTTCTACCTCTGACGATGCAGAAGCCGATAAACGGCGAGATGAAGCTTCAGAGAGTGGTTCTG
TGCGGCGATCATCTACAAAACTCTCCCGTCATTCAAAGTCTGGCCTTTCGGCATTACGCGAATCTCGAGCAGTCC
TTGTTTTCGCGTCTTGTGCGCTTGGGAGTGCCAACAATTACCCTGGATCGTCAAGGCCGAGCTCGGCCATCAATT
GCCAAGCTTTATCACTGGCGATACCCCAAACTGGGGGACTTGACCGAGGTACAGAAAGAATCCCAATATATCCAG
GCCAATGCCGGCTTCAGATTCGACTACCAATTCATCAATGTCCCTGCATACAAGGGCCGCGGAGAAGTCGAACCG
TCTCCACACTTTATCCAGAACTTGGGCGAGGCTGAATACGCTGTCGCCATCTACCAATACATGCGGCTACTTGGT
TACCCTGCCGACAAGATTAGCATTCTGACTACATATGCTGGACAGCGAGCTCTGGTGAGGGATGTGCTCTCTCAT
AGGTGTGCCCAGAACCCTATTTTTGGTATGCCAAAGGCTGTCTCGACGGTAGACAAGTACCAAGGCGAGCAGAAT
GACTACATCATCCTCTCGCTAACGCGTACGTCGCGAGTGGGATACCTGCGCGATGTGCGGCGTATGACGGTGGCT
GTCTCGCGTGCCAGACTAGGGCTCTATGTCCTAGGCAGGCGTGAGGTCTTCGAGGCGTGTCCTGAGCTTCGGCCG
GCCTTTGAGTTGCTACTGCAAAGACCAGAGAAGCTGATGCTTGTGACGGGCGAGCTGTGGCCCACACAAAGACTC
TGCGCTCACGATGAATCACCGATAGAGGGGCAAGTGGCTATGGAAAGCGTGGAACATTTGGGAAAGTATGTCTTC
GAGATGACACAGACCAAGTCAAAGCAGCTGCAAGAGGGAAGAGCATCAGTAGTGGAAAACCTGACATCCATTTCT
GAAGAGGGACAGACGGCCAGCTATGAGGATGGCGAGCAAGCTTTGGAGGTAGATATATTGGAGGTGGATGACGCA
GACAGGGCATAG
Transcript >OphauB2|6916
ATGTTTCTGGCAGCTTCGGCCCGCCAGCCGACGCTCAAGGCCCAAGTCGAGACGGTCAAAGTTTCGACATACAGG
CCTCTCAACAACGGGCCGTATCCTACGGATGAGCCACGCAAGAATACGGTGCGCTTCACTCCTGCGCAGGTTGAG
GCAATCAAGTCTGGCTCGCAGCCAGGTCTCACCATCGTCGTCGGCCCCCCTGGGACGGGCAAGACAGATGTTGCT
ACGCAAATCATTGGCAACATATACCACGATTTTCCTCAGCAAAAGACCTTGTTAATAGCTCACAGCAACCAGGCA
TTGAACCAGCTCTTTGCCAAGATTGTTGCATTAGACATTGATGAGAGGCATTTGCTACGCTTGGGTCACGGAGAG
GAAGACCTTGGTACTGAAGGTGCCCATGAAAACTCGGCTGAAACTGCGGGCTACTTCAACGAGGTTTATGTGCAG
CCAGCATGGTCGAGTTTCCTACAAACCGAGACATCAGAAAACTCAACAGTGGGCGACCTGATCAAGGAATTTCCA
TTCCATGGCTACTTTGCCGATGCTCCTCAGCCTCTATTCCCGCCAGAGGCAGATCGTTCGGCCGTGTTGGAAATT
GCTCATGGCTGCTACCGCCACATCTCCAAGATCTTCTCGCAACTGATGGATATTGTACCTTTTGAGGTGCTGCGG
CGAGAGCGAGACAAAGCCAATTATCTGCTCACCAAAGAGGCTCGCATCATTGCCATGACGACGACACATGCTGCC
ATGAGGAGGAGTGAAACTGCCTCGCTCGGATTCCACTATGACAATGTCATAATCGAAGAAGCAGCACAAATCACT
GAAGCCGAGACATTTCTACCTCTGACGATGCAGAAGCCGATAAACGGCGAGATGAAGCTTCAGAGAGTGGTTCTG
TGCGGCGATCATCTACAAAACTCTCCCGTCATTCAAAGTCTGGCCTTTCGGCATTACGCGAATCTCGAGCAGTCC
TTGTTTTCGCGTCTTGTGCGCTTGGGAGTGCCAACAATTACCCTGGATCGTCAAGGCCGAGCTCGGCCATCAATT
GCCAAGCTTTATCACTGGCGATACCCCAAACTGGGGGACTTGACCGAGGTACAGAAAGAATCCCAATATATCCAG
GCCAATGCCGGCTTCAGATTCGACTACCAATTCATCAATGTCCCTGCATACAAGGGCCGCGGAGAAGTCGAACCG
TCTCCACACTTTATCCAGAACTTGGGCGAGGCTGAATACGCTGTCGCCATCTACCAATACATGCGGCTACTTGGT
TACCCTGCCGACAAGATTAGCATTCTGACTACATATGCTGGACAGCGAGCTCTGGTGAGGGATGTGCTCTCTCAT
AGGTGTGCCCAGAACCCTATTTTTGGTATGCCAAAGGCTGTCTCGACGGTAGACAAGTACCAAGGCGAGCAGAAT
GACTACATCATCCTCTCGCTAACGCGTACGTCGCGAGTGGGATACCTGCGCGATGTGCGGCGTATGACGGTGGCT
GTCTCGCGTGCCAGACTAGGGCTCTATGTCCTAGGCAGGCGTGAGGTCTTCGAGGCGTGTCCTGAGCTTCGGCCG
GCCTTTGAGTTGCTACTGCAAAGACCAGAGAAGCTGATGCTTGTGACGGGCGAGCTGTGGCCCACACAAAGACTC
TGCGCTCACGATGAATCACCGATAGAGGGGCAAGTGGCTATGGAAAGCGTGGAACATTTGGGAAAGTATGTCTTC
GAGATGACACAGACCAAGTCAAAGCAGCTGCAAGAGGGAAGAGCATCAGTAGTGGAAAACCTGACATCCATTTCT
GAAGAGGGACAGACGGCCAGCTATGAGGATGGCGAGCAAGCTTTGGAGGTAGATATATTGGAGGTGGATGACGCA
GACAGGGCATAG
Gene >OphauB2|6916
ATGTTTCTGGCAGCTTCGGCCCGCCGTATGTTTTGGAGGAAGTAAGCAATGCAGCAACATCAGGCGCTGTCAAGC
CGTCTAAAAAACGCCGACGGGATGCAGAGCCGACGCTCAAGGCCCAAGTCGAGACGGTCAAAGTTTCGACATACA
GGCCTCTCAACAACGGGCCGTATCCTACGGATGAGCCACGCAAGAATACGGTGCGCTTCACTCCTGCGCAGGTTG
AGGCAATCAAGTCTGGCTCGCAGCCAGGTCTCACCATCGTCGTCGGCCCCCCTGGGACGGGCAAGACAGATGTTG
CTACGCAAATCATTGGCAACATATACCACGATTTTCCTCAGCAAAAGACCTTGTTAATAGCTCACAGCAACCAGG
CATTGAACCAGCTCTTTGCCAAGATTGTTGCATTAGACATTGATGAGAGGCATTTGCTACGCTTGGGTCACGGAG
AGGAAGACCTTGGTACTGAAGGTAGCTTCAGCAAGCATGGCCGCATAGAATCTTTTTTCGAAAACCGGCAGCGAC
TGCTACTAGAAGTCAGAAGGCTCGCTGTGAGCCTCGCCGCACCAGGTGCCCATGAAAACTCGGCTGAAACTGCGG
GCTACTTCAACGAGGTTTATGTGCAGCCAGCATGGTCGAGTTTCCTACAAACCGAGACATCAGAAAACTCAACAG
TGGGCGACCTGATCAAGGAATTTCCATTCCATGGCTACTTTGCCGATGCTCCTCAGCCTCTATTCCCGCCAGAGG
CAGATCGTTCGGCCGTGTTGGAAATTGCTCATGGCTGCTACCGCCACATCTCCAAGATCTTCTCGCAACTGATGG
ATATTGTACCTTTTGAGGTGCTGCGGCGAGAGCGAGACAAAGCCAATTATCTGCTCACCAAAGAGGCTCGCATCA
TTGCCATGACGACGACACATGCTGCCATGAGGAGGAGTGAAACTGCCTCGCTCGGATTCCACTATGACAATGTCA
TAATCGAAGAAGCAGCACAAATCACTGAAGCCGAGACATTTCTACCTCTGACGATGCAGAAGCCGATAAACGGCG
AGATGAAGCTTCAGAGAGTGGTTCTGTGCGGCGATCATCTACAAAACTCTCCCGTCATTCAAAGTCTGGCCTTTC
GGCATTACGCGAATCTCGAGCAGTCCTTGTTTTCGCGTCTTGTGCGCTTGGGAGTGCCAACAATTACCCTGGATC
GTCAAGGCCGAGCTCGGCCATCAATTGCCAAGCTTTATCACTGGCGATACCCCAAACTGGGGGACTTGACCGAGG
TACAGAAAGAATCCCAATATATCCAGGCCAATGCCGGCTTCAGATTCGACTACCAATTCATCAATGTCCCTGCAT
ACAAGGGCCGCGGAGAAGTCGAACCGTCTCCACACTTTATCCAGAACTTGGGCGAGGCTGAATACGCTGTCGCCA
TCTACCAATACATGCGGCTACTTGGTTACCCTGCCGACAAGATTAGCATTCTGACTACATATGCTGGACAGCGAG
CTCTGGTGAGGGATGTGCTCTCTCATAGGTGTGCCCAGAACCCTATTTTTGGTATGCCAAAGGCTGTCTCGACGG
TAGACAAGTACCAAGGCGAGCAGAATGACTGTAGGTTGAATCACAGGCCCTGGGTCCCCATTTCTATTTAACAAG
CCACCTATCTGACTTTGCAAATGCTTTTCCAGACATCATCCTCTCGCTAACGCGTACGTCGCGAGTGGGATACCT
GCGCGATGTGCGGCGTATGACGGTGGCTGTCTCGCGTGCCAGACTAGGGCTCTATGTCCTAGGCAGGCGTGAGGT
CTTCGAGGCGTGTCCTGAGCTTCGGCCGGCCTTTGAGTTGCTACTGCAAAGACCAGAGAAGCTGATGCTTGTGAC
GGGCGAGCTGTGGCCCACACAAAGACTCTGCGCTCACGATGAATCACCGATAGAGGGGCAAGTGGCTATGGAAAG
CGTGGAACATTTGGGAAAGTATGTCTTCGAGATGACACAGACCAAGTCAAAGCAGCTGCAAGAGGGAAGAGCATC
AGTAGTGGAAAACCTGACATCCATTTCTGAAGAGGGACAGACGGCCAGCTATGAGGATGGCGAGCAAGCTTTGGA
GGTAGATATATTGGAGGTGGATGACGCAGACAGGGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail