Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6914
Gene name
LocationContig_69:8553..13206
Strand+
Gene length (bp)4653
Transcript length (bp)4401
Coding sequence length (bp)4401
Protein length (aa) 1467

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00136 DNA_pol_B DNA polymerase family B 3.8E-114 794 1228
PF08996 zf-DNA_Pol DNA Polymerase alpha zinc finger 1.4E-62 1271 1458
PF03104 DNA_pol_B_exo1 DNA polymerase family B, exonuclease domain 5.9E-34 378 715
PF12254 DNA_pol_alpha_N DNA polymerase alpha subunit p180 N terminal 2.1E-23 10 75

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P13382|DPOA_YEAST DNA polymerase alpha catalytic subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL1 PE=1 SV=2 341 1458 0.0E+00
sp|O89042|DPOLA_RAT DNA polymerase alpha catalytic subunit (Fragment) OS=Rattus norvegicus GN=Pola1 PE=2 SV=1 3 1422 0.0E+00
sp|Q9DE46|DPOLA_XENLA DNA polymerase alpha catalytic subunit OS=Xenopus laevis GN=pola1 PE=1 SV=1 27 1462 0.0E+00
sp|P09884|DPOLA_HUMAN DNA polymerase alpha catalytic subunit OS=Homo sapiens GN=POLA1 PE=1 SV=2 3 1459 0.0E+00
sp|P33609|DPOLA_MOUSE DNA polymerase alpha catalytic subunit OS=Mus musculus GN=Pola1 PE=1 SV=2 3 1459 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P13382|DPOA_YEAST DNA polymerase alpha catalytic subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL1 PE=1 SV=2 341 1458 0.0E+00
sp|O89042|DPOLA_RAT DNA polymerase alpha catalytic subunit (Fragment) OS=Rattus norvegicus GN=Pola1 PE=2 SV=1 3 1422 0.0E+00
sp|Q9DE46|DPOLA_XENLA DNA polymerase alpha catalytic subunit OS=Xenopus laevis GN=pola1 PE=1 SV=1 27 1462 0.0E+00
sp|P09884|DPOLA_HUMAN DNA polymerase alpha catalytic subunit OS=Homo sapiens GN=POLA1 PE=1 SV=2 3 1459 0.0E+00
sp|P33609|DPOLA_MOUSE DNA polymerase alpha catalytic subunit OS=Mus musculus GN=Pola1 PE=1 SV=2 3 1459 0.0E+00
sp|Q9FHA3|DPOLA_ARATH DNA polymerase alpha catalytic subunit OS=Arabidopsis thaliana GN=POLA PE=3 SV=2 5 1404 0.0E+00
sp|Q94636|DPOLA_STENO DNA polymerase alpha catalytic subunit OS=Sterkiella nova PE=3 SV=1 26 1459 0.0E+00
sp|O48653|DPOLA_ORYSJ DNA polymerase alpha catalytic subunit OS=Oryza sativa subsp. japonica GN=Os01g0868300 PE=2 SV=2 222 1457 0.0E+00
sp|Q27152|DPOLA_OXYTR DNA polymerase alpha catalytic subunit OS=Oxytricha trifallax PE=3 SV=1 347 1406 1.0E-170
sp|Q54SV8|DPOLA_DICDI DNA polymerase alpha catalytic subunit OS=Dictyostelium discoideum GN=pola1 PE=3 SV=1 347 1458 2.0E-161
sp|P26019|DPOLA_DROME DNA polymerase alpha catalytic subunit OS=Drosophila melanogaster GN=DNApol-alpha180 PE=1 SV=2 356 1425 3.0E-157
sp|O00874|DPOLA_LEIDO DNA polymerase alpha catalytic subunit OS=Leishmania donovani PE=3 SV=1 355 1370 8.0E-154
sp|P27727|DPOLA_TRYBB DNA polymerase alpha catalytic subunit OS=Trypanosoma brucei brucei PE=3 SV=1 321 1243 2.0E-139
sp|P30316|DPOD_SCHPO DNA polymerase delta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol3 PE=1 SV=2 482 1237 1.0E-50
sp|O29753|DPOL_ARCFU DNA polymerase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pol PE=3 SV=1 625 1244 2.0E-50
sp|Q56366|DPOL_THES9 DNA polymerase OS=Thermococcus sp. (strain 9oN-7) GN=pol PE=1 SV=1 624 1226 3.0E-48
sp|P56689|DPOL_THEGO DNA polymerase OS=Thermococcus gorgonarius GN=pol PE=1 SV=1 624 1226 8.0E-48
sp|Q54N97|DPOD1_DICDI DNA polymerase delta catalytic subunit OS=Dictyostelium discoideum GN=pold1 PE=3 SV=1 480 1232 6.0E-45
sp|P52431|DPOD1_MOUSE DNA polymerase delta catalytic subunit OS=Mus musculus GN=Pold1 PE=1 SV=2 492 1299 8.0E-45
sp|P52025|DPOL_METVO DNA polymerase OS=Methanococcus voltae GN=pol PE=3 SV=1 642 1244 8.0E-45
sp|P97283|DPOD1_MESAU DNA polymerase delta catalytic subunit OS=Mesocricetus auratus GN=POLD1 PE=2 SV=1 492 1299 4.0E-44
sp|P90829|DPOD1_CAEEL DNA polymerase delta catalytic subunit OS=Caenorhabditis elegans GN=F10C2.4 PE=3 SV=1 471 1237 6.0E-44
sp|Q9LRE6|DPOD1_ORYSJ DNA polymerase delta catalytic subunit OS=Oryza sativa subsp. japonica GN=POLD1 PE=2 SV=1 619 1237 9.0E-44
sp|O54747|DPOD1_RAT DNA polymerase delta catalytic subunit OS=Rattus norvegicus GN=Pold1 PE=2 SV=1 492 1299 1.0E-43
sp|P28339|DPOD1_BOVIN DNA polymerase delta catalytic subunit OS=Bos taurus GN=POLD1 PE=1 SV=1 619 1231 9.0E-43
sp|P46588|DPOD_CANAX DNA polymerase delta catalytic subunit OS=Candida albicans GN=POL3 PE=3 SV=2 497 1357 1.0E-42
sp|P61876|DPOL_PYRWO DNA polymerase OS=Pyrococcus woesei GN=pol PE=1 SV=1 624 1226 1.0E-42
sp|P61875|DPOL_PYRFU DNA polymerase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pol PE=1 SV=1 624 1226 1.0E-42
sp|P28340|DPOD1_HUMAN DNA polymerase delta catalytic subunit OS=Homo sapiens GN=POLD1 PE=1 SV=2 619 1231 2.0E-42
sp|Q7SIG7|DPOL_DESST DNA polymerase OS=Desulfurococcus sp. (strain Tok) GN=pol PE=1 SV=1 619 1226 3.0E-41
sp|P15436|DPOD_YEAST DNA polymerase delta catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL3 PE=1 SV=4 618 1300 6.0E-41
sp|Q9LVN7|DPOD1_ARATH DNA polymerase delta catalytic subunit OS=Arabidopsis thaliana GN=POLD1 PE=2 SV=2 619 1237 2.0E-40
sp|P54358|DPOD1_DROME DNA polymerase delta catalytic subunit OS=Drosophila melanogaster GN=DNApol-delta PE=2 SV=2 482 1357 4.0E-40
sp|O93746|DPOL2_AERPE DNA polymerase 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=polB PE=3 SV=3 618 1237 1.0E-39
sp|Q9HH06|DPOL_PYRGL DNA polymerase OS=Pyrococcus glycovorans GN=pol PE=3 SV=1 624 1226 2.0E-39
sp|P0CL77|DPOL_PYRAB DNA polymerase 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=polI PE=1 SV=1 624 1226 3.0E-39
sp|P0CL76|DPOL_PYRAY DNA polymerase 1 OS=Pyrococcus abyssi GN=polI PE=1 SV=1 624 1226 4.0E-39
sp|P30315|DPOD1_PLAFK DNA polymerase delta catalytic subunit OS=Plasmodium falciparum (isolate K1 / Thailand) GN=POLD1 PE=3 SV=1 451 1296 5.0E-39
sp|O48901|DPOD1_SOYBN DNA polymerase delta catalytic subunit OS=Glycine max GN=POLD1 PE=2 SV=1 828 1294 1.0E-37
sp|Q9DKT8|DPOL_ELHVK DNA polymerase catalytic subunit OS=Elephantid herpesvirus 1 (isolate Asian elephant/Berlin/Kiba/1998) PE=3 SV=1 624 1105 1.0E-32
sp|Q58295|DPOL_METJA DNA polymerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pol PE=3 SV=2 957 1244 6.0E-29
sp|O93745|DPOL1_AERPE DNA polymerase 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=polA PE=3 SV=2 837 1190 1.0E-28
sp|O71121|DPOL_RHCM6 DNA polymerase catalytic subunit OS=Rhesus cytomegalovirus (strain 68-1) GN=UL54 PE=3 SV=1 624 1187 4.0E-27
sp|P52367|DPOL_EHV2 DNA polymerase catalytic subunit OS=Equine herpesvirus 2 (strain 86/87) GN=9 PE=3 SV=1 624 1218 2.0E-26
sp|Q61493|DPOLZ_MOUSE DNA polymerase zeta catalytic subunit OS=Mus musculus GN=Rev3l PE=1 SV=3 845 1229 8.0E-26
sp|P52342|DPOL_HHV7J DNA polymerase catalytic subunit OS=Human herpesvirus 7 (strain JI) GN=U38 PE=3 SV=1 624 1186 7.0E-25
sp|P30321|DPOL_PBCV1 DNA polymerase OS=Paramecium bursaria Chlorella virus 1 GN=DPO PE=3 SV=2 496 1222 1.0E-24
sp|Q6UDK1|DPOL_PSHV1 DNA polymerase catalytic subunit OS=Psittacid herpesvirus 1 (isolate Amazon parrot/-/97-0001/1997) GN=UL30 PE=3 SV=1 834 1287 2.0E-24
sp|Q69025|DPOL_GPCMV DNA polymerase OS=Guinea pig cytomegalovirus (strain 22122) GN=UL54 PE=3 SV=3 624 1180 2.0E-24
sp|P24907|DPOL_SHV21 DNA polymerase catalytic subunit OS=Saimiriine herpesvirus 2 (strain 11) GN=9 PE=3 SV=1 624 1188 3.0E-24
sp|O60673|DPOLZ_HUMAN DNA polymerase zeta catalytic subunit OS=Homo sapiens GN=REV3L PE=1 SV=2 845 1229 6.0E-24
sp|P28858|DPOL_EHV1B DNA polymerase catalytic subunit OS=Equine herpesvirus 1 (strain Ab4p) GN=30 PE=3 SV=1 841 1187 7.0E-24
sp|P30320|DPOL_PBCVN DNA polymerase OS=Paramecium bursaria Chlorella virus NY2A GN=DPO PE=3 SV=1 840 1237 7.0E-24
sp|Q6S6P1|DPOL_EHV1V DNA polymerase catalytic subunit OS=Equine herpesvirus 1 (strain V592) GN=30 PE=3 SV=1 841 1187 1.0E-23
sp|Q766Z3|REV3_ARATH DNA polymerase zeta catalytic subunit OS=Arabidopsis thaliana GN=REV3 PE=2 SV=1 625 1289 2.0E-23
sp|O36363|DPOL_ALHV1 DNA polymerase catalytic subunit OS=Alcelaphine herpesvirus 1 (strain C500) GN=9 PE=3 SV=1 785 1180 3.0E-23
sp|Q1HVC1|DPOL_EBVA8 DNA polymerase catalytic subunit OS=Epstein-Barr virus (strain AG876) GN=BALF5 PE=3 SV=1 733 1181 3.0E-23
sp|Q3KSP1|DPOL_EBVG DNA polymerase catalytic subunit OS=Epstein-Barr virus (strain GD1) GN=BALF5 PE=3 SV=1 733 1181 3.0E-23
sp|Q2HRD0|DPOL_HHV8P DNA polymerase catalytic subunit OS=Human herpesvirus 8 type P (isolate GK18) GN=ORF9 PE=3 SV=1 624 1102 3.0E-23
sp|P03198|DPOL_EBVB9 DNA polymerase catalytic subunit OS=Epstein-Barr virus (strain B95-8) GN=BALF5 PE=1 SV=1 733 1181 4.0E-23
sp|P07917|DPOL_HHV1A DNA polymerase catalytic subunit OS=Human herpesvirus 1 (strain Angelotti) GN=UL30 PE=1 SV=1 841 1105 5.0E-23
sp|P04293|DPOL_HHV11 DNA polymerase catalytic subunit OS=Human herpesvirus 1 (strain 17) GN=UL30 PE=1 SV=2 841 1105 5.0E-23
sp|P21189|DPO2_ECOLI DNA polymerase II OS=Escherichia coli (strain K12) GN=polB PE=1 SV=2 619 1243 6.0E-23
sp|P09854|DPOL_HHV1S DNA polymerase catalytic subunit OS=Human herpesvirus 1 (strain SC16) GN=UL30 PE=3 SV=1 841 1105 1.0E-22
sp|P04292|DPOL_HHV1K DNA polymerase catalytic subunit OS=Human herpesvirus 1 (strain KOS) GN=UL30 PE=1 SV=1 841 1105 1.0E-22
sp|P28040|DPOA_SCHPO DNA polymerase alpha catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol1 PE=1 SV=1 3 155 6.0E-22
sp|P89453|DPOL_HHV2H DNA polymerase catalytic subunit OS=Human herpesvirus 2 (strain HG52) GN=UL30 PE=3 SV=1 841 1105 8.0E-22
sp|P07918|DPOL_HHV21 DNA polymerase catalytic subunit OS=Human herpesvirus 2 (strain 186) GN=UL30 PE=3 SV=1 841 1105 2.0E-21
sp|Q9QJ32|DPOL_HHV6Z DNA polymerase catalytic subunit OS=Human herpesvirus 6B (strain Z29) GN=U38 PE=3 SV=1 624 1143 6.0E-21
sp|P27172|DPOL_MUHVS DNA polymerase catalytic subunit OS=Murid herpesvirus 1 (strain Smith) GN=UL54 PE=3 SV=1 619 1213 1.0E-20
sp|Q85428|DPOL_RCMVM DNA polymerase catalytic subunit OS=Rat cytomegalovirus (strain Maastricht) GN=UL54 PE=3 SV=2 841 1201 2.0E-20
sp|P95690|DPOL1_SULAC DNA polymerase 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=dpo1 PE=1 SV=2 837 1179 3.0E-20
sp|Q9P6L6|DPOZ_SCHPO DNA polymerase zeta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rev3 PE=3 SV=1 845 1234 3.0E-20
sp|P28857|DPOL_HHV6U DNA polymerase catalytic subunit OS=Human herpesvirus 6A (strain Uganda-1102) GN=U38 PE=3 SV=1 811 1141 4.0E-20
sp|O27276|DPOL1_METTH DNA polymerase PolB subunit 1 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=polB1 PE=1 SV=1 768 1008 7.0E-20
sp|P09252|DPOL_VZVD DNA polymerase catalytic subunit OS=Varicella-zoster virus (strain Dumas) GN=ORF28 PE=3 SV=1 624 1150 2.0E-19
sp|O50607|DPOL1_SULOH DNA polymerase 1 OS=Sulfurisphaera ohwakuensis GN=pol-alpha PE=3 SV=1 837 1200 2.0E-19
sp|P08546|DPOL_HCMVA DNA polymerase catalytic subunit OS=Human cytomegalovirus (strain AD169) GN=UL54 PE=1 SV=2 841 1189 5.0E-19
sp|Q4JQU7|DPOL_VZVO DNA polymerase catalytic subunit OS=Varicella-zoster virus (strain Oka vaccine) GN=ORF28 PE=3 SV=1 624 1150 5.0E-19
sp|Q6SW77|DPOL_HCMVM DNA polymerase catalytic subunit OS=Human cytomegalovirus (strain Merlin) GN=UL54 PE=3 SV=1 841 1189 5.0E-19
sp|P14284|DPOZ_YEAST DNA polymerase zeta catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REV3 PE=1 SV=1 624 1241 5.0E-19
sp|P26811|DPOL1_SULSO DNA polymerase 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=dpo1 PE=1 SV=2 841 1179 8.0E-19
sp|O59610|DPOL_PYRHO DNA polymerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pol PE=3 SV=1 950 1226 2.0E-18
sp|Q9E6N9|DPOL_GAHVM DNA polymerase catalytic subunit OS=Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) GN=MDV043 PE=3 SV=1 832 1105 4.0E-18
sp|P77933|DPOL_THEKO DNA polymerase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pol PE=1 SV=3 970 1226 1.0E-17
sp|Q9HH05|DPOL_THEHY DNA polymerase (Fragment) OS=Thermococcus hydrothermalis GN=pol PE=1 SV=1 624 959 5.0E-17
sp|P30317|DPOL_THELI DNA polymerase OS=Thermococcus litoralis GN=pol PE=1 SV=1 624 959 1.0E-16
sp|O59610|DPOL_PYRHO DNA polymerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pol PE=3 SV=1 624 959 6.0E-16
sp|Q84173|DPOL_ORFN2 DNA polymerase OS=Orf virus (strain NZ2) GN=POL PE=3 SV=1 833 1101 6.0E-16
sp|O57191|DPOL_VACCA DNA polymerase OS=Vaccinia virus (strain Ankara) GN=POL PE=3 SV=1 841 1095 1.0E-15
sp|P20509|DPOL_VACCC DNA polymerase OS=Vaccinia virus (strain Copenhagen) GN=POL PE=3 SV=1 841 1095 1.0E-15
sp|P06856|DPOL_VACCW DNA polymerase OS=Vaccinia virus (strain Western Reserve) GN=POL PE=1 SV=5 841 1095 1.0E-15
sp|Q51334|DPOL_PYRSD DNA polymerase OS=Pyrococcus sp. (strain GB-D) GN=pol PE=1 SV=1 957 1226 2.0E-15
sp|P33793|DPOL_VAR67 DNA polymerase OS=Variola virus (isolate Human/India/Ind3/1967) GN=POL PE=3 SV=1 841 1095 4.0E-15
sp|Q9HH84|DPOL_THEG8 DNA polymerase OS=Thermococcus sp. (strain GE8) GN=pol PE=3 SV=1 624 959 1.0E-14
sp|O70736|DPOL_RSIV DNA polymerase OS=Red sea bream iridovirus PE=3 SV=1 909 1118 1.0E-14
sp|A7U6F2|DPOL_POV01 DNA polymerase OS=Pyramimonas orientalis virus GN=dpo PE=3 SV=1 834 1227 2.0E-14
sp|Q51334|DPOL_PYRSD DNA polymerase OS=Pyrococcus sp. (strain GB-D) GN=pol PE=1 SV=1 624 959 6.0E-14
sp|Q9HH05|DPOL_THEHY DNA polymerase (Fragment) OS=Thermococcus hydrothermalis GN=pol PE=1 SV=1 1025 1226 7.0E-14
sp|Q9HH84|DPOL_THEG8 DNA polymerase OS=Thermococcus sp. (strain GE8) GN=pol PE=3 SV=1 1025 1226 1.0E-13
sp|P74918|DPOL_THEFM DNA polymerase OS=Thermococcus fumicolans GN=pol PE=1 SV=1 1038 1226 1.0E-13
sp|Q4U3V0|DPOL_TNAVC DNA polymerase OS=Trichoplusia ni ascovirus 2c GN=ORF1 PE=3 SV=2 911 1127 5.0E-13
sp|O26310|DPOL2_METTH DNA polymerase PolB subunit 2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=polB2 PE=1 SV=1 1039 1229 1.0E-12
sp|P74918|DPOL_THEFM DNA polymerase OS=Thermococcus fumicolans GN=pol PE=1 SV=1 860 1066 5.0E-12
sp|Q9YUS3|DPOL_TUHV1 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus 1 (strain 1) GN=DPOL PE=3 SV=1 912 1202 6.0E-12
sp|Q9YUS2|DPOL_TUHV2 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus (strain 2) GN=DPOL PE=3 SV=1 912 1202 6.0E-12
sp|O33845|DPOL_THEAG DNA polymerase OS=Thermococcus aggregans GN=pol PE=3 SV=1 1025 1244 3.0E-11
sp|Q07635|DPOL2_SULSO DNA polymerase 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=dpo2 PE=3 SV=2 842 1030 1.0E-10
sp|P30317|DPOL_THELI DNA polymerase OS=Thermococcus litoralis GN=pol PE=1 SV=1 1025 1226 4.0E-10
sp|Q196U0|DPOL_IIV3 DNA polymerase 120R OS=Invertebrate iridescent virus 3 GN=IIV3-120R PE=3 SV=1 910 1164 6.0E-10
sp|P30318|DPOL_NPVLD DNA polymerase OS=Lymantria dispar multicapsid nuclear polyhedrosis virus GN=POL PE=3 SV=2 826 1021 7.0E-10
sp|A7U6F3|DPOL_PPV01 DNA polymerase OS=Phaeocystis pouchetii virus GN=dpo PE=3 SV=1 841 1043 1.0E-09
sp|Q6GZR5|DPOL_FRG3G Putative DNA polymerase 060R OS=Frog virus 3 (isolate Goorha) GN=FV3-060R PE=3 SV=1 906 1142 8.0E-09
sp|Q9QSK2|DPOL_IIV6 DNA polymerase 037L OS=Invertebrate iridescent virus 6 GN=DPOL PE=3 SV=1 910 1102 1.0E-08
sp|O48653|DPOLA_ORYSJ DNA polymerase alpha catalytic subunit OS=Oryza sativa subsp. japonica GN=Os01g0868300 PE=2 SV=2 8 94 2.0E-08
sp|A4KX57|DPOL_HVAVE DNA polymerase OS=Heliothis virescens ascovirus 3e GN=ORF1 PE=3 SV=1 909 1103 3.0E-08
sp|Q9YUS3|DPOL_TUHV1 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus 1 (strain 1) GN=DPOL PE=3 SV=1 618 911 5.0E-08
sp|A7U6F1|DPOL_CEV01 DNA polymerase OS=Chrysochromulina ericina virus GN=dpo PE=3 SV=1 841 1032 6.0E-08
sp|Q9YUS2|DPOL_TUHV2 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus (strain 2) GN=DPOL PE=3 SV=1 618 911 3.0E-07
sp|P95979|DPOL3_SULSO DNA polymerase 3 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=dpo3 PE=3 SV=1 683 1226 3.0E-07
sp|Q779J8|DPOL_SFAVA DNA polymerase OS=Spodoptera frugiperda ascovirus 1a GN=ORF1 PE=3 SV=1 909 1095 4.0E-07
sp|Q5UQR0|DPOL_MIMIV DNA polymerase OS=Acanthamoeba polyphaga mimivirus GN=POLB PE=3 SV=1 907 1006 8.0E-07
sp|P30319|DPOL_CBEPV DNA polymerase OS=Choristoneura biennis entomopoxvirus GN=POL PE=3 SV=1 839 1148 2.0E-06
sp|Q27152|DPOLA_OXYTR DNA polymerase alpha catalytic subunit OS=Oxytricha trifallax PE=3 SV=1 28 85 4.0E-06
sp|Q90162|DPOL_NPVCF DNA polymerase OS=Choristoneura fumiferana nuclear polyhedrosis virus GN=POL PE=3 SV=1 840 1062 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0006260 DNA replication Yes
GO:0003887 DNA-directed DNA polymerase activity Yes
GO:0000166 nucleotide binding Yes
GO:0003824 catalytic activity No
GO:0016779 nucleotidyltransferase activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0034061 DNA polymerase activity No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0140097 catalytic activity, acting on DNA No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0006725 cellular aromatic compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:1901363 heterocyclic compound binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006259 DNA metabolic process No
GO:0044237 cellular metabolic process No
GO:0036094 small molecule binding No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0003676 nucleic acid binding No
GO:0016740 transferase activity No
GO:0046483 heterocycle metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6914
MPKPSHRAQLAQLRALKQSGKKTFDVYQVDNAQDVYDEVDEDGYKKIVRNRLDQDDFVVDDNGEGYADDGREEWD
QVERHDDSDDSDAAPRAKRGKSSKDAKDDAVQEQAKRDATDRSISDYFGARGATKAQPKVKVAQTQEDVDFMAGI
LDDVDSAAGLAAPPPARRGGWNERRKPRDLSPAPQREVKRQKRLDTRVLSPQAPIKADYDDDGFVAPLDYDEDVV
MDDVMAVAEPNAQMKQEACQEDRAKDADQDKVKVKAEEEEEDDGLMEIAHAGAVEARSVNLTAIRPVQEAGKADL
RAATTKTEEDEAIDASSWNQVTEKLNVVSSSHGESRSIGKVDGKDVMEEDGSVKMFWIDFTEVNGSLCLFGKVLD
KKSKTYVSAFVKIDNMQRKLYFLPRGRGVGEGEESRDEVDMMDVCNEVDTLMSDMKVPVYKMKRCRRKYAFELAD
IPKEAEYLKLLYPYTQPIMDMNTKGKTFSHVFGTNTALFEEFVVWRKIMGPCWLRIGEANSEALKNASHCKVELL
VEKPESISVMSDSEGVEPPPLTLMSVALRTVWKARDNRHEVFAISARIYEHVQLGDTTAADKRPSRSFTVLRPSG
TGFPFGFEQLAKERGRGLIASKRSEAEVLAFFLAQVQVADPDVLLGHQLEGVDLSILLRRVHETKVPQWSRLGRL
RRSQWPWTVGKAGGSSAVGERSVLAGRLLCDLANEAGRAVLARCQTWALGEMCSLYLGSEVRRRDVDTAAALGSW
AQSRQGLLDLIGHAEADTHYIAALVLGVQLLPLTRVLTCLAGNSWARTLAGTRAERNDFILLHEFARNGFICPDR
PPPRSRHADEAKRDKFRGGLVFEPQKGLYDKFVLVMDFNSLYPSIIQEYNICFTTVDRSATATADDNKPDNDDDQ
APPVPPTQQQGILPRLIATLVSRRRQVKALIKTSKNASPQQLATWDIKQLALKLTANSMYGCLGYTRSRFYARPL
AVLTTHKGREILRCTKQLAESKSLQVIYGDTDSVMINANVDSVSAALAVAADFKKAVNEQYRLLEIDLDNVFRRI
LLQAKKKYAAISLVEADGKFVEHLEVKGLDMKRREFCALSKQVSKHLLDAILSGDDAELSLARIHDYLRDTADRM
RQHAVAMSSYIIYTQLGKEPNDYPNADSMPQVQVALRDIARGKTVRKGDVVSYVITGDAQSSLPAPKRAYSPADV
KADAALQPDVEWYLARQIFPPVERLCANIVGTSSTRLAQQLGLDLGRYATSSLARADAAQSADLDIYPLESQVPD
AVRFSACVRLCLRCPSCAHCEAFEGLVAAPHRVLPAGLVCPSCDALFPVLSLVAQMDHAIRVETSRYYEAWLVCD
DSQCANRTRQMSVYGTRCLGPKGLARDCLGRMRYEYGEKAIYTQLLYFASLWDVDRARASALDMPAPDRDKIFAL
AEHNRLRFGTLKSLVQGYLEKCGRQWVAMDTLFGKLGFNRS*
Coding >OphauB2|6914
ATGCCCAAGCCGTCTCATCGAGCCCAGCTGGCCCAGCTCAGGGCTCTCAAGCAGTCGGGCAAGAAGACTTTTGAC
GTCTACCAAGTAGACAATGCACAAGATGTCTACGATGAAGTAGACGAGGATGGATACAAGAAGATTGTGCGCAAT
CGTCTAGACCAAGACGACTTTGTGGTTGACGACAATGGCGAGGGATACGCCGACGATGGGCGCGAGGAATGGGAC
CAAGTCGAGCGGCATGATGACTCTGACGACAGCGACGCGGCGCCAAGGGCCAAGCGAGGCAAAAGCAGCAAAGAT
GCAAAAGACGATGCTGTGCAAGAGCAGGCAAAACGAGACGCCACGGACCGCTCCATCAGCGACTACTTTGGCGCA
AGAGGCGCGACCAAGGCACAGCCAAAAGTCAAGGTTGCGCAGACGCAGGAAGATGTCGATTTCATGGCGGGCATA
CTTGACGACGTCGACTCTGCGGCTGGCTTGGCAGCGCCGCCTCCAGCTCGACGTGGCGGATGGAACGAGCGTCGC
AAGCCAAGGGACCTTTCGCCTGCCCCTCAAAGAGAAGTCAAGAGACAGAAGCGGCTTGACACGCGCGTCTTGTCG
CCGCAAGCGCCCATCAAGGCAGATTATGACGATGATGGTTTTGTGGCGCCATTAGATTATGATGAAGATGTTGTC
ATGGACGATGTCATGGCTGTTGCCGAGCCCAATGCTCAGATGAAGCAAGAGGCTTGCCAGGAGGATCGAGCCAAG
GACGCAGACCAAGACAAGGTCAAGGTCAAGGCGGAAGAGGAAGAGGAAGATGACGGCTTGATGGAGATTGCCCAC
GCCGGCGCCGTGGAAGCACGCAGCGTCAACCTGACAGCGATTCGCCCCGTGCAAGAGGCTGGCAAAGCCGACTTG
CGAGCAGCAACAACAAAGACTGAAGAAGACGAGGCCATTGACGCCTCGTCGTGGAACCAAGTGACGGAGAAGCTC
AACGTGGTGAGCAGCAGCCATGGCGAGTCGAGGAGCATAGGCAAAGTGGATGGCAAGGATGTCATGGAAGAGGAC
GGCAGCGTCAAGATGTTTTGGATCGACTTTACCGAGGTCAATGGCAGCCTGTGCCTGTTTGGCAAGGTGTTGGAC
AAGAAGAGCAAGACATATGTGAGTGCTTTTGTCAAGATTGACAATATGCAGCGAAAGCTCTACTTTTTGCCGCGG
GGGCGAGGAGTGGGCGAGGGCGAGGAGAGCCGAGACGAGGTGGACATGATGGACGTGTGCAACGAAGTGGACACG
TTGATGAGCGACATGAAGGTGCCCGTGTACAAGATGAAGAGGTGTAGGCGCAAGTATGCCTTTGAGCTGGCCGAC
ATTCCCAAAGAGGCAGAGTATCTCAAGCTCTTGTATCCATATACGCAGCCCATCATGGACATGAATACAAAGGGC
AAAACGTTTAGCCACGTCTTTGGCACCAACACGGCCCTCTTTGAAGAGTTTGTGGTGTGGCGCAAAATCATGGGC
CCCTGCTGGCTGAGGATTGGCGAGGCCAACAGCGAGGCGCTCAAAAACGCATCGCACTGCAAGGTGGAACTCTTG
GTTGAAAAGCCCGAGTCGATATCAGTCATGAGCGACTCGGAGGGCGTCGAGCCACCGCCGCTGACGCTAATGAGC
GTGGCGCTGCGAACGGTGTGGAAGGCGAGAGACAACAGGCACGAGGTGTTTGCCATTAGCGCACGCATCTACGAG
CACGTACAACTCGGCGACACGACGGCGGCAGACAAGCGGCCCAGTCGCAGCTTCACGGTGCTGCGGCCAAGCGGG
ACGGGCTTCCCGTTTGGCTTTGAGCAGCTGGCCAAGGAACGGGGGCGCGGGCTGATTGCGAGCAAGCGGAGCGAG
GCCGAGGTGCTGGCCTTTTTCCTGGCGCAGGTGCAGGTGGCGGACCCGGATGTGCTGCTGGGCCACCAGCTCGAG
GGCGTGGACCTGAGCATCCTGCTGCGGCGCGTGCACGAGACCAAGGTGCCGCAGTGGTCGCGTCTGGGCCGGCTG
CGGCGCTCGCAGTGGCCGTGGACAGTGGGCAAGGCGGGCGGCAGCAGCGCCGTGGGGGAGCGCAGCGTGCTGGCG
GGCCGCCTGCTGTGCGACTTGGCCAACGAGGCGGGGCGGGCAGTGCTGGCGCGCTGCCAGACGTGGGCGCTGGGG
GAAATGTGCAGCCTGTACCTGGGCAGCGAGGTGCGCCGCCGCGACGTGGACACGGCGGCTGCACTGGGCTCGTGG
GCGCAGAGCCGCCAGGGCCTGCTGGATCTCATTGGCCACGCCGAGGCGGACACGCACTACATTGCCGCCCTGGTG
CTGGGCGTCCAACTGCTGCCGCTGACAAGGGTGCTCACGTGCCTGGCGGGAAACTCGTGGGCGCGCACGCTGGCG
GGCACGCGAGCCGAGCGCAACGACTTTATCCTGCTTCACGAGTTTGCCCGCAACGGCTTCATCTGCCCCGACCGG
CCGCCGCCGCGCTCCCGCCATGCCGACGAGGCCAAGCGCGACAAGTTTCGCGGCGGCCTCGTCTTTGAGCCGCAA
AAGGGGCTCTACGACAAGTTTGTCCTGGTCATGGACTTTAACTCGCTCTACCCCTCCATCATCCAAGAGTACAAT
ATCTGCTTCACCACTGTCGACCGCTCCGCCACCGCCACGGCCGACGACAACAAGCCCGACAACGACGACGACCAG
GCCCCGCCCGTGCCCCCGACGCAGCAACAGGGCATTCTCCCCCGCCTCATTGCCACGCTCGTCAGCCGTCGCCGC
CAGGTAAAGGCGCTCATCAAGACGAGCAAGAATGCCTCGCCCCAGCAGCTCGCCACCTGGGACATTAAGCAGCTG
GCCCTCAAGCTCACGGCAAACTCCATGTACGGCTGCCTCGGCTACACTCGCTCGCGCTTTTATGCCCGCCCGCTC
GCCGTGCTCACCACGCACAAGGGCCGCGAGATTTTGCGCTGCACCAAGCAGCTGGCCGAGAGCAAGTCGCTGCAA
GTCATTTACGGCGACACCGACTCCGTCATGATCAATGCCAATGTCGACTCGGTCAGCGCCGCCCTTGCCGTTGCC
GCCGACTTTAAAAAGGCTGTCAATGAGCAGTACCGCCTGCTCGAGATTGACCTGGACAATGTCTTTCGCCGCATC
CTGCTGCAGGCCAAGAAGAAGTACGCCGCCATTAGCCTGGTGGAGGCGGACGGCAAGTTTGTCGAGCACCTCGAG
GTCAAGGGGCTCGACATGAAGCGCCGCGAGTTTTGCGCCCTGTCCAAGCAAGTCTCCAAGCACCTCCTCGACGCC
ATTCTCTCGGGCGACGACGCCGAGCTGTCCCTTGCCCGCATCCACGACTACCTGCGCGACACGGCCGACAGGATG
CGCCAGCACGCCGTTGCCATGTCGAGCTACATTATTTACACCCAGCTGGGCAAGGAGCCCAACGACTACCCCAAT
GCCGACTCGATGCCCCAGGTCCAGGTGGCCCTGCGCGACATTGCCCGCGGCAAGACGGTGCGCAAGGGCGACGTG
GTCTCGTACGTCATTACAGGCGACGCCCAGAGCTCGCTGCCCGCCCCCAAGCGAGCCTATTCGCCCGCCGACGTC
AAGGCCGACGCTGCCCTGCAGCCCGATGTCGAGTGGTATCTGGCCCGCCAAATCTTTCCTCCCGTCGAGCGCCTC
TGCGCAAACATTGTCGGCACCTCGTCCACCCGGCTGGCCCAGCAGCTCGGCCTCGACCTGGGCCGCTATGCCACC
TCGAGTCTTGCCCGCGCCGACGCTGCCCAGTCTGCCGACTTGGACATTTACCCCCTCGAGTCGCAGGTGCCCGAT
GCCGTGCGCTTCAGCGCCTGTGTCCGCCTCTGCTTGCGCTGCCCCAGCTGCGCCCACTGCGAAGCCTTTGAGGGC
CTCGTCGCCGCCCCGCACCGCGTCTTGCCCGCCGGCCTCGTCTGCCCCAGCTGCGACGCCTTGTTTCCCGTCTTG
TCCCTCGTCGCCCAGATGGACCATGCCATTCGCGTCGAGACGTCGCGCTACTACGAGGCTTGGCTCGTTTGCGAC
GACTCGCAGTGCGCAAACCGCACGCGCCAAATGAGCGTCTATGGCACCCGCTGCCTCGGCCCCAAGGGCCTTGCC
CGCGACTGCCTGGGCCGCATGCGCTACGAGTATGGCGAAAAGGCAATCTACACCCAGCTCCTCTACTTTGCCTCG
TTGTGGGACGTGGATCGCGCCCGTGCTAGTGCCCTCGACATGCCCGCCCCTGACCGCGACAAGATTTTCGCCTTG
GCAGAGCACAACCGCCTGCGCTTTGGCACCCTCAAATCCCTTGTCCAGGGCTACTTGGAAAAGTGCGGCAGACAG
TGGGTCGCCATGGACACCCTCTTTGGCAAGCTTGGCTTCAACCGCTCCTGA
Transcript >OphauB2|6914
ATGCCCAAGCCGTCTCATCGAGCCCAGCTGGCCCAGCTCAGGGCTCTCAAGCAGTCGGGCAAGAAGACTTTTGAC
GTCTACCAAGTAGACAATGCACAAGATGTCTACGATGAAGTAGACGAGGATGGATACAAGAAGATTGTGCGCAAT
CGTCTAGACCAAGACGACTTTGTGGTTGACGACAATGGCGAGGGATACGCCGACGATGGGCGCGAGGAATGGGAC
CAAGTCGAGCGGCATGATGACTCTGACGACAGCGACGCGGCGCCAAGGGCCAAGCGAGGCAAAAGCAGCAAAGAT
GCAAAAGACGATGCTGTGCAAGAGCAGGCAAAACGAGACGCCACGGACCGCTCCATCAGCGACTACTTTGGCGCA
AGAGGCGCGACCAAGGCACAGCCAAAAGTCAAGGTTGCGCAGACGCAGGAAGATGTCGATTTCATGGCGGGCATA
CTTGACGACGTCGACTCTGCGGCTGGCTTGGCAGCGCCGCCTCCAGCTCGACGTGGCGGATGGAACGAGCGTCGC
AAGCCAAGGGACCTTTCGCCTGCCCCTCAAAGAGAAGTCAAGAGACAGAAGCGGCTTGACACGCGCGTCTTGTCG
CCGCAAGCGCCCATCAAGGCAGATTATGACGATGATGGTTTTGTGGCGCCATTAGATTATGATGAAGATGTTGTC
ATGGACGATGTCATGGCTGTTGCCGAGCCCAATGCTCAGATGAAGCAAGAGGCTTGCCAGGAGGATCGAGCCAAG
GACGCAGACCAAGACAAGGTCAAGGTCAAGGCGGAAGAGGAAGAGGAAGATGACGGCTTGATGGAGATTGCCCAC
GCCGGCGCCGTGGAAGCACGCAGCGTCAACCTGACAGCGATTCGCCCCGTGCAAGAGGCTGGCAAAGCCGACTTG
CGAGCAGCAACAACAAAGACTGAAGAAGACGAGGCCATTGACGCCTCGTCGTGGAACCAAGTGACGGAGAAGCTC
AACGTGGTGAGCAGCAGCCATGGCGAGTCGAGGAGCATAGGCAAAGTGGATGGCAAGGATGTCATGGAAGAGGAC
GGCAGCGTCAAGATGTTTTGGATCGACTTTACCGAGGTCAATGGCAGCCTGTGCCTGTTTGGCAAGGTGTTGGAC
AAGAAGAGCAAGACATATGTGAGTGCTTTTGTCAAGATTGACAATATGCAGCGAAAGCTCTACTTTTTGCCGCGG
GGGCGAGGAGTGGGCGAGGGCGAGGAGAGCCGAGACGAGGTGGACATGATGGACGTGTGCAACGAAGTGGACACG
TTGATGAGCGACATGAAGGTGCCCGTGTACAAGATGAAGAGGTGTAGGCGCAAGTATGCCTTTGAGCTGGCCGAC
ATTCCCAAAGAGGCAGAGTATCTCAAGCTCTTGTATCCATATACGCAGCCCATCATGGACATGAATACAAAGGGC
AAAACGTTTAGCCACGTCTTTGGCACCAACACGGCCCTCTTTGAAGAGTTTGTGGTGTGGCGCAAAATCATGGGC
CCCTGCTGGCTGAGGATTGGCGAGGCCAACAGCGAGGCGCTCAAAAACGCATCGCACTGCAAGGTGGAACTCTTG
GTTGAAAAGCCCGAGTCGATATCAGTCATGAGCGACTCGGAGGGCGTCGAGCCACCGCCGCTGACGCTAATGAGC
GTGGCGCTGCGAACGGTGTGGAAGGCGAGAGACAACAGGCACGAGGTGTTTGCCATTAGCGCACGCATCTACGAG
CACGTACAACTCGGCGACACGACGGCGGCAGACAAGCGGCCCAGTCGCAGCTTCACGGTGCTGCGGCCAAGCGGG
ACGGGCTTCCCGTTTGGCTTTGAGCAGCTGGCCAAGGAACGGGGGCGCGGGCTGATTGCGAGCAAGCGGAGCGAG
GCCGAGGTGCTGGCCTTTTTCCTGGCGCAGGTGCAGGTGGCGGACCCGGATGTGCTGCTGGGCCACCAGCTCGAG
GGCGTGGACCTGAGCATCCTGCTGCGGCGCGTGCACGAGACCAAGGTGCCGCAGTGGTCGCGTCTGGGCCGGCTG
CGGCGCTCGCAGTGGCCGTGGACAGTGGGCAAGGCGGGCGGCAGCAGCGCCGTGGGGGAGCGCAGCGTGCTGGCG
GGCCGCCTGCTGTGCGACTTGGCCAACGAGGCGGGGCGGGCAGTGCTGGCGCGCTGCCAGACGTGGGCGCTGGGG
GAAATGTGCAGCCTGTACCTGGGCAGCGAGGTGCGCCGCCGCGACGTGGACACGGCGGCTGCACTGGGCTCGTGG
GCGCAGAGCCGCCAGGGCCTGCTGGATCTCATTGGCCACGCCGAGGCGGACACGCACTACATTGCCGCCCTGGTG
CTGGGCGTCCAACTGCTGCCGCTGACAAGGGTGCTCACGTGCCTGGCGGGAAACTCGTGGGCGCGCACGCTGGCG
GGCACGCGAGCCGAGCGCAACGACTTTATCCTGCTTCACGAGTTTGCCCGCAACGGCTTCATCTGCCCCGACCGG
CCGCCGCCGCGCTCCCGCCATGCCGACGAGGCCAAGCGCGACAAGTTTCGCGGCGGCCTCGTCTTTGAGCCGCAA
AAGGGGCTCTACGACAAGTTTGTCCTGGTCATGGACTTTAACTCGCTCTACCCCTCCATCATCCAAGAGTACAAT
ATCTGCTTCACCACTGTCGACCGCTCCGCCACCGCCACGGCCGACGACAACAAGCCCGACAACGACGACGACCAG
GCCCCGCCCGTGCCCCCGACGCAGCAACAGGGCATTCTCCCCCGCCTCATTGCCACGCTCGTCAGCCGTCGCCGC
CAGGTAAAGGCGCTCATCAAGACGAGCAAGAATGCCTCGCCCCAGCAGCTCGCCACCTGGGACATTAAGCAGCTG
GCCCTCAAGCTCACGGCAAACTCCATGTACGGCTGCCTCGGCTACACTCGCTCGCGCTTTTATGCCCGCCCGCTC
GCCGTGCTCACCACGCACAAGGGCCGCGAGATTTTGCGCTGCACCAAGCAGCTGGCCGAGAGCAAGTCGCTGCAA
GTCATTTACGGCGACACCGACTCCGTCATGATCAATGCCAATGTCGACTCGGTCAGCGCCGCCCTTGCCGTTGCC
GCCGACTTTAAAAAGGCTGTCAATGAGCAGTACCGCCTGCTCGAGATTGACCTGGACAATGTCTTTCGCCGCATC
CTGCTGCAGGCCAAGAAGAAGTACGCCGCCATTAGCCTGGTGGAGGCGGACGGCAAGTTTGTCGAGCACCTCGAG
GTCAAGGGGCTCGACATGAAGCGCCGCGAGTTTTGCGCCCTGTCCAAGCAAGTCTCCAAGCACCTCCTCGACGCC
ATTCTCTCGGGCGACGACGCCGAGCTGTCCCTTGCCCGCATCCACGACTACCTGCGCGACACGGCCGACAGGATG
CGCCAGCACGCCGTTGCCATGTCGAGCTACATTATTTACACCCAGCTGGGCAAGGAGCCCAACGACTACCCCAAT
GCCGACTCGATGCCCCAGGTCCAGGTGGCCCTGCGCGACATTGCCCGCGGCAAGACGGTGCGCAAGGGCGACGTG
GTCTCGTACGTCATTACAGGCGACGCCCAGAGCTCGCTGCCCGCCCCCAAGCGAGCCTATTCGCCCGCCGACGTC
AAGGCCGACGCTGCCCTGCAGCCCGATGTCGAGTGGTATCTGGCCCGCCAAATCTTTCCTCCCGTCGAGCGCCTC
TGCGCAAACATTGTCGGCACCTCGTCCACCCGGCTGGCCCAGCAGCTCGGCCTCGACCTGGGCCGCTATGCCACC
TCGAGTCTTGCCCGCGCCGACGCTGCCCAGTCTGCCGACTTGGACATTTACCCCCTCGAGTCGCAGGTGCCCGAT
GCCGTGCGCTTCAGCGCCTGTGTCCGCCTCTGCTTGCGCTGCCCCAGCTGCGCCCACTGCGAAGCCTTTGAGGGC
CTCGTCGCCGCCCCGCACCGCGTCTTGCCCGCCGGCCTCGTCTGCCCCAGCTGCGACGCCTTGTTTCCCGTCTTG
TCCCTCGTCGCCCAGATGGACCATGCCATTCGCGTCGAGACGTCGCGCTACTACGAGGCTTGGCTCGTTTGCGAC
GACTCGCAGTGCGCAAACCGCACGCGCCAAATGAGCGTCTATGGCACCCGCTGCCTCGGCCCCAAGGGCCTTGCC
CGCGACTGCCTGGGCCGCATGCGCTACGAGTATGGCGAAAAGGCAATCTACACCCAGCTCCTCTACTTTGCCTCG
TTGTGGGACGTGGATCGCGCCCGTGCTAGTGCCCTCGACATGCCCGCCCCTGACCGCGACAAGATTTTCGCCTTG
GCAGAGCACAACCGCCTGCGCTTTGGCACCCTCAAATCCCTTGTCCAGGGCTACTTGGAAAAGTGCGGCAGACAG
TGGGTCGCCATGGACACCCTCTTTGGCAAGCTTGGCTTCAACCGCTCCTGA
Gene >OphauB2|6914
ATGCCCAAGCCGTCTCATCGAGCCCAGCTGGCCCAGCTCAGGGCTCTCAAGCAGTCGGGCAAGAAGACTTTTGAC
GTCTACCAAGTAGACAATGCACAAGATGTCTACGATGAAGTAGACGAGGATGGATACAAGAAGATTGTGCGCAAT
CGTCTAGACCAAGACGACTTTGTGGTTGACGACAATGGCGAGGGATACGCCGACGATGGGCGCGAGGAATGGGAC
CAAGTCGAGCGGCATGATGACTCTGACGACAGCGACGCGGCGCCAAGGGCCAAGCGAGGCAAAAGCAGCAAAGAT
GGTTTGTTGGAGTCCGGGACCATTTTGGTGAATGCGGCACGTGCTGACAAGATGGCGTAGCAAAAGACGATGCTG
TGCAAGAGCAGGCAAAACGAGACGCCACGGACCGCTCCATCAGCGACTACTTTGGCGCAAGAGGCGCGACCAAGG
CACAGCCAAAAGTCAAGGTAATCCTTTGCTGGTCTGGCTCCTTGTGGAGCATGTGGCTCATTGGATTGTAATGCA
GGTTGCGCAGACGCAGGAAGATGTCGATTTCATGGCGGGCATACTTGACGACGTCGACTCTGCGGCTGGCTTGGC
AGCGCCGCCTCCAGCTCGACGTGGCGGATGGAACGAGCGTCGCAAGCCAAGGGACCTTTCGCCTGCCCCTCAAAG
AGAAGTCAAGAGACAGAAGCGGCTTGACACGCGCGTCTTGTCGCCGCAAGCGCCCATCAAGGCAGATTATGACGA
TGATGGTTTTGTGGCGCCATTAGATTATGATGAAGATGTTGTCATGGACGATGTCATGGCTGTTGCCGAGCCCAA
TGCTCAGATGAAGCAAGAGGCTTGCCAGGAGGATCGAGCCAAGGACGCAGACCAAGACAAGGTCAAGGTCAAGGC
GGAAGAGGAAGAGGAAGATGACGGCTTGATGGAGATTGCCCACGCCGGCGCCGTGGAAGCACGCAGCGTCAACCT
GACAGCGATTCGCCCCGTGCAAGAGGCTGGCAAAGCCGACTTGCGAGCAGCAACAACAAAGACTGAAGAAGACGA
GGCCATTGACGCCTCGTCGTGGAACCAAGTGACGGAGAAGCTCAACGTGGTGAGCAGCAGCCATGGCGAGTCGAG
GAGCATAGGCAAAGTGGATGGCAAGGATGTCATGGAAGAGGACGGCAGCGTCAAGATGTTTTGGATCGACTTTAC
CGAGGTCAATGGCAGCCTGTGCCTGTTTGGCAAGGTGTTGGACAAGAAGAGCAAGACATATGTGAGTGCTTTTGT
CAAGATTGACAATATGCAGCGAAAGCTCTACTTTTTGCCGCGGGGGCGAGGAGTGGGCGAGGGCGAGGAGAGCCG
AGACGAGGTGGACATGATGGACGTGTGCAACGAAGTGGACACGTTGATGAGCGACATGAAGGTGCCCGTGTACAA
GATGAAGAGGTGTAGGCGCAAGTATGCCTTTGAGCTGGCCGACATTCCCAAAGAGGCAGAGTATCTCAAGCTCTT
GTATCCATATACGCGTGAGTCTTTTTTTTTTTTTCCCTTGTCCCTCACATTGTCTTCATCTGTCTCGTTTCTACA
GTCTCATCATGGCCTTGTCGCTTTCAATCATTTTACTCATTGTTTGGCTAACCGGCCCCCCCCCCCCCTATAGAG
CCCATCATGGACATGAATACAAAGGGCAAAACGTTTAGCCACGTCTTTGGCACCAACACGGCCCTCTTTGAAGAG
TTTGTGGTGTGGCGCAAAATCATGGGCCCCTGCTGGCTGAGGATTGGCGAGGCCAACAGCGAGGCGCTCAAAAAC
GCATCGCACTGCAAGGTGGAACTCTTGGTTGAAAAGCCCGAGTCGATATCAGTCATGAGCGACTCGGAGGGCGTC
GAGCCACCGCCGCTGACGCTAATGAGCGTGGCGCTGCGAACGGTGTGGAAGGCGAGAGACAACAGGCACGAGGTG
TTTGCCATTAGCGCACGCATCTACGAGCACGTACAACTCGGCGACACGACGGCGGCAGACAAGCGGCCCAGTCGC
AGCTTCACGGTGCTGCGGCCAAGCGGGACGGGCTTCCCGTTTGGCTTTGAGCAGCTGGCCAAGGAACGGGGGCGC
GGGCTGATTGCGAGCAAGCGGAGCGAGGCCGAGGTGCTGGCCTTTTTCCTGGCGCAGGTGCAGGTGGCGGACCCG
GATGTGCTGCTGGGCCACCAGCTCGAGGGCGTGGACCTGAGCATCCTGCTGCGGCGCGTGCACGAGACCAAGGTG
CCGCAGTGGTCGCGTCTGGGCCGGCTGCGGCGCTCGCAGTGGCCGTGGACAGTGGGCAAGGCGGGCGGCAGCAGC
GCCGTGGGGGAGCGCAGCGTGCTGGCGGGCCGCCTGCTGTGCGACTTGGCCAACGAGGCGGGGCGGGCAGTGCTG
GCGCGCTGCCAGACGTGGGCGCTGGGGGAAATGTGCAGCCTGTACCTGGGCAGCGAGGTGCGCCGCCGCGACGTG
GACACGGCGGCTGCACTGGGCTCGTGGGCGCAGAGCCGCCAGGGCCTGCTGGATCTCATTGGCCACGCCGAGGCG
GACACGCACTACATTGCCGCCCTGGTGCTGGGCGTCCAACTGCTGCCGCTGACAAGGGTGCTCACGTGCCTGGCG
GGAAACTCGTGGGCGCGCACGCTGGCGGGCACGCGAGCCGAGCGCAACGACTTTATCCTGCTTCACGAGTTTGCC
CGCAACGGCTTCATCTGCCCCGACCGGCCGCCGCCGCGCTCCCGCCATGCCGACGAGGCCAAGCGCGACAAGTTT
CGCGGCGGCCTCGTCTTTGAGCCGCAAAAGGGGCTCTACGACAAGTTTGTCCTGGTCATGGACTTTAACTCGCTC
TACCCCTCCATCATCCAAGAGTACAATATCTGCTTCACCACTGTCGACCGCTCCGCCACCGCCACGGCCGACGAC
AACAAGCCCGACAACGACGACGACCAGGCCCCGCCCGTGCCCCCGACGCAGCAACAGGGCATTCTCCCCCGCCTC
ATTGCCACGCTCGTCAGCCGTCGCCGCCAGGTAAAGGCGCTCATCAAGACGAGCAAGAATGCCTCGCCCCAGCAG
CTCGCCACCTGGGACATTAAGCAGCTGGCCCTCAAGCTCACGGCAAACTCCATGTACGGCTGCCTCGGCTACACT
CGCTCGCGCTTTTATGCCCGCCCGCTCGCCGTGCTCACCACGCACAAGGGCCGCGAGATTTTGCGCTGCACCAAG
CAGCTGGCCGAGAGCAAGTCGCTGCAAGTCATTTACGGCGACACCGACTCCGTCATGATCAATGCCAATGTCGAC
TCGGTCAGCGCCGCCCTTGCCGTTGCCGCCGACTTTAAAAAGGCTGTCAATGAGCAGTACCGCCTGCTCGAGATT
GACCTGGACAATGTCTTTCGCCGCATCCTGCTGCAGGCCAAGAAGAAGTACGCCGCCATTAGCCTGGTGGAGGCG
GACGGCAAGTTTGTCGAGCACCTCGAGGTCAAGGGGCTCGACATGAAGCGCCGCGAGTTTTGCGCCCTGTCCAAG
CAAGTCTCCAAGCACCTCCTCGACGCCATTCTCTCGGGCGACGACGCCGAGCTGTCCCTTGCCCGCATCCACGAC
TACCTGCGCGACACGGCCGACAGGATGCGCCAGCACGCCGTTGCCATGTCGAGCTACATTATTTACACCCAGCTG
GGCAAGGAGCCCAACGACTACCCCAATGCCGACTCGATGCCCCAGGTCCAGGTGGCCCTGCGCGACATTGCCCGC
GGCAAGACGGTGCGCAAGGGCGACGTGGTCTCGTACGTCATTACAGGCGACGCCCAGAGCTCGCTGCCCGCCCCC
AAGCGAGCCTATTCGCCCGCCGACGTCAAGGCCGACGCTGCCCTGCAGCCCGATGTCGAGTGGTATCTGGCCCGC
CAAATCTTTCCTCCCGTCGAGCGCCTCTGCGCAAACATTGTCGGCACCTCGTCCACCCGGCTGGCCCAGCAGCTC
GGCCTCGACCTGGGCCGCTATGCCACCTCGAGTCTTGCCCGCGCCGACGCTGCCCAGTCTGCCGACTTGGACATT
TACCCCCTCGAGTCGCAGGTGCCCGATGCCGTGCGCTTCAGCGCCTGTGTCCGCCTCTGCTTGCGCTGCCCCAGC
TGCGCCCACTGCGAAGCCTTTGAGGGCCTCGTCGCCGCCCCGCACCGCGTCTTGCCCGCCGGCCTCGTCTGCCCC
AGCTGCGACGCCTTGTTTCCCGTCTTGTCCCTCGTCGCCCAGATGGACCATGCCATTCGCGTCGAGACGTCGCGC
TACTACGAGGCTTGGCTCGTTTGCGACGACTCGCAGTGCGCAAACCGCACGCGCCAAATGAGCGTCTATGGCACC
CGCTGCCTCGGCCCCAAGGGCCTTGCCCGCGACTGCCTGGGCCGCATGCGCTACGAGTATGGCGAAAAGGCAATC
TACACCCAGCTCCTCTACTTTGCCTCGTTGTGGGACGTGGATCGCGCCCGTGCTAGTGCCCTCGACATGCCCGCC
CCTGACCGCGACAAGATTTTCGCCTTGGCAGAGCACAACCGCCTGCGCTTTGGCACCCTCAAATCCCTTGTCCAG
GGCTACTTGGAAAAGTGCGGCAGACAGTGGGTCGCCATGGACACCCTCTTTGGCAAGCTTGGCTTCAACCGCTCC
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail