Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6912
Gene name
LocationContig_69:3170..5174
Strand+
Gene length (bp)2004
Transcript length (bp)1674
Coding sequence length (bp)1674
Protein length (aa) 558

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13041 PPR_2 PPR repeat family 9.2E-18 86 132
PF01535 PPR PPR repeat 6.5E-04 87 115

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9SH26|PP102_ARATH Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 86 206 3.0E-07
sp|O60142|PPR2_SCHPO Pentatricopeptide repeat-containing protein 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppr2 PE=3 SV=1 18 262 5.0E-07
sp|Q9LFC5|PP360_ARATH Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 86 229 1.0E-06
sp|Q9SS81|PP221_ARATH Pentatricopeptide repeat-containing protein At3g09060 OS=Arabidopsis thaliana GN=At3g09060 PE=2 SV=1 86 206 2.0E-06
sp|Q9M907|PP217_ARATH Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 86 206 4.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6912
MLLYPRKSDKRATDSDEVEEATDSDEVVDEAQERKTAAIRRRVARHMSRMDDPWHIANQVQIILANGGFDEALML
VQKFSARMQVVVSWNHVIDHLLKQQKIKEAIKLYNDMKKRAQLPNVQTYTILFRGLALSDHPKYAVSVALKHYNI
LLADKRLSPNSTHLNSCLNACARAEDIESLLLIAQTANDSTRAPTAYTYTIILNALRAHAMTEIKDGFSQKAEYL
QKNVIDRANDLWSEVLTKWRHGEIVLDEKLVCSMGRIANFARHDNDKHYVFELLRLTMNMPNFSQEVDSDPYSEE
MKFISRPGSKPVAVPMSKSAFYAVPGNMTLSLIIATLTQTKNKTIGLKYWNLMVRHYGIIPDAKNWIRMFYMLRS
VKSSGTIAELFSVLPPDFLEVKMFRIALETVPEINDLRLYLRAALVCHLSFRELKMEAGLDKARKAYGKQIMEAI
NRIWEPYMTAYHGDFEENGETSTVPGPQYNQQREVIALARRMFSALNKLVNEKLVYADLVPKIRSMAAKLNRKIV
SFYHDREEDTTLDDDDNDDDPERRAGSGYTRV*
Coding >OphauB2|6912
ATGCTACTATATCCGAGAAAGAGCGACAAGAGGGCCACTGATTCAGACGAGGTGGAAGAGGCCACTGATTCAGAC
GAAGTGGTAGATGAGGCTCAAGAACGCAAGACGGCGGCCATAAGGCGCAGAGTGGCTAGGCACATGTCGCGCATG
GACGATCCATGGCATATTGCCAACCAAGTGCAAATAATCTTGGCCAATGGCGGCTTCGATGAGGCGTTGATGCTA
GTGCAGAAATTCAGTGCTCGCATGCAAGTCGTGGTGTCATGGAACCACGTAATAGATCACTTGCTTAAACAGCAA
AAGATCAAGGAGGCCATTAAGCTCTACAACGATATGAAGAAGAGGGCGCAGTTGCCCAATGTCCAGACTTATACC
ATTTTATTCAGAGGCTTGGCCCTCTCTGACCATCCCAAGTATGCCGTTTCGGTGGCGCTCAAGCACTACAACATT
CTTTTGGCCGATAAGCGCCTCTCACCAAACTCGACACATCTCAACTCCTGCCTCAACGCTTGTGCTCGGGCGGAA
GATATCGAATCTTTACTTCTCATTGCTCAGACGGCCAACGACTCGACTCGAGCCCCGACTGCTTATACCTACACC
ATTATCTTAAACGCCCTCCGCGCACACGCCATGACCGAGATAAAGGACGGATTCAGCCAAAAAGCCGAGTATTTG
CAGAAAAATGTTATCGATCGCGCCAATGATTTGTGGTCCGAGGTTCTCACAAAGTGGCGTCATGGAGAAATTGTC
CTTGACGAGAAGCTTGTCTGCTCCATGGGCCGCATCGCCAATTTTGCACGTCACGACAACGACAAACATTATGTC
TTTGAACTATTGAGACTGACCATGAATATGCCCAACTTTTCGCAAGAAGTCGACTCGGATCCCTATAGCGAGGAA
ATGAAATTCATTTCCAGGCCAGGTTCAAAGCCCGTCGCTGTGCCAATGTCAAAGTCTGCCTTTTACGCCGTGCCA
GGAAACATGACGCTTTCGCTCATCATAGCTACTCTAACGCAAACCAAGAACAAGACTATAGGCTTAAAGTATTGG
AATCTCATGGTCCGGCACTATGGCATTATTCCAGATGCCAAAAACTGGATTCGCATGTTTTACATGCTCAGATCA
GTCAAGTCGAGTGGAACAATCGCTGAACTTTTTAGCGTTCTCCCTCCAGACTTTCTTGAAGTCAAAATGTTTCGT
ATTGCTTTGGAAACGGTCCCCGAAATCAATGACTTGCGTCTCTATCTGCGCGCTGCGCTCGTCTGCCACCTCTCA
TTCCGCGAATTAAAAATGGAGGCAGGTTTGGACAAGGCCAGAAAGGCTTATGGTAAACAAATCATGGAGGCCATC
AACCGCATCTGGGAGCCCTACATGACGGCCTATCACGGTGACTTTGAGGAGAATGGTGAGACGAGTACTGTTCCA
GGACCCCAATACAATCAGCAGCGCGAGGTGATTGCTCTGGCTCGCCGCATGTTTTCTGCCCTCAACAAACTTGTC
AATGAGAAATTGGTCTACGCAGACTTGGTGCCAAAAATTCGCTCAATGGCTGCCAAACTCAACCGCAAAATCGTC
TCGTTTTACCACGACCGAGAAGAAGACACCACACTTGATGATGATGATAATGATGACGACCCGGAAAGAAGGGCG
GGAAGTGGATACACAAGAGTCTGA
Transcript >OphauB2|6912
ATGCTACTATATCCGAGAAAGAGCGACAAGAGGGCCACTGATTCAGACGAGGTGGAAGAGGCCACTGATTCAGAC
GAAGTGGTAGATGAGGCTCAAGAACGCAAGACGGCGGCCATAAGGCGCAGAGTGGCTAGGCACATGTCGCGCATG
GACGATCCATGGCATATTGCCAACCAAGTGCAAATAATCTTGGCCAATGGCGGCTTCGATGAGGCGTTGATGCTA
GTGCAGAAATTCAGTGCTCGCATGCAAGTCGTGGTGTCATGGAACCACGTAATAGATCACTTGCTTAAACAGCAA
AAGATCAAGGAGGCCATTAAGCTCTACAACGATATGAAGAAGAGGGCGCAGTTGCCCAATGTCCAGACTTATACC
ATTTTATTCAGAGGCTTGGCCCTCTCTGACCATCCCAAGTATGCCGTTTCGGTGGCGCTCAAGCACTACAACATT
CTTTTGGCCGATAAGCGCCTCTCACCAAACTCGACACATCTCAACTCCTGCCTCAACGCTTGTGCTCGGGCGGAA
GATATCGAATCTTTACTTCTCATTGCTCAGACGGCCAACGACTCGACTCGAGCCCCGACTGCTTATACCTACACC
ATTATCTTAAACGCCCTCCGCGCACACGCCATGACCGAGATAAAGGACGGATTCAGCCAAAAAGCCGAGTATTTG
CAGAAAAATGTTATCGATCGCGCCAATGATTTGTGGTCCGAGGTTCTCACAAAGTGGCGTCATGGAGAAATTGTC
CTTGACGAGAAGCTTGTCTGCTCCATGGGCCGCATCGCCAATTTTGCACGTCACGACAACGACAAACATTATGTC
TTTGAACTATTGAGACTGACCATGAATATGCCCAACTTTTCGCAAGAAGTCGACTCGGATCCCTATAGCGAGGAA
ATGAAATTCATTTCCAGGCCAGGTTCAAAGCCCGTCGCTGTGCCAATGTCAAAGTCTGCCTTTTACGCCGTGCCA
GGAAACATGACGCTTTCGCTCATCATAGCTACTCTAACGCAAACCAAGAACAAGACTATAGGCTTAAAGTATTGG
AATCTCATGGTCCGGCACTATGGCATTATTCCAGATGCCAAAAACTGGATTCGCATGTTTTACATGCTCAGATCA
GTCAAGTCGAGTGGAACAATCGCTGAACTTTTTAGCGTTCTCCCTCCAGACTTTCTTGAAGTCAAAATGTTTCGT
ATTGCTTTGGAAACGGTCCCCGAAATCAATGACTTGCGTCTCTATCTGCGCGCTGCGCTCGTCTGCCACCTCTCA
TTCCGCGAATTAAAAATGGAGGCAGGTTTGGACAAGGCCAGAAAGGCTTATGGTAAACAAATCATGGAGGCCATC
AACCGCATCTGGGAGCCCTACATGACGGCCTATCACGGTGACTTTGAGGAGAATGGTGAGACGAGTACTGTTCCA
GGACCCCAATACAATCAGCAGCGCGAGGTGATTGCTCTGGCTCGCCGCATGTTTTCTGCCCTCAACAAACTTGTC
AATGAGAAATTGGTCTACGCAGACTTGGTGCCAAAAATTCGCTCAATGGCTGCCAAACTCAACCGCAAAATCGTC
TCGTTTTACCACGACCGAGAAGAAGACACCACACTTGATGATGATGATAATGATGACGACCCGGAAAGAAGGGCG
GGAAGTGGATACACAAGAGTCTGA
Gene >OphauB2|6912
ATGCTACTATAGTCACTCCATATAGTCCGCGAAAGAGCGATAAGAGGGCCACTGATTCAGACGAGGTGGAAGATG
CCACTGAAGTCACCCCGCACAGTCCGAGAAAGAGCGACAAGAGGGCCACTGATTCAGACGAGGTGGAAGAGGCCA
CTGATTCAGACGAAGTGGTAGATGAGGCTCAAGAACGCAAGACGGCGGCCATAAGGCGCAGAGTGGCTAGGCACA
TGTCGCGCATGGACGATCCATGGCATATTGCCAACCAAGTGCAAATAATCTTGGCCAATGGCGGCTTCGATGAGG
CGTTGATGCTAGTGCAGAAATTCAGTGCTCGCATGCAAGTCGTGGTGTCATGGAACCACGTAATAGATCACTTGC
TTAAACAGCAAAAGATCAAGGAGGCCATTAAGCTCTACAACGATGTTGGTCTCTCTCTCTTGTTGACTGCCAAGG
GCTCTTAGCTAAAAGGGGACCACAGATGAAGAAGAGGGCGCAGTTGCCCAATGTCCAGACTTATACCATTTTATT
CAGAGGCTTGGCCCTCTCTGACCATCCCAAGTATGCCGTTTCGGTGGCGCTCAAGCACTACAACATTCTTTTGGC
CGATAAGCGCCTCTCACCAAACTCGACACATCTCAACTCCTGCCTCAACGCTTGTGCTCGGGCGGAAGATATCGA
ATCTTTACTTCTCATTGCTCAGACGGCCAACGACTCGACTCGAGCCCCGACTGCTTATACCTACACCATTATCTT
AAACGCCCTCCGCGCACACGCCATGACCGAGATAAAGGACGGATTCAGCCAAAAAGCCGAGTATTTGCAGAAAAA
TGTTATCGATCGCGCCAATGATTTGTGGTCCGAGGTTCTCACAAAGTGGCGTCATGGAGAAATTGTCCTTGACGA
GAAGCTTGTCTGCTCCATGGGCCGCATCGCCAATTTTGCACGTCACGACAACGACAAACATTATGTCTTTGAACT
ATTGAGACTGACCATGAATATGCCCAACTTTTCGCAAGAAGTCGACTCGGATCCCTATAGCGAGGAAATGAAATT
CATTTCCAGGCCAGGTTCAAAGCCCGTCGCTGTGCCAATGTCAAAGTCTGCCTTTTACGCCGTGCCAGGAAACAT
GACGCTTTCGCTCATCATAGCTACTCTAACGCAAACCAAGAACAAGACTATAGGCTTAAAGTATTGGAATCTCAT
GGTCCGGCACTATGGCATTATTCCAGATGCCAAAAACTGGATTCGCATGTTTTACATGCTCAGATCAGTCAAGTC
GAGTGGAACAATCGCTGAACTTTTTAGCGTTCTCCCTCCAGACTTTCTTGAAGTCAAAATGTTTCGTATTGCTTT
GGAAACGGTTATTCGCGACAACTTGAACAGAAATGCCTTCAAGAATGCGAATACTATTATGGATGCTATGCTAAG
ACAGGACAAGGTCCCCGAAATCAATGACTTGCGTCTCTATCTGCGCGCTGCGCTCGTCTGCCACCTCTCATTCCG
CGAATTAAAAATGGAGGCAGGTTTGGACAAGGCCAGAAAGGCTTATGGTAAACAAATCATGGAGGCCATCAACCG
CATCTGGGAGCCCTACATGACGGCCTATCACGGTGACTTTGAGGAGAATGGTGAGACGAGTACTGTTCCAGGACC
CCAATACAATCAGCAGCGCGAGGTGATTGCTCTGGCTCGCCGCATGTTTTCTGCCCTCAACAAACTTGTCAATGA
GAAATTGGTCTACGCAGACTTGGTGCCAAAAATTCGCTCAATGGCTGCCAAACTCAACCGCAAAATCGTCTCGTT
TTACCACGACCGTGAGGAAAAGGAGCCCAACCTGTCTGGCTCAAAAACTACTCAAGGAGAAGAAGACACCACACT
TGATGATGATGATAATGATGACGACCCGGAAAGAAGGGCGGGAAGTGGATACGTGTGGAAGACTCTTAGGTCTTT
CGGGCCTGTCGCGCCTGTCGAACATATCATTTGGGATCAAAGACAAGAGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail