Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|691
Gene name
LocationContig_112:50370..51126
Strand-
Gene length (bp)756
Transcript length (bp)756
Coding sequence length (bp)756
Protein length (aa) 252

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11374 DUF3176 Protein of unknown function (DUF3176) 1.0E-32 57 170

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 38 60 22
2 75 97 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|691
MVSTLETSSDTSKLQPSGANFMGKMQRRHSQNLATIRLWCFEVASILAAAGIFAAIVAILVKYDGQQLPKRPYNI
NLNTLIALLTLCLRAALAFTAVEIIGQLKWKWFSDGPRSLANFQTFDEASRGLLGSLKLISLLRLSYRGSPLAVI
AALTSILSLAISPFTQQAIKTVPCPHVASIDGARIPVAMNLPGVDGSYSFGQTAELQELGPMFKVPFSRASSAHM
ATKVLFSGSARLGIARFPRLLACRTR*
Coding >OphauB2|691
ATGGTGTCCACTTTGGAAACAAGTTCAGACACGTCAAAGCTACAACCATCAGGGGCCAATTTTATGGGAAAGATG
CAAAGGCGGCACAGCCAGAATTTGGCGACTATTCGCCTCTGGTGCTTCGAAGTCGCCTCAATACTTGCTGCGGCA
GGCATTTTTGCCGCCATAGTGGCCATCTTGGTCAAGTACGATGGCCAGCAGCTTCCGAAACGGCCCTACAACATC
AATCTAAACACACTTATAGCCCTGCTTACTCTCTGCCTTCGCGCTGCCTTAGCTTTTACTGCGGTGGAAATCATC
GGTCAGTTGAAATGGAAATGGTTCTCAGACGGCCCACGGTCGCTCGCCAACTTCCAGACTTTTGACGAAGCCAGT
CGTGGCTTGCTCGGGTCTCTTAAATTGATATCTCTGCTGCGTCTCAGCTATCGCGGAAGTCCGTTGGCAGTTATC
GCCGCTCTTACCTCCATTCTCAGTCTTGCAATCAGCCCCTTTACTCAACAAGCAATCAAGACGGTACCGTGCCCC
CACGTGGCATCTATAGATGGCGCTAGAATCCCCGTGGCCATGAACCTCCCCGGTGTCGATGGATCGTATTCGTTT
GGACAAACGGCAGAGCTGCAAGAACTCGGACCCATGTTCAAGGTGCCATTCTCTCGGGCCTCATCAGCCCACATG
GCAACGAAAGTACTATTCAGCGGGAGTGCTCGACTAGGAATTGCACGTTTCCCGAGGCTCTTGGCGTGCCGCACT
CGATGA
Transcript >OphauB2|691
ATGGTGTCCACTTTGGAAACAAGTTCAGACACGTCAAAGCTACAACCATCAGGGGCCAATTTTATGGGAAAGATG
CAAAGGCGGCACAGCCAGAATTTGGCGACTATTCGCCTCTGGTGCTTCGAAGTCGCCTCAATACTTGCTGCGGCA
GGCATTTTTGCCGCCATAGTGGCCATCTTGGTCAAGTACGATGGCCAGCAGCTTCCGAAACGGCCCTACAACATC
AATCTAAACACACTTATAGCCCTGCTTACTCTCTGCCTTCGCGCTGCCTTAGCTTTTACTGCGGTGGAAATCATC
GGTCAGTTGAAATGGAAATGGTTCTCAGACGGCCCACGGTCGCTCGCCAACTTCCAGACTTTTGACGAAGCCAGT
CGTGGCTTGCTCGGGTCTCTTAAATTGATATCTCTGCTGCGTCTCAGCTATCGCGGAAGTCCGTTGGCAGTTATC
GCCGCTCTTACCTCCATTCTCAGTCTTGCAATCAGCCCCTTTACTCAACAAGCAATCAAGACGGTACCGTGCCCC
CACGTGGCATCTATAGATGGCGCTAGAATCCCCGTGGCCATGAACCTCCCCGGTGTCGATGGATCGTATTCGTTT
GGACAAACGGCAGAGCTGCAAGAACTCGGACCCATGTTCAAGGTGCCATTCTCTCGGGCCTCATCAGCCCACATG
GCAACGAAAGTACTATTCAGCGGGAGTGCTCGACTAGGAATTGCACGTTTCCCGAGGCTCTTGGCGTGCCGCACT
CGATGA
Gene >OphauB2|691
ATGGTGTCCACTTTGGAAACAAGTTCAGACACGTCAAAGCTACAACCATCAGGGGCCAATTTTATGGGAAAGATG
CAAAGGCGGCACAGCCAGAATTTGGCGACTATTCGCCTCTGGTGCTTCGAAGTCGCCTCAATACTTGCTGCGGCA
GGCATTTTTGCCGCCATAGTGGCCATCTTGGTCAAGTACGATGGCCAGCAGCTTCCGAAACGGCCCTACAACATC
AATCTAAACACACTTATAGCCCTGCTTACTCTCTGCCTTCGCGCTGCCTTAGCTTTTACTGCGGTGGAAATCATC
GGTCAGTTGAAATGGAAATGGTTCTCAGACGGCCCACGGTCGCTCGCCAACTTCCAGACTTTTGACGAAGCCAGT
CGTGGCTTGCTCGGGTCTCTTAAATTGATATCTCTGCTGCGTCTCAGCTATCGCGGAAGTCCGTTGGCAGTTATC
GCCGCTCTTACCTCCATTCTCAGTCTTGCAATCAGCCCCTTTACTCAACAAGCAATCAAGACGGTACCGTGCCCC
CACGTGGCATCTATAGATGGCGCTAGAATCCCCGTGGCCATGAACCTCCCCGGTGTCGATGGATCGTATTCGTTT
GGACAAACGGCAGAGCTGCAAGAACTCGGACCCATGTTCAAGGTGCCATTCTCTCGGGCCTCATCAGCCCACATG
GCAACGAAAGTACTATTCAGCGGGAGTGCTCGACTAGGAATTGCACGTTTCCCGAGGCTCTTGGCGTGCCGCACT
CGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail