Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6907
Gene name
LocationContig_68:95217..95985
Strand+
Gene length (bp)768
Transcript length (bp)648
Coding sequence length (bp)648
Protein length (aa) 216

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O96185|YPF08_PLAF7 Uncharacterized protein PFB0460c OS=Plasmodium falciparum (isolate 3D7) GN=PFB0460c PE=3 SV=1 45 109 4.0E-06
sp|O96185|YPF08_PLAF7 Uncharacterized protein PFB0460c OS=Plasmodium falciparum (isolate 3D7) GN=PFB0460c PE=3 SV=1 47 109 5.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6907
MHAKTWLSICLLGLAVASPQEPTPLTSESKTLPPSPTNSGACEPHGDHWHCHQPAATATSHTNDHSHSHDDDDND
HDHHDHDHDHDHGHDDHDHDHDNNGCTPHSDHWHCPPGVPKPSTPPPPPATSSETQACTPHNDHWHCPSGVPKPT
TPPPGAAEFSRTRSQPATSATTATATASASQSTSSVATGSAPRPLPIGGVVAPLLAAGLVSALML*
Coding >OphauB2|6907
ATGCATGCCAAAACGTGGCTTTCCATATGCCTCTTGGGCCTGGCTGTTGCCTCGCCGCAGGAGCCAACGCCCTTG
ACATCTGAGAGCAAGACGCTGCCGCCGTCGCCCACCAACTCTGGTGCCTGCGAGCCGCACGGAGACCACTGGCAC
TGCCACCAGCCAGCCGCCACAGCCACCAGCCACACCAACGACCACAGCCACAGTCACGATGACGACGACAATGAC
CACGACCACCATGACCACGACCACGACCATGACCATGGCCATGATGACCACGACCACGACCACGACAACAACGGC
TGTACCCCCCACTCGGATCACTGGCACTGCCCTCCCGGCGTGCCCAAGCCCTCCACCCCCCCGCCGCCACCAGCC
ACATCCTCAGAAACGCAAGCCTGCACTCCCCACAACGACCACTGGCACTGCCCATCAGGAGTCCCCAAGCCCACC
ACGCCGCCCCCCGGAGCCGCAGAGTTTAGCCGCACGCGCTCTCAGCCCGCCACGTCTGCCACCACGGCAACGGCG
ACGGCTTCTGCTTCCCAGTCCACTTCGTCCGTCGCCACGGGCAGCGCCCCTCGCCCTTTGCCCATTGGCGGTGTC
GTGGCGCCTCTGCTGGCTGCTGGTCTTGTCAGTGCTCTGATGCTGTAA
Transcript >OphauB2|6907
ATGCATGCCAAAACGTGGCTTTCCATATGCCTCTTGGGCCTGGCTGTTGCCTCGCCGCAGGAGCCAACGCCCTTG
ACATCTGAGAGCAAGACGCTGCCGCCGTCGCCCACCAACTCTGGTGCCTGCGAGCCGCACGGAGACCACTGGCAC
TGCCACCAGCCAGCCGCCACAGCCACCAGCCACACCAACGACCACAGCCACAGTCACGATGACGACGACAATGAC
CACGACCACCATGACCACGACCACGACCATGACCATGGCCATGATGACCACGACCACGACCACGACAACAACGGC
TGTACCCCCCACTCGGATCACTGGCACTGCCCTCCCGGCGTGCCCAAGCCCTCCACCCCCCCGCCGCCACCAGCC
ACATCCTCAGAAACGCAAGCCTGCACTCCCCACAACGACCACTGGCACTGCCCATCAGGAGTCCCCAAGCCCACC
ACGCCGCCCCCCGGAGCCGCAGAGTTTAGCCGCACGCGCTCTCAGCCCGCCACGTCTGCCACCACGGCAACGGCG
ACGGCTTCTGCTTCCCAGTCCACTTCGTCCGTCGCCACGGGCAGCGCCCCTCGCCCTTTGCCCATTGGCGGTGTC
GTGGCGCCTCTGCTGGCTGCTGGTCTTGTCAGTGCTCTGATGCTGTAA
Gene >OphauB2|6907
ATGCATGCCAAAACGTGGCTTTCCATATGCCTCTTGGGCCTGGCTGTTGCCTCGCCGCAGGAGCCAACGCCCTTG
ACATCTGAGAGCAAGACGCTGCCGCCGTCGCCCACCAACTCTGGTGCCTGCGAGCCGCACGGAGACCACTGTAAG
CTCTTGCTTTTCTCACAGCGTTTTTTTTTTCTTTTTTTTCAGCAATATATTCCTTCTTTTTCAATGTCTTGGTGG
CTGTCAAGTAATGGGGGAGCACGAGGCTAACAAATGTTAGGGCACTGCCACCAGCCAGCCGCCACAGCCACCAGC
CACACCAACGACCACAGCCACAGTCACGATGACGACGACAATGACCACGACCACCATGACCACGACCACGACCAT
GACCATGGCCATGATGACCACGACCACGACCACGACAACAACGGCTGTACCCCCCACTCGGATCACTGGCACTGC
CCTCCCGGCGTGCCCAAGCCCTCCACCCCCCCGCCGCCACCAGCCACATCCTCAGAAACGCAAGCCTGCACTCCC
CACAACGACCACTGGCACTGCCCATCAGGAGTCCCCAAGCCCACCACGCCGCCCCCCGGAGCCGCAGAGTTTAGC
CGCACGCGCTCTCAGCCCGCCACGTCTGCCACCACGGCAACGGCGACGGCTTCTGCTTCCCAGTCCACTTCGTCC
GTCGCCACGGGCAGCGCCCCTCGCCCTTTGCCCATTGGCGGTGTCGTGGCGCCTCTGCTGGCTGCTGGTCTTGTC
AGTGCTCTGATGCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail