Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6904
Gene name
LocationContig_68:86905..88748
Strand-
Gene length (bp)1843
Transcript length (bp)1779
Coding sequence length (bp)1779
Protein length (aa) 593

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02535 Zip ZIP Zinc transporter 3.9E-10 34 185
PF02535 Zip ZIP Zinc transporter 1.4E-22 380 582

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P34240|ZRT3_YEAST Zinc-regulated transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRT3 PE=1 SV=2 427 558 7.0E-29
sp|Q8FTK0|ZUPT_COREF Zinc transporter ZupT OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=zupT PE=3 SV=1 417 589 3.0E-18
sp|O94402|ZIP2_SCHPO Probable zinc transporter zip2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zip2 PE=3 SV=2 404 569 3.0E-18
sp|Q8NQK0|ZUPT_CORGL Zinc transporter ZupT OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=zupT PE=3 SV=1 417 589 8.0E-18
sp|Q9PIN2|ZUPT_CAMJE Zinc transporter ZupT OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=zupT PE=3 SV=1 404 585 1.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P34240|ZRT3_YEAST Zinc-regulated transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRT3 PE=1 SV=2 427 558 7.0E-29
sp|Q8FTK0|ZUPT_COREF Zinc transporter ZupT OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=zupT PE=3 SV=1 417 589 3.0E-18
sp|O94402|ZIP2_SCHPO Probable zinc transporter zip2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zip2 PE=3 SV=2 404 569 3.0E-18
sp|Q8NQK0|ZUPT_CORGL Zinc transporter ZupT OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=zupT PE=3 SV=1 417 589 8.0E-18
sp|Q9PIN2|ZUPT_CAMJE Zinc transporter ZupT OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=zupT PE=3 SV=1 404 585 1.0E-17
sp|B2UL32|ZUPT_AKKM8 Zinc transporter ZupT OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=zupT PE=3 SV=1 422 555 2.0E-17
sp|C3PFG5|ZUPT_CORA7 Zinc transporter ZupT OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=zupT PE=3 SV=1 436 589 4.0E-17
sp|Q3AU90|ZUPT_CHLCH Zinc transporter ZupT OS=Chlorobium chlorochromatii (strain CaD3) GN=zupT PE=3 SV=1 439 555 4.0E-17
sp|Q8ENQ1|ZUPT_OCEIH Zinc transporter ZupT OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=zupT PE=3 SV=1 436 590 6.0E-17
sp|B3QP89|ZUPT_CHLP8 Zinc transporter ZupT OS=Chlorobaculum parvum (strain NCIB 8327) GN=zupT PE=3 SV=1 436 555 8.0E-17
sp|A1KRK6|ZUPT_NEIMF Zinc transporter ZupT OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=zupT PE=3 SV=1 419 589 2.0E-16
sp|Q9JX23|ZUPT_NEIMA Zinc transporter ZupT OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=zupT PE=3 SV=1 419 589 2.0E-16
sp|Q8DRY7|ZUPT_STRMU Zinc transporter ZupT OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=zupT PE=3 SV=1 398 589 3.0E-16
sp|Q9K1H6|ZUPT_NEIMB Zinc transporter ZupT OS=Neisseria meningitidis serogroup B (strain MC58) GN=zupT PE=3 SV=1 419 589 4.0E-16
sp|B7NJQ3|ZUPT_ECO7I Zinc transporter ZupT OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=zupT PE=3 SV=1 444 589 1.0E-15
sp|Q54LY6|ZNTB_DICDI Protein zntB OS=Dictyostelium discoideum GN=zntB PE=2 SV=1 438 556 2.0E-15
sp|A4SE48|ZUPT_CHLPM Zinc transporter ZupT OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=zupT PE=3 SV=1 425 590 7.0E-15
sp|A8ZVV7|ZUPT_DESOH Zinc transporter ZupT OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=zupT PE=3 SV=1 393 585 8.0E-15
sp|B3ECE6|ZUPT_CHLL2 Zinc transporter ZupT OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=zupT PE=3 SV=1 439 590 8.0E-15
sp|Q8XMG8|ZUPT_CLOPE Zinc transporter ZupT OS=Clostridium perfringens (strain 13 / Type A) GN=zupT PE=3 SV=1 403 589 3.0E-14
sp|B4SPV6|ZUPT_STRM5 Zinc transporter ZupT OS=Stenotrophomonas maltophilia (strain R551-3) GN=zupT PE=3 SV=1 439 589 1.0E-13
sp|B2FM90|ZUPT_STRMK Zinc transporter ZupT OS=Stenotrophomonas maltophilia (strain K279a) GN=zupT PE=3 SV=1 439 589 2.0E-13
sp|Q3B4G1|ZUPT_CHLL7 Zinc transporter ZupT OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=zupT PE=3 SV=1 439 589 2.0E-13
sp|Q8P8Z6|ZUPT_XANCP Zinc transporter ZupT OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=zupT PE=3 SV=1 439 555 3.0E-13
sp|Q940Q3|ZTP29_ARATH Zinc transporter ZTP29 OS=Arabidopsis thaliana GN=ZTP29 PE=2 SV=1 419 555 5.0E-13
sp|B1HYT6|ZUPT_LYSSC Zinc transporter ZupT OS=Lysinibacillus sphaericus (strain C3-41) GN=zupT PE=3 SV=1 437 588 6.0E-13
sp|A4WEI1|ZUPT_ENT38 Zinc transporter ZupT OS=Enterobacter sp. (strain 638) GN=zupT PE=3 SV=1 444 589 9.0E-13
sp|Q8PKQ5|ZUPT_XANAC Zinc transporter ZupT OS=Xanthomonas axonopodis pv. citri (strain 306) GN=zupT PE=3 SV=1 439 555 1.0E-12
sp|B1XG45|ZUPT_ECODH Zinc transporter ZupT OS=Escherichia coli (strain K12 / DH10B) GN=zupT PE=3 SV=1 444 589 2.0E-12
sp|P0A8H3|ZUPT_ECOLI Zinc transporter ZupT OS=Escherichia coli (strain K12) GN=zupT PE=1 SV=1 444 589 2.0E-12
sp|C4ZQV8|ZUPT_ECOBW Zinc transporter ZupT OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=zupT PE=3 SV=1 444 589 2.0E-12
sp|B7LZI9|ZUPT_ECO8A Zinc transporter ZupT OS=Escherichia coli O8 (strain IAI1) GN=zupT PE=3 SV=1 444 589 2.0E-12
sp|B5YR85|ZUPT_ECO5E Zinc transporter ZupT OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=zupT PE=3 SV=1 444 589 2.0E-12
sp|P0A8H5|ZUPT_ECO57 Zinc transporter ZupT OS=Escherichia coli O157:H7 GN=zupT PE=3 SV=1 444 589 2.0E-12
sp|Q0T0L8|ZUPT_SHIF8 Zinc transporter ZupT OS=Shigella flexneri serotype 5b (strain 8401) GN=zupT PE=3 SV=1 444 589 2.0E-12
sp|B7LGI2|ZUPT_ECO55 Zinc transporter ZupT OS=Escherichia coli (strain 55989 / EAEC) GN=zupT PE=3 SV=1 444 589 2.0E-12
sp|B7MAB7|ZUPT_ECO45 Zinc transporter ZupT OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=zupT PE=3 SV=1 444 589 2.0E-12
sp|A7ZRS2|ZUPT_ECO24 Zinc transporter ZupT OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=zupT PE=3 SV=1 444 589 2.0E-12
sp|B7UIV3|ZUPT_ECO27 Zinc transporter ZupT OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=zupT PE=3 SV=1 444 589 2.0E-12
sp|Q7UBJ3|ZUPT_SHIFL Zinc transporter ZupT OS=Shigella flexneri GN=zupT PE=3 SV=1 444 589 2.0E-12
sp|A1AFW5|ZUPT_ECOK1 Zinc transporter ZupT OS=Escherichia coli O1:K1 / APEC GN=zupT PE=3 SV=1 444 589 2.0E-12
sp|A8A4J6|ZUPT_ECOHS Zinc transporter ZupT OS=Escherichia coli O9:H4 (strain HS) GN=zupT PE=3 SV=1 444 589 2.0E-12
sp|B7N0I9|ZUPT_ECO81 Zinc transporter ZupT OS=Escherichia coli O81 (strain ED1a) GN=zupT PE=3 SV=1 444 589 2.0E-12
sp|Q3YXK1|ZUPT_SHISS Zinc transporter ZupT OS=Shigella sonnei (strain Ss046) GN=zupT PE=3 SV=1 444 589 2.0E-12
sp|B1LF36|ZUPT_ECOSM Zinc transporter ZupT OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=zupT PE=3 SV=1 444 589 2.0E-12
sp|B6I411|ZUPT_ECOSE Zinc transporter ZupT OS=Escherichia coli (strain SE11) GN=zupT PE=3 SV=1 444 589 2.0E-12
sp|B7ND33|ZUPT_ECOLU Zinc transporter ZupT OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=zupT PE=3 SV=1 444 589 2.0E-12
sp|B1ISB7|ZUPT_ECOLC Zinc transporter ZupT OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=zupT PE=3 SV=1 444 589 2.0E-12
sp|P0A8H4|ZUPT_ECOL6 Zinc transporter ZupT OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=zupT PE=3 SV=1 444 589 2.0E-12
sp|Q0TD62|ZUPT_ECOL5 Zinc transporter ZupT OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=zupT PE=3 SV=1 444 589 2.0E-12
sp|Q32BU5|ZUPT_SHIDS Zinc transporter ZupT OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=zupT PE=3 SV=1 444 589 5.0E-12
sp|Q5PMU9|ZUPT_SALPA Zinc transporter ZupT OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=zupT PE=3 SV=1 444 585 1.0E-11
sp|B5BG02|ZUPT_SALPK Zinc transporter ZupT OS=Salmonella paratyphi A (strain AKU_12601) GN=zupT PE=3 SV=1 444 585 1.0E-11
sp|B5F683|ZUPT_SALA4 Zinc transporter ZupT OS=Salmonella agona (strain SL483) GN=zupT PE=3 SV=1 444 585 1.0E-11
sp|B4TVS2|ZUPT_SALSV Zinc transporter ZupT OS=Salmonella schwarzengrund (strain CVM19633) GN=zupT PE=3 SV=1 444 585 1.0E-11
sp|Q57JS2|ZUPT_SALCH Zinc transporter ZupT OS=Salmonella choleraesuis (strain SC-B67) GN=zupT PE=3 SV=1 444 585 1.0E-11
sp|B5FV58|ZUPT_SALDC Zinc transporter ZupT OS=Salmonella dublin (strain CT_02021853) GN=zupT PE=3 SV=1 444 585 1.0E-11
sp|B5QZ27|ZUPT_SALEP Zinc transporter ZupT OS=Salmonella enteritidis PT4 (strain P125109) GN=zupT PE=3 SV=1 444 585 1.0E-11
sp|B5REE9|ZUPT_SALG2 Zinc transporter ZupT OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=zupT PE=3 SV=1 444 585 1.0E-11
sp|B4T660|ZUPT_SALNS Zinc transporter ZupT OS=Salmonella newport (strain SL254) GN=zupT PE=3 SV=1 444 585 1.0E-11
sp|A9N5W7|ZUPT_SALPB Zinc transporter ZupT OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=zupT PE=3 SV=1 444 585 1.0E-11
sp|C0PYW1|ZUPT_SALPC Zinc transporter ZupT OS=Salmonella paratyphi C (strain RKS4594) GN=zupT PE=3 SV=1 444 585 1.0E-11
sp|P67471|ZUPT_SALTI Zinc transporter ZupT OS=Salmonella typhi GN=zupT PE=3 SV=1 444 585 1.0E-11
sp|P67470|ZUPT_SALTY Zinc transporter ZupT OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=zupT PE=3 SV=1 444 585 1.0E-11
sp|B4TI40|ZUPT_SALHS Zinc transporter ZupT OS=Salmonella heidelberg (strain SL476) GN=zupT PE=3 SV=1 444 585 2.0E-11
sp|A9MPX1|ZUPT_SALAR Zinc transporter ZupT OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=zupT PE=3 SV=1 444 585 2.0E-11
sp|B7LQB7|ZUPT_ESCF3 Zinc transporter ZupT OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=zupT PE=3 SV=1 444 585 6.0E-11
sp|O94402|ZIP2_SCHPO Probable zinc transporter zip2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zip2 PE=3 SV=2 19 154 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0030001 metal ion transport Yes
GO:0051179 localization No
GO:0006811 ion transport No
GO:0008324 cation transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0006812 cation transport No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0015075 ion transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0009987 cellular process No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 28 50 22
2 63 82 19
3 102 124 22
4 470 492 22
5 502 524 22
6 537 559 22
7 569 591 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6904
MAFTEPQASMPLVATEMDNDTRGWIMCIVSGIACVFGASIICVDVVVRLFPGKHNFRIQESSIFLACSLSLSFGV
MLFSSLYSMLPESKQYLRDEGWADQPAGFAMMGCFIGGFIGIQAISRFLHQYMPSHVVDCDHSHDDDGSTAAAAS
HTRPSSGGHSHRQQSRVSRARRRVSRNHSTHSGAKGETTPLLLDADRDFARDSSTCHTATKSSRRLDPVRGAATD
EMAERPVSPLVATATKRSRTAGDLGRRPSMYDVHKRVMSFVKDTKCNCDEEGDCYGYTDPCGQECFKHLAVRPSN
GSNSVRHATLLRTTTGPFYPQSASVFHGSTSNGAHEAGNQHQQRPDGTEPLSPMFRTSRAASREPFPPAEEDRRE
CISLRRNSVCDGEHLHNHELDNDTCHGDEQNSHTAELRSCSSMQDGDIEGQHHHHVPTNAFLSIGLQTSIAIALH
KFPEGFITYATNHANPKLGFNVFMALFVHNITEGFALALPLYMALGSRWRAMLWSALLGGLSQPVGAAIAALWFR
LARRTHMTPNAVAYACLFAATAGIMVSVALQLFVESLSLNHNRNLCIFFGFIGMAVLGLSNALFAGH*
Coding >OphauB2|6904
ATGGCCTTTACGGAGCCACAAGCCAGCATGCCTCTGGTGGCTACAGAGATGGACAATGATACCCGCGGCTGGATC
ATGTGTATTGTCAGCGGCATTGCTTGCGTTTTTGGCGCCTCCATAATATGTGTCGACGTGGTAGTTCGTCTCTTC
CCCGGCAAGCACAATTTTCGAATCCAAGAGAGCAGCATTTTTCTCGCCTGCTCTCTCAGCCTCAGCTTTGGAGTC
ATGCTCTTTTCTTCACTCTATAGCATGCTGCCAGAGTCAAAGCAGTACCTCAGGGATGAGGGCTGGGCCGACCAG
CCGGCTGGCTTCGCCATGATGGGCTGCTTCATTGGCGGCTTCATCGGAATCCAAGCCATCTCTCGATTTCTGCAC
CAGTACATGCCCTCGCACGTTGTCGACTGCGACCACAGCCACGATGATGATGGTTCAACTGCCGCTGCCGCCTCT
CATACCCGGCCTTCCTCGGGCGGCCACTCGCACCGGCAGCAGTCGCGCGTCAGCAGAGCTCGCAGACGCGTCTCG
AGAAATCATTCAACTCATAGCGGTGCCAAGGGCGAGACTACACCCCTGCTTCTAGATGCCGACCGCGACTTTGCC
CGCGATTCTTCGACATGCCACACAGCTACCAAGTCGAGTCGGAGACTGGACCCCGTCCGCGGCGCTGCTACTGAT
GAAATGGCTGAGCGGCCTGTCAGTCCTCTTGTTGCTACTGCCACCAAGCGATCTCGCACAGCTGGAGACCTTGGC
CGTCGTCCGTCCATGTACGATGTGCACAAGCGCGTCATGTCCTTTGTCAAGGACACCAAGTGCAACTGCGATGAG
GAGGGAGACTGCTACGGCTATACCGATCCCTGTGGCCAGGAATGCTTCAAGCATCTTGCCGTGCGCCCATCAAAC
GGAAGCAACAGCGTCCGCCATGCCACGCTGCTGCGCACCACGACGGGGCCCTTTTATCCGCAGTCTGCATCTGTC
TTCCACGGAAGCACCAGTAACGGAGCCCATGAAGCTGGCAATCAGCACCAGCAGCGCCCAGATGGCACGGAGCCC
TTGAGCCCCATGTTTCGAACTAGTCGAGCTGCATCCCGCGAGCCCTTTCCTCCAGCAGAGGAGGACCGTCGGGAA
TGTATTTCTCTTCGCCGTAACAGTGTCTGCGACGGCGAGCACCTTCACAACCATGAGCTTGACAATGACACGTGT
CATGGCGATGAGCAGAATTCGCATACTGCGGAGCTGCGCTCGTGCTCGTCCATGCAAGATGGGGACATTGAAGGA
CAGCACCACCACCACGTGCCCACCAATGCCTTTCTCTCCATTGGCCTTCAGACATCGATTGCCATTGCGCTGCAC
AAGTTTCCCGAAGGCTTCATCACTTATGCCACGAATCATGCGAATCCAAAGCTCGGCTTCAATGTCTTCATGGCG
CTCTTTGTGCACAACATCACCGAGGGCTTTGCTCTGGCGCTTCCGCTTTACATGGCACTCGGCTCCCGCTGGCGC
GCCATGCTCTGGTCTGCCCTCCTTGGCGGCCTCTCTCAGCCCGTTGGCGCAGCCATTGCCGCCCTGTGGTTCCGG
CTTGCGCGCCGTACGCACATGACGCCAAATGCTGTTGCCTATGCTTGCCTATTTGCTGCAACGGCGGGCATCATG
GTGAGCGTTGCCCTGCAGCTCTTTGTTGAGAGCTTGAGCCTCAACCACAACCGTAATCTGTGCATCTTTTTTGGT
TTTATTGGCATGGCAGTATTGGGATTGAGCAACGCCCTCTTTGCTGGGCACTAA
Transcript >OphauB2|6904
ATGGCCTTTACGGAGCCACAAGCCAGCATGCCTCTGGTGGCTACAGAGATGGACAATGATACCCGCGGCTGGATC
ATGTGTATTGTCAGCGGCATTGCTTGCGTTTTTGGCGCCTCCATAATATGTGTCGACGTGGTAGTTCGTCTCTTC
CCCGGCAAGCACAATTTTCGAATCCAAGAGAGCAGCATTTTTCTCGCCTGCTCTCTCAGCCTCAGCTTTGGAGTC
ATGCTCTTTTCTTCACTCTATAGCATGCTGCCAGAGTCAAAGCAGTACCTCAGGGATGAGGGCTGGGCCGACCAG
CCGGCTGGCTTCGCCATGATGGGCTGCTTCATTGGCGGCTTCATCGGAATCCAAGCCATCTCTCGATTTCTGCAC
CAGTACATGCCCTCGCACGTTGTCGACTGCGACCACAGCCACGATGATGATGGTTCAACTGCCGCTGCCGCCTCT
CATACCCGGCCTTCCTCGGGCGGCCACTCGCACCGGCAGCAGTCGCGCGTCAGCAGAGCTCGCAGACGCGTCTCG
AGAAATCATTCAACTCATAGCGGTGCCAAGGGCGAGACTACACCCCTGCTTCTAGATGCCGACCGCGACTTTGCC
CGCGATTCTTCGACATGCCACACAGCTACCAAGTCGAGTCGGAGACTGGACCCCGTCCGCGGCGCTGCTACTGAT
GAAATGGCTGAGCGGCCTGTCAGTCCTCTTGTTGCTACTGCCACCAAGCGATCTCGCACAGCTGGAGACCTTGGC
CGTCGTCCGTCCATGTACGATGTGCACAAGCGCGTCATGTCCTTTGTCAAGGACACCAAGTGCAACTGCGATGAG
GAGGGAGACTGCTACGGCTATACCGATCCCTGTGGCCAGGAATGCTTCAAGCATCTTGCCGTGCGCCCATCAAAC
GGAAGCAACAGCGTCCGCCATGCCACGCTGCTGCGCACCACGACGGGGCCCTTTTATCCGCAGTCTGCATCTGTC
TTCCACGGAAGCACCAGTAACGGAGCCCATGAAGCTGGCAATCAGCACCAGCAGCGCCCAGATGGCACGGAGCCC
TTGAGCCCCATGTTTCGAACTAGTCGAGCTGCATCCCGCGAGCCCTTTCCTCCAGCAGAGGAGGACCGTCGGGAA
TGTATTTCTCTTCGCCGTAACAGTGTCTGCGACGGCGAGCACCTTCACAACCATGAGCTTGACAATGACACGTGT
CATGGCGATGAGCAGAATTCGCATACTGCGGAGCTGCGCTCGTGCTCGTCCATGCAAGATGGGGACATTGAAGGA
CAGCACCACCACCACGTGCCCACCAATGCCTTTCTCTCCATTGGCCTTCAGACATCGATTGCCATTGCGCTGCAC
AAGTTTCCCGAAGGCTTCATCACTTATGCCACGAATCATGCGAATCCAAAGCTCGGCTTCAATGTCTTCATGGCG
CTCTTTGTGCACAACATCACCGAGGGCTTTGCTCTGGCGCTTCCGCTTTACATGGCACTCGGCTCCCGCTGGCGC
GCCATGCTCTGGTCTGCCCTCCTTGGCGGCCTCTCTCAGCCCGTTGGCGCAGCCATTGCCGCCCTGTGGTTCCGG
CTTGCGCGCCGTACGCACATGACGCCAAATGCTGTTGCCTATGCTTGCCTATTTGCTGCAACGGCGGGCATCATG
GTGAGCGTTGCCCTGCAGCTCTTTGTTGAGAGCTTGAGCCTCAACCACAACCGTAATCTGTGCATCTTTTTTGGT
TTTATTGGCATGGCAGTATTGGGATTGAGCAACGCCCTCTTTGCTGGGCACTAA
Gene >OphauB2|6904
ATGGCCTTTACGGAGCCACAAGCCAGCATGCCTCTGGTGGCTACAGAGATGGACAATGATACCCGCGGCTGGATC
ATGTGTATTGTCAGCGGCATTGGTGCGTAATGGCTCCAAAAAAGGGAGCAAAACCCCCTCGCAACTGAGTGCTGA
CATGGCAATAGCTTGCGTTTTTGGCGCCTCCATAATATGTGTCGACGTGGTAGTTCGTCTCTTCCCCGGCAAGCA
CAATTTTCGAATCCAAGAGAGCAGCATTTTTCTCGCCTGCTCTCTCAGCCTCAGCTTTGGAGTCATGCTCTTTTC
TTCACTCTATAGCATGCTGCCAGAGTCAAAGCAGTACCTCAGGGATGAGGGCTGGGCCGACCAGCCGGCTGGCTT
CGCCATGATGGGCTGCTTCATTGGCGGCTTCATCGGAATCCAAGCCATCTCTCGATTTCTGCACCAGTACATGCC
CTCGCACGTTGTCGACTGCGACCACAGCCACGATGATGATGGTTCAACTGCCGCTGCCGCCTCTCATACCCGGCC
TTCCTCGGGCGGCCACTCGCACCGGCAGCAGTCGCGCGTCAGCAGAGCTCGCAGACGCGTCTCGAGAAATCATTC
AACTCATAGCGGTGCCAAGGGCGAGACTACACCCCTGCTTCTAGATGCCGACCGCGACTTTGCCCGCGATTCTTC
GACATGCCACACAGCTACCAAGTCGAGTCGGAGACTGGACCCCGTCCGCGGCGCTGCTACTGATGAAATGGCTGA
GCGGCCTGTCAGTCCTCTTGTTGCTACTGCCACCAAGCGATCTCGCACAGCTGGAGACCTTGGCCGTCGTCCGTC
CATGTACGATGTGCACAAGCGCGTCATGTCCTTTGTCAAGGACACCAAGTGCAACTGCGATGAGGAGGGAGACTG
CTACGGCTATACCGATCCCTGTGGCCAGGAATGCTTCAAGCATCTTGCCGTGCGCCCATCAAACGGAAGCAACAG
CGTCCGCCATGCCACGCTGCTGCGCACCACGACGGGGCCCTTTTATCCGCAGTCTGCATCTGTCTTCCACGGAAG
CACCAGTAACGGAGCCCATGAAGCTGGCAATCAGCACCAGCAGCGCCCAGATGGCACGGAGCCCTTGAGCCCCAT
GTTTCGAACTAGTCGAGCTGCATCCCGCGAGCCCTTTCCTCCAGCAGAGGAGGACCGTCGGGAATGTATTTCTCT
TCGCCGTAACAGTGTCTGCGACGGCGAGCACCTTCACAACCATGAGCTTGACAATGACACGTGTCATGGCGATGA
GCAGAATTCGCATACTGCGGAGCTGCGCTCGTGCTCGTCCATGCAAGATGGGGACATTGAAGGACAGCACCACCA
CCACGTGCCCACCAATGCCTTTCTCTCCATTGGCCTTCAGACATCGATTGCCATTGCGCTGCACAAGTTTCCCGA
AGGCTTCATCACTTATGCCACGAATCATGCGAATCCAAAGCTCGGCTTCAATGTCTTCATGGCGCTCTTTGTGCA
CAACATCACCGAGGGCTTTGCTCTGGCGCTTCCGCTTTACATGGCACTCGGCTCCCGCTGGCGCGCCATGCTCTG
GTCTGCCCTCCTTGGCGGCCTCTCTCAGCCCGTTGGCGCAGCCATTGCCGCCCTGTGGTTCCGGCTTGCGCGCCG
TACGCACATGACGCCAAATGCTGTTGCCTATGCTTGCCTATTTGCTGCAACGGCGGGCATCATGGTGAGCGTTGC
CCTGCAGCTCTTTGTTGAGAGCTTGAGCCTCAACCACAACCGTAATCTGTGCATCTTTTTTGGTTTTATTGGCAT
GGCAGTATTGGGATTGAGCAACGCCCTCTTTGCTGGGCACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail