Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6875
Gene name
LocationContig_67:101467..105440
Strand+
Gene length (bp)3973
Transcript length (bp)3915
Coding sequence length (bp)3915
Protein length (aa) 1305

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16212 PhoLip_ATPase_C Phospholipid-translocating P-type ATPase C-terminal 2.3E-44 1197 1302
PF16209 PhoLip_ATPase_N Phospholipid-translocating ATPase N-terminal 7.6E-23 204 260
PF13246 Cation_ATPase Cation transport ATPase (P-type) 3.3E-10 734 835
PF00122 E1-E2_ATPase E1-E2 ATPase 7.0E-09 355 538

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 181 1301 0.0E+00
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 181 1300 0.0E+00
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 200 836 9.0E-90
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 207 836 2.0E-89
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 207 856 1.0E-88
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 181 1301 0.0E+00
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 181 1300 0.0E+00
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 200 836 9.0E-90
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 207 836 2.0E-89
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 207 856 1.0E-88
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 201 848 1.0E-86
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 190 836 4.0E-86
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 192 848 2.0E-85
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 191 843 3.0E-85
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 207 836 3.0E-85
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 954 1302 4.0E-85
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 207 864 5.0E-85
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 207 848 7.0E-85
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 954 1302 8.0E-85
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 954 1302 2.0E-84
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 205 836 3.0E-84
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 954 1302 4.0E-84
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 207 836 4.0E-84
sp|Q9SGG3|ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana GN=ALA5 PE=3 SV=1 205 836 6.0E-84
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 139 836 1.0E-83
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 179 839 2.0E-83
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 207 836 4.0E-83
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 207 840 6.0E-83
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 961 1302 2.0E-82
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 961 1302 3.0E-82
sp|P98199|AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 207 836 7.0E-82
sp|P98198|AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 207 839 1.0E-81
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 207 836 2.0E-81
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 961 1302 2.0E-81
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 961 1304 2.0E-80
sp|Q9LVK9|ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 184 836 2.0E-80
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 965 1302 7.0E-80
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 195 836 1.0E-78
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 205 836 3.0E-78
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 207 881 7.0E-77
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 360 848 5.0E-76
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 177 845 1.0E-75
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 199 836 2.0E-75
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 951 1302 2.0E-75
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 183 836 4.0E-75
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 961 1302 8.0E-75
sp|Q9GKS6|AT10D_MACFA Probable phospholipid-transporting ATPase VD (Fragment) OS=Macaca fascicularis GN=ATP10D PE=2 SV=1 961 1302 8.0E-75
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 961 1302 2.0E-74
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 192 848 2.0E-73
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 357 836 9.0E-73
sp|P98198|AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 966 1301 2.0E-72
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 965 1301 2.0E-72
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 970 1302 2.0E-72
sp|Q9LVK9|ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 948 1302 3.0E-72
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 948 1302 7.0E-72
sp|P98199|AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 966 1301 9.0E-72
sp|Q9SGG3|ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana GN=ALA5 PE=3 SV=1 948 1302 2.0E-71
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 357 836 3.0E-71
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 966 1301 3.0E-71
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 887 1300 7.0E-71
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 965 1302 9.0E-71
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 965 1300 6.0E-70
sp|P98204|ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 207 840 1.0E-69
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 948 1302 2.0E-69
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 950 1300 4.0E-69
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 887 1300 6.0E-69
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 887 1300 1.0E-68
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 944 1300 3.0E-68
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 952 1300 5.0E-68
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 925 1300 9.0E-68
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 967 1301 3.0E-67
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 361 849 2.0E-66
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 965 1301 1.0E-65
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 201 652 2.0E-65
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 949 1301 3.0E-65
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 184 652 6.0E-65
sp|P98204|ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 970 1302 1.0E-64
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 200 850 3.0E-64
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 207 853 1.0E-62
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 965 1300 1.0E-61
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 970 1302 2.0E-60
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 207 853 3.0E-59
sp|Q9Y2G3|AT11B_HUMAN Probable phospholipid-transporting ATPase IF OS=Homo sapiens GN=ATP11B PE=1 SV=2 966 1297 2.0E-58
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 210 654 2.0E-57
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 210 654 5.0E-57
sp|Q9Y2G3|AT11B_HUMAN Probable phospholipid-transporting ATPase IF OS=Homo sapiens GN=ATP11B PE=1 SV=2 179 835 8.0E-57
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 945 1297 2.0E-56
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 945 1297 2.0E-56
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 201 644 3.0E-56
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 966 1297 6.0E-55
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 179 835 9.0E-53
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 207 836 3.0E-51
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 966 1297 1.0E-50
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 966 1297 9.0E-50
sp|O43861|ATP9B_HUMAN Probable phospholipid-transporting ATPase IIB OS=Homo sapiens GN=ATP9B PE=2 SV=4 201 884 5.0E-49
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 969 1297 2.0E-48
sp|D4ABB8|ATP9B_RAT Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 969 1297 8.0E-48
sp|P98195|ATP9B_MOUSE Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 969 1297 1.0E-47
sp|O43861|ATP9B_HUMAN Probable phospholipid-transporting ATPase IIB OS=Homo sapiens GN=ATP9B PE=2 SV=4 969 1297 3.0E-47
sp|A1A4J6|ATP9B_BOVIN Probable phospholipid-transporting ATPase IIB OS=Bos taurus GN=ATP9B PE=2 SV=1 969 1297 9.0E-47
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 1132 1302 3.0E-46
sp|A1A4J6|ATP9B_BOVIN Probable phospholipid-transporting ATPase IIB OS=Bos taurus GN=ATP9B PE=2 SV=1 201 884 5.0E-46
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 201 872 7.0E-46
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 1132 1302 9.0E-46
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 1128 1302 1.0E-45
sp|D4ABB8|ATP9B_RAT Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 201 851 3.0E-45
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 361 847 6.0E-45
sp|P98195|ATP9B_MOUSE Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 201 851 6.0E-45
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 969 1297 6.0E-45
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 969 1297 8.0E-45
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 969 1297 5.0E-43
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 969 1297 1.0E-42
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 207 861 5.0E-42
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 201 946 7.0E-42
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 201 946 3.0E-41
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 363 851 3.0E-38
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 967 1072 3.0E-20
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 967 1072 3.0E-20
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 967 1088 2.0E-19
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 199 296 6.0E-12
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 207 305 2.0E-11
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 205 296 4.0E-11
sp|Q9H7F0|AT133_HUMAN Probable cation-transporting ATPase 13A3 OS=Homo sapiens GN=ATP13A3 PE=1 SV=4 964 1285 3.0E-10
sp|Q5XF89|AT133_MOUSE Probable cation-transporting ATPase 13A3 OS=Mus musculus GN=Atp13a3 PE=1 SV=1 967 1285 4.0E-09
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 741 837 3.0E-08
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 739 951 4.0E-08
sp|Q9GKS6|AT10D_MACFA Probable phospholipid-transporting ATPase VD (Fragment) OS=Macaca fascicularis GN=ATP10D PE=2 SV=1 745 950 4.0E-08
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 747 857 8.0E-08
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 744 836 9.0E-08
sp|O14072|ATC4_SCHPO Manganese-transporting ATPase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta4 PE=3 SV=1 960 1188 9.0E-08
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 204 295 2.0E-07
sp|P9WPS5|CTPI_MYCTU Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpI PE=1 SV=1 961 1255 3.0E-07
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 745 950 4.0E-07
sp|P39986|ATC6_YEAST Manganese-transporting ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPF1 PE=1 SV=1 1008 1195 4.0E-07
sp|P9WPS4|CTPI_MYCTO Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpI PE=3 SV=1 961 1255 5.0E-07
sp|P54707|AT12A_HUMAN Potassium-transporting ATPase alpha chain 2 OS=Homo sapiens GN=ATP12A PE=1 SV=3 974 1197 9.0E-07
sp|Q9WV27|AT1A4_MOUSE Sodium/potassium-transporting ATPase subunit alpha-4 OS=Mus musculus GN=Atp1a4 PE=1 SV=3 1008 1192 1.0E-06
sp|Q21286|YBF7_CAEEL Probable cation-transporting ATPase K07E3.7 OS=Caenorhabditis elegans GN=K07E3.7/K07E3.6 PE=3 SV=4 961 1197 1.0E-06
sp|Q64541|AT1A4_RAT Sodium/potassium-transporting ATPase subunit alpha-4 OS=Rattus norvegicus GN=Atp1a4 PE=2 SV=1 1020 1192 2.0E-06
sp|Q9CTG6|AT132_MOUSE Probable cation-transporting ATPase 13A2 OS=Mus musculus GN=Atp13a2 PE=2 SV=3 1014 1193 2.0E-06
sp|P17326|AT1A_ARTSF Sodium/potassium-transporting ATPase subunit alpha-A OS=Artemia franciscana PE=2 SV=1 1022 1192 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.45

Transmembrane Domains

Domain # Start End Length
1 512 534 22
2 561 583 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6875
MASRLKHGASSRPPCHDGRTDNDGSNELAMGRSSQEEQGGSALKSLAAPLAWTRQRLAQGAKGARQSQHYELEPI
HSNVVMPTGADGQAARSSADVEAPFMEHTSHTASESKRSMTYRIKSCAQEALATSWADRVYGWNKRRNRTMARAA
SSKAQVGQGLAGLYREYIAEGLFGQGPLPASCDGRHIALNGMGGPGALLDERSGKPYKSNFIRSSRYTVYNFLPK
QLLFQFSKLGNFYFLVMGILQMIPGLSTVGRWTTIVPLGIFVAFSMAKEGYDDYRRYKLDKAENESAARVLVREE
RGRKRPSLATLMSKASMSKRSESKTGVTLEVKGDLPSRQGEEEQEQGEKQEETQQDWSEVQWQQVRVGDIVRLER
DEAVPADLVLLQASGPNGMAYIETMALDGETNLKSKQACPMLAEQCGSVAGIRATQASIVSEDPNMDLYSYEGRV
EAEEQRVALSLNNVVYRGSTLRNTQQAIGLVINSGEECKIRMNAKRGVRAKKPAMQPMINKMVLFQIVLVCALAG
GLTGGYHGWHGGTERASFYLVRAGVYDGSVPLKQVFFGYLLMFNTLIPLSLYISMEIIKIGQLLLMQDVDMYDAA
SDTPMVANTTTILENLGQVGYVFCDKTGTLTENVMRFRKLSVGGVWCWHEADEEGRSGASSDGRGEQRPTTSARG
SRAKESNGASSVAKEGNKEAMGATDEPGMRTEQLVEYIWQRPHSTFSLKAKHLLLCMALCHTCLPERNEAGDISF
QAASPDELALVEAARDMGMVLVEREAQAIVLQTRDGEGGWRRERFEVLDVVEFSSQRQRMSVIVRMPDGRICVLC
KGADSVVMSRLKLSHLAEQKARDIGRRASLRKTFEQDKALRRMSLQEAATASTPRTSLHMLRRQSADRLEGLGLS
MGRRSADIARLANSEGVATWLKSKRAPSETLHDDKEAADKEAGLTGRVDEALAANEAAVFERCFQHVDDFASQGL
RTLLFAYRYVDADLYARWKQVYRQAETSLVDRQQRIDEAAQQMEQRLELAGATAIEDKLQAGVPDTIDKLCRASI
KVWMLTGDKRETAINIAHSAHLCKPYSEIYILDATHHLLADALRATLTDVCRAMVPHSVLVLDGQTLAALDADAR
LARMLHDLLVRVDSLICCRASPAQKASLVHTLARHVPDAITLAIGDGANDIGMIQASHVGIGISGREGLQAARIA
DYSIAQFCFLQRLLLVHGRWNYLRTGKYVLATFWKEVVFFFVQAHFARANGYTGTSLYESWSLTVFNSAFTSLPV
ILLGILERDLAAETLLAVPELYTFGQRPA*
Coding >OphauB2|6875
ATGGCCTCACGCCTCAAGCATGGCGCCTCATCTCGCCCGCCATGTCACGACGGCCGGACCGACAATGACGGCAGC
AACGAGTTGGCGATGGGACGCAGCAGCCAAGAGGAGCAAGGCGGCAGCGCGCTCAAGTCTCTGGCGGCGCCGCTG
GCATGGACGAGGCAGCGGCTGGCGCAAGGGGCAAAGGGAGCGAGACAGAGCCAGCACTATGAGCTGGAGCCGATT
CACTCCAACGTGGTGATGCCGACCGGGGCGGATGGACAGGCGGCGAGGAGCAGCGCGGATGTCGAGGCGCCGTTT
ATGGAGCACACGTCGCACACGGCGAGCGAGAGCAAGAGGTCCATGACGTACCGCATCAAGTCGTGTGCGCAAGAG
GCTCTGGCTACGAGCTGGGCAGACCGCGTGTACGGATGGAACAAGCGGCGCAACAGGACCATGGCGCGTGCAGCC
AGCAGCAAGGCGCAGGTGGGCCAAGGGCTGGCGGGACTCTATCGCGAATACATTGCCGAGGGCCTCTTTGGACAG
GGCCCGCTGCCGGCGAGCTGCGACGGGCGGCACATTGCGCTAAATGGCATGGGCGGGCCGGGAGCGCTGCTTGAC
GAGCGCAGCGGCAAGCCGTACAAGAGCAACTTTATCCGGTCGAGCCGCTACACCGTGTACAACTTCTTGCCCAAG
CAGCTGCTCTTCCAGTTTAGCAAGCTGGGCAACTTTTACTTTCTCGTCATGGGCATTTTGCAAATGATTCCGGGG
CTGAGCACGGTGGGACGGTGGACGACGATTGTGCCGCTGGGGATATTTGTGGCGTTTAGCATGGCCAAGGAGGGC
TATGATGATTATCGGCGGTATAAGCTGGACAAGGCGGAGAATGAGAGTGCGGCGCGCGTCTTGGTTCGAGAGGAG
AGGGGGAGGAAGCGGCCGTCGTTGGCTACGCTCATGAGCAAGGCGAGCATGAGCAAGAGGAGCGAGAGCAAGACT
GGTGTGACGCTCGAGGTCAAGGGCGACTTGCCGTCTCGGCAGGGCGAGGAGGAGCAAGAGCAAGGGGAAAAGCAA
GAGGAAACGCAACAAGACTGGAGCGAGGTGCAGTGGCAGCAGGTGCGAGTAGGAGACATTGTACGGCTGGAGCGC
GACGAGGCGGTGCCGGCAGACTTGGTGCTGCTGCAGGCGTCGGGCCCAAACGGCATGGCATACATTGAGACGATG
GCGCTGGACGGCGAGACCAACCTCAAGAGCAAGCAGGCGTGTCCCATGCTGGCGGAGCAGTGCGGCAGCGTGGCT
GGGATTCGGGCGACACAGGCAAGCATCGTTTCGGAAGACCCCAACATGGACCTGTACAGCTACGAGGGCCGGGTG
GAGGCGGAGGAGCAGCGGGTGGCGCTGTCGCTCAACAATGTGGTGTATCGCGGGTCGACGCTGCGCAACACGCAG
CAAGCCATTGGGCTGGTGATTAACAGCGGAGAAGAGTGCAAGATTCGCATGAATGCCAAGCGCGGGGTGCGGGCC
AAGAAGCCGGCGATGCAGCCCATGATTAACAAGATGGTGCTCTTCCAAATCGTCTTGGTGTGCGCGCTGGCGGGC
GGGCTAACGGGCGGCTACCACGGCTGGCATGGCGGGACGGAGCGGGCGTCGTTTTACCTGGTGCGGGCGGGCGTC
TACGACGGCAGCGTGCCGCTCAAGCAAGTGTTTTTTGGATACCTGCTCATGTTCAACACGCTGATTCCGCTGTCG
CTGTACATTAGCATGGAGATTATCAAGATTGGGCAGCTGCTGCTGATGCAAGACGTGGACATGTATGACGCGGCC
AGCGACACGCCCATGGTGGCGAATACGACTACGATTTTGGAAAACTTGGGGCAGGTGGGCTATGTCTTTTGCGAC
AAGACGGGGACGCTGACGGAAAATGTCATGAGGTTTCGCAAGCTGAGTGTTGGGGGGGTGTGGTGTTGGCACGAG
GCTGACGAGGAGGGCCGGTCAGGGGCGAGCAGTGACGGGAGAGGCGAGCAGAGGCCGACGACGAGTGCAAGAGGG
AGCAGAGCCAAGGAGAGCAACGGGGCGAGCTCAGTGGCCAAGGAGGGCAACAAAGAGGCCATGGGGGCAACAGAC
GAGCCCGGGATGCGCACAGAGCAACTGGTCGAGTACATTTGGCAACGGCCGCACTCGACGTTTTCGCTCAAGGCC
AAGCACCTGCTGCTCTGCATGGCGCTCTGCCACACGTGTCTGCCGGAAAGAAACGAGGCCGGTGACATTAGCTTC
CAGGCAGCCTCGCCCGACGAGCTGGCGCTGGTGGAGGCGGCGCGCGACATGGGCATGGTGCTTGTGGAGCGGGAG
GCGCAGGCCATTGTGCTGCAGACACGCGACGGCGAGGGCGGATGGAGGCGAGAGCGGTTCGAGGTGCTGGACGTG
GTTGAGTTTAGCAGCCAGCGGCAGCGCATGTCGGTGATTGTGCGCATGCCCGACGGGCGCATCTGCGTGCTGTGC
AAGGGCGCCGACAGCGTCGTCATGTCGCGCCTCAAGCTGAGCCACTTGGCGGAGCAAAAGGCGCGCGACATTGGG
CGGCGCGCGAGCCTGCGCAAGACGTTTGAGCAGGACAAGGCGCTGCGGCGCATGAGCCTGCAAGAGGCAGCAACG
GCCAGCACGCCGCGCACCAGCCTGCACATGCTGCGGCGCCAGTCGGCCGACCGGCTCGAGGGTTTGGGTTTAAGC
ATGGGGCGGCGCTCGGCCGACATTGCGCGGCTGGCCAATTCGGAGGGCGTGGCAACGTGGCTCAAGAGCAAGCGC
GCGCCGTCCGAGACGCTCCATGACGACAAGGAGGCGGCAGACAAGGAGGCCGGTCTGACTGGACGCGTCGACGAG
GCCCTGGCGGCCAACGAGGCTGCCGTCTTTGAGCGCTGCTTCCAGCACGTCGACGACTTTGCCTCGCAGGGCCTG
CGCACCCTCCTCTTTGCCTACCGCTACGTCGACGCCGACTTGTATGCGCGCTGGAAGCAAGTCTACCGCCAGGCC
GAGACGAGTCTGGTGGACCGCCAGCAGCGCATCGACGAGGCGGCGCAGCAAATGGAGCAGCGGCTGGAGCTGGCG
GGCGCCACCGCTATCGAGGACAAGCTGCAGGCTGGCGTGCCCGACACCATTGACAAGCTGTGCCGCGCCAGCATC
AAGGTGTGGATGCTAACGGGCGACAAGCGCGAAACAGCCATCAACATTGCCCACTCGGCGCACCTGTGCAAGCCC
TACTCGGAGATTTATATCCTCGACGCCACCCACCACTTGCTCGCCGACGCCCTGCGCGCCACCCTGACCGACGTT
TGCCGCGCCATGGTGCCGCACTCTGTCCTTGTCCTCGACGGCCAAACCCTCGCTGCCCTCGACGCCGACGCCCGC
CTGGCGCGCATGCTGCACGACTTGCTGGTGCGCGTCGACTCGCTCATTTGCTGCCGCGCCTCGCCCGCCCAAAAG
GCCAGCCTGGTGCACACCCTGGCCCGCCACGTGCCCGACGCCATCACCCTGGCCATTGGCGACGGCGCAAACGAC
ATTGGCATGATTCAGGCCTCTCACGTTGGCATTGGCATCTCGGGCCGCGAGGGCCTGCAAGCTGCCCGCATTGCC
GACTATTCCATTGCCCAGTTTTGCTTCTTGCAGCGCTTGCTCTTGGTGCACGGCCGCTGGAATTACTTGCGCACG
GGCAAATACGTCTTGGCTACCTTTTGGAAGGAGGTTGTCTTTTTCTTCGTGCAGGCTCACTTTGCTCGCGCAAAT
GGGTATACCGGCACCTCGCTCTACGAGTCGTGGAGCCTCACCGTTTTTAATAGTGCGTTTACCTCGCTGCCTGTT
ATTCTACTCGGTATCCTTGAGCGCGACTTGGCGGCCGAGACGCTACTCGCCGTGCCGGAGCTGTATACCTTTGGC
CAGCGCCCTGCCTGA
Transcript >OphauB2|6875
ATGGCCTCACGCCTCAAGCATGGCGCCTCATCTCGCCCGCCATGTCACGACGGCCGGACCGACAATGACGGCAGC
AACGAGTTGGCGATGGGACGCAGCAGCCAAGAGGAGCAAGGCGGCAGCGCGCTCAAGTCTCTGGCGGCGCCGCTG
GCATGGACGAGGCAGCGGCTGGCGCAAGGGGCAAAGGGAGCGAGACAGAGCCAGCACTATGAGCTGGAGCCGATT
CACTCCAACGTGGTGATGCCGACCGGGGCGGATGGACAGGCGGCGAGGAGCAGCGCGGATGTCGAGGCGCCGTTT
ATGGAGCACACGTCGCACACGGCGAGCGAGAGCAAGAGGTCCATGACGTACCGCATCAAGTCGTGTGCGCAAGAG
GCTCTGGCTACGAGCTGGGCAGACCGCGTGTACGGATGGAACAAGCGGCGCAACAGGACCATGGCGCGTGCAGCC
AGCAGCAAGGCGCAGGTGGGCCAAGGGCTGGCGGGACTCTATCGCGAATACATTGCCGAGGGCCTCTTTGGACAG
GGCCCGCTGCCGGCGAGCTGCGACGGGCGGCACATTGCGCTAAATGGCATGGGCGGGCCGGGAGCGCTGCTTGAC
GAGCGCAGCGGCAAGCCGTACAAGAGCAACTTTATCCGGTCGAGCCGCTACACCGTGTACAACTTCTTGCCCAAG
CAGCTGCTCTTCCAGTTTAGCAAGCTGGGCAACTTTTACTTTCTCGTCATGGGCATTTTGCAAATGATTCCGGGG
CTGAGCACGGTGGGACGGTGGACGACGATTGTGCCGCTGGGGATATTTGTGGCGTTTAGCATGGCCAAGGAGGGC
TATGATGATTATCGGCGGTATAAGCTGGACAAGGCGGAGAATGAGAGTGCGGCGCGCGTCTTGGTTCGAGAGGAG
AGGGGGAGGAAGCGGCCGTCGTTGGCTACGCTCATGAGCAAGGCGAGCATGAGCAAGAGGAGCGAGAGCAAGACT
GGTGTGACGCTCGAGGTCAAGGGCGACTTGCCGTCTCGGCAGGGCGAGGAGGAGCAAGAGCAAGGGGAAAAGCAA
GAGGAAACGCAACAAGACTGGAGCGAGGTGCAGTGGCAGCAGGTGCGAGTAGGAGACATTGTACGGCTGGAGCGC
GACGAGGCGGTGCCGGCAGACTTGGTGCTGCTGCAGGCGTCGGGCCCAAACGGCATGGCATACATTGAGACGATG
GCGCTGGACGGCGAGACCAACCTCAAGAGCAAGCAGGCGTGTCCCATGCTGGCGGAGCAGTGCGGCAGCGTGGCT
GGGATTCGGGCGACACAGGCAAGCATCGTTTCGGAAGACCCCAACATGGACCTGTACAGCTACGAGGGCCGGGTG
GAGGCGGAGGAGCAGCGGGTGGCGCTGTCGCTCAACAATGTGGTGTATCGCGGGTCGACGCTGCGCAACACGCAG
CAAGCCATTGGGCTGGTGATTAACAGCGGAGAAGAGTGCAAGATTCGCATGAATGCCAAGCGCGGGGTGCGGGCC
AAGAAGCCGGCGATGCAGCCCATGATTAACAAGATGGTGCTCTTCCAAATCGTCTTGGTGTGCGCGCTGGCGGGC
GGGCTAACGGGCGGCTACCACGGCTGGCATGGCGGGACGGAGCGGGCGTCGTTTTACCTGGTGCGGGCGGGCGTC
TACGACGGCAGCGTGCCGCTCAAGCAAGTGTTTTTTGGATACCTGCTCATGTTCAACACGCTGATTCCGCTGTCG
CTGTACATTAGCATGGAGATTATCAAGATTGGGCAGCTGCTGCTGATGCAAGACGTGGACATGTATGACGCGGCC
AGCGACACGCCCATGGTGGCGAATACGACTACGATTTTGGAAAACTTGGGGCAGGTGGGCTATGTCTTTTGCGAC
AAGACGGGGACGCTGACGGAAAATGTCATGAGGTTTCGCAAGCTGAGTGTTGGGGGGGTGTGGTGTTGGCACGAG
GCTGACGAGGAGGGCCGGTCAGGGGCGAGCAGTGACGGGAGAGGCGAGCAGAGGCCGACGACGAGTGCAAGAGGG
AGCAGAGCCAAGGAGAGCAACGGGGCGAGCTCAGTGGCCAAGGAGGGCAACAAAGAGGCCATGGGGGCAACAGAC
GAGCCCGGGATGCGCACAGAGCAACTGGTCGAGTACATTTGGCAACGGCCGCACTCGACGTTTTCGCTCAAGGCC
AAGCACCTGCTGCTCTGCATGGCGCTCTGCCACACGTGTCTGCCGGAAAGAAACGAGGCCGGTGACATTAGCTTC
CAGGCAGCCTCGCCCGACGAGCTGGCGCTGGTGGAGGCGGCGCGCGACATGGGCATGGTGCTTGTGGAGCGGGAG
GCGCAGGCCATTGTGCTGCAGACACGCGACGGCGAGGGCGGATGGAGGCGAGAGCGGTTCGAGGTGCTGGACGTG
GTTGAGTTTAGCAGCCAGCGGCAGCGCATGTCGGTGATTGTGCGCATGCCCGACGGGCGCATCTGCGTGCTGTGC
AAGGGCGCCGACAGCGTCGTCATGTCGCGCCTCAAGCTGAGCCACTTGGCGGAGCAAAAGGCGCGCGACATTGGG
CGGCGCGCGAGCCTGCGCAAGACGTTTGAGCAGGACAAGGCGCTGCGGCGCATGAGCCTGCAAGAGGCAGCAACG
GCCAGCACGCCGCGCACCAGCCTGCACATGCTGCGGCGCCAGTCGGCCGACCGGCTCGAGGGTTTGGGTTTAAGC
ATGGGGCGGCGCTCGGCCGACATTGCGCGGCTGGCCAATTCGGAGGGCGTGGCAACGTGGCTCAAGAGCAAGCGC
GCGCCGTCCGAGACGCTCCATGACGACAAGGAGGCGGCAGACAAGGAGGCCGGTCTGACTGGACGCGTCGACGAG
GCCCTGGCGGCCAACGAGGCTGCCGTCTTTGAGCGCTGCTTCCAGCACGTCGACGACTTTGCCTCGCAGGGCCTG
CGCACCCTCCTCTTTGCCTACCGCTACGTCGACGCCGACTTGTATGCGCGCTGGAAGCAAGTCTACCGCCAGGCC
GAGACGAGTCTGGTGGACCGCCAGCAGCGCATCGACGAGGCGGCGCAGCAAATGGAGCAGCGGCTGGAGCTGGCG
GGCGCCACCGCTATCGAGGACAAGCTGCAGGCTGGCGTGCCCGACACCATTGACAAGCTGTGCCGCGCCAGCATC
AAGGTGTGGATGCTAACGGGCGACAAGCGCGAAACAGCCATCAACATTGCCCACTCGGCGCACCTGTGCAAGCCC
TACTCGGAGATTTATATCCTCGACGCCACCCACCACTTGCTCGCCGACGCCCTGCGCGCCACCCTGACCGACGTT
TGCCGCGCCATGGTGCCGCACTCTGTCCTTGTCCTCGACGGCCAAACCCTCGCTGCCCTCGACGCCGACGCCCGC
CTGGCGCGCATGCTGCACGACTTGCTGGTGCGCGTCGACTCGCTCATTTGCTGCCGCGCCTCGCCCGCCCAAAAG
GCCAGCCTGGTGCACACCCTGGCCCGCCACGTGCCCGACGCCATCACCCTGGCCATTGGCGACGGCGCAAACGAC
ATTGGCATGATTCAGGCCTCTCACGTTGGCATTGGCATCTCGGGCCGCGAGGGCCTGCAAGCTGCCCGCATTGCC
GACTATTCCATTGCCCAGTTTTGCTTCTTGCAGCGCTTGCTCTTGGTGCACGGCCGCTGGAATTACTTGCGCACG
GGCAAATACGTCTTGGCTACCTTTTGGAAGGAGGTTGTCTTTTTCTTCGTGCAGGCTCACTTTGCTCGCGCAAAT
GGGTATACCGGCACCTCGCTCTACGAGTCGTGGAGCCTCACCGTTTTTAATAGTGCGTTTACCTCGCTGCCTGTT
ATTCTACTCGGTATCCTTGAGCGCGACTTGGCGGCCGAGACGCTACTCGCCGTGCCGGAGCTGTATACCTTTGGC
CAGCGCCCTGCCTGA
Gene >OphauB2|6875
ATGGCCTCACGCCTCAAGCATGGCGCCTCATCTCGCCCGCCATGTCACGACGGCCGGACCGACAATGACGGCAGC
AACGAGTTGGCGATGGGACGCAGCAGCCAAGAGGAGCAAGGCGGCAGCGCGCTCAAGTCTCTGGCGGCGCCGCTG
GCATGGACGAGGCAGCGGCTGGCGCAAGGGGCAAAGGGAGCGAGACAGAGCCAGCACTATGAGCTGGAGCCGATT
CACTCCAACGTGGTGATGCCGACCGGGGCGGATGGACAGGCGGCGAGGAGCAGCGCGGATGTCGAGGCGCCGTTT
ATGGAGCACACGTCGCACACGGCGAGCGAGAGCAAGAGGTCCATGACGTACCGCATCAAGTCGTGTGCGCAAGAG
GCTCTGGCTACGAGCTGGGCAGACCGCGTGTACGGATGGAACAAGCGGCGCAACAGGACCATGGCGCGTGCAGCC
AGCAGCAAGGCGCAGGTGGGCCAAGGGCTGGCGGGACTCTATCGCGAATACATTGCCGAGGGCCTCTTTGGACAG
GGCCCGCTGCCGGCGAGCTGCGACGGGCGGCACATTGCGCTAAATGGCATGGGCGGGCCGGGAGCGCTGCTTGAC
GAGCGCAGCGGCAAGCCGTACAAGAGCAACTTTATCCGGTCGAGCCGCTACACCGTGTACAACTTCTTGCCCAAG
CAGCTGCTCTTCCAGTTTAGCAAGCTGGGCAACTTTTACTTTCTCGTCATGGGCATTTTGCAAATGATTCCGGGG
CTGAGCACGGTGGGACGGTGGACGACGATTGTGCCGCTGGGGATATTTGTGGCGTTTAGCATGGCCAAGGAGGGC
TATGATGATTATCGGCGGTATAAGCTGGACAAGGCGGAGAATGAGAGTGCGGCGCGCGTCTTGGTTCGAGAGGAG
AGGGGGAGGAAGCGGCCGTCGTTGGCTACGCTCATGAGCAAGGCGAGCATGAGCAAGAGGAGCGAGAGCAAGACT
GGTGTGACGCTCGAGGTCAAGGGCGACTTGCCGTCTCGGCAGGGCGAGGAGGAGCAAGAGCAAGGGGAAAAGCAA
GAGGAAACGCAACAAGACTGGAGCGAGGTGCAGTGGCAGCAGGTGCGAGTAGGAGACATTGTACGGCTGGAGCGC
GACGAGGCGGTGCCGGCAGACTTGGTGCTGCTGCAGGCGTCGGGCCCAAACGGCATGGCATACATTGAGACGATG
GCGCTGGACGGCGAGACCAACCTCAAGAGCAAGCAGGCGTGTCCCATGCTGGCGGAGCAGTGCGGCAGCGTGGCT
GGGATTCGGGCGACACAGGCAAGCATCGTTTCGGAAGACCCCAACATGGACCTGTACAGCTACGAGGGCCGGGTG
GAGGCGGAGGAGCAGCGGGTGGCGCTGTCGCTCAACAATGTGGTGTATCGCGGGTCGACGCTGCGCAACACGCAG
CAAGCCATTGGGCTGGTGATTAACAGCGGAGAAGAGTGCAAGATTCGCATGAATGCCAAGCGCGGGGTGCGGGCC
AAGAAGCCGGCGATGCAGCCCATGATTAACAAGATGGTGCTCTTCCAAATCGTCTTGGTGTGCGCGCTGGCGGGC
GGGCTAACGGGCGGCTACCACGGCTGGCATGGCGGGACGGAGCGGGCGTCGTTTTACCTGGTGCGGGCGGGCGTC
TACGACGGCAGCGTGCCGCTCAAGCAAGTGTTTTTTGGATACCTGCTCATGTTCAACACGCTGATTCCGCTGTCG
CTGTACATTAGCATGGAGATTATCAAGATTGGGCAGCTGCTGCTGATGCAAGACGTGGACATGTATGACGCGGCC
AGCGACACGCCCATGGTGGCGAATACGACTACGATTTTGGAAAACTTGGGGCAGGTGGGCTATGTCTTTTGCGAC
AAGACGGGGACGCTGACGGAAAATGTCATGAGGTTTCGCAAGCTGAGTGTTGGGGGGGTGTGGTGTTGGCACGAG
GCTGACGAGGAGGGCCGGTCAGGGGCGAGCAGTGACGGGAGAGGCGAGCAGAGGCCGACGACGAGTGCAAGAGGG
AGCAGAGCCAAGGAGAGCAACGGGGCGAGCTCAGTGGCCAAGGAGGGCAACAAAGAGGCCATGGGGGCAACAGAC
GAGCCCGGGATGCGCACAGAGCAACTGGTCGAGTACATTTGGCAACGGCCGCACTCGACGTTTTCGCTCAAGGCC
AAGCACCTGCTGCTCTGCATGGCGCTCTGCCACACGTGTCTGCCGGAAAGAAACGAGGCCGGTGACATTAGCTTC
CAGGCAGCCTCGCCCGACGAGCTGGCGCTGGTGGAGGCGGCGCGCGACATGGGCATGGTGCTTGTGGAGCGGGAG
GCGCAGGCCATTGTGCTGCAGACACGCGACGGCGAGGGCGGATGGAGGCGAGAGCGGTTCGAGGTGCTGGACGTG
GTTGAGTTTAGCAGCCAGCGGCAGCGCATGTCGGTGATTGTGCGCATGCCCGACGGGCGCATCTGCGTGCTGTGC
AAGGGCGCCGACAGCGTCGTCATGTCGCGCCTCAAGCTGAGCCACTTGGCGGAGCAAAAGGCGCGCGACATTGGG
CGGCGCGCGAGCCTGCGCAAGACGTTTGAGCAGGACAAGGCGCTGCGGCGCATGAGCCTGCAAGAGGCAGCAACG
GCCAGCACGCCGCGCACCAGCCTGCACATGCTGCGGCGCCAGTCGGCCGACCGGCTCGAGGGTTTGGGTTTAAGC
ATGGGGCGGCGCTCGGCCGACATTGCGCGGCTGGCCAATTCGGAGGGCGTGGCAACGTGGCTCAAGAGCAAGCGC
GCGCCGTCCGAGACGCTCCATGACGACAAGGAGGCGGCAGACAAGGAGGCCGGTCTGACTGGACGCGTCGACGAG
GCCCTGGCGGCCAACGAGGCTGCCGTCTTTGAGCGCTGCTTCCAGCACGTCGACGACTTTGCCTCGCAGGGCCTG
CGCACCCTCCTCTTTGCCTACCGCTACGTCGACGCCGACTTGTATGCGCGCTGGAAGCAAGTCTACCGCCAGGCC
GAGACGAGTCTGGTGGACCGCCAGCAGCGCATCGACGAGGCGGCGCAGCAAATGGAGCAGCGGCTGGAGCTGGCG
GGCGCCACCGCTATCGAGGACAAGCTGCAGGCTGGCGTGCCCGACACCATTGACAAGCTGTGCCGCGCCAGCATC
AAGGTGTGGATGCTAACGGGCGACAAGCGCGAAACAGCCATCAACATTGCCCACTCGGCGCACCTGTGCAAGCCC
TACTCGGAGATTTATATCCTCGACGCCACCCACCACTTGCTCGCCGACGCCCTGCGCGCCACCCTGACCGACGTT
TGCCGCGCCATGGTGCCGCACTCTGTCCTTGTCCTCGACGGCCAAACCCTCGCTGCCCTCGACGCCGACGCCCGC
CTGGCGCGCATGCTGCACGACTTGCTGGTGCGCGTCGACTCGCTCATTTGCTGCCGCGCCTCGCCCGCCCAAAAG
GCCAGCCTGGTGCACACCCTGGCCCGCCACGTGCCCGACGCCATCACCCTGGCCATTGGCGACGGCGCAAACGAC
ATTGGCATGATTCAGGCCTCTCACGTTGGCATTGGCATCTCGGGCCGCGAGGGCCTGCAAGCTGCCCGCATTGCC
GACTATTCCATTGCCCAGTTTTGCTTCTTGCAGCGCTTGCTCTTGGTGCACGGCCGCTGGAATTACTTGCGCACG
GGCAAATACGTCTTGGCTACCTTTTGGAAGGAGGTTGTCTTTTTCTTCGTGCAGGCTCACTTTGCTCGCGCAAAT
GGGTATACCGGCACCTCGCTCTACGAGTCGTGGAGCCTCACCGTTTTTAATAGTGCGTTTACCTCGCTGCCTGTT
ATTCTACTCGGTATCCTTGAGCGCGACTTGGCGGCCGAGACGCTACTCGCCGTGCCGGAGCTGTATACCTTTGGC
CAGCGCCGTCTAGCCTTGAATTACGCCTTGTATTTTGGCTGGCTGGCCATGGGCGTGCTGGGCAGCTGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail