Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6874
Gene name
LocationContig_67:97194..99192
Strand+
Gene length (bp)1998
Transcript length (bp)1869
Coding sequence length (bp)1869
Protein length (aa) 623

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00046 Homeodomain Homeodomain 1.5E-18 71 125

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99160|HOY1_YARLI Homeobox protein HOY1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HOY1 PE=3 SV=2 56 137 2.0E-17
sp|Q10328|PHX1_SCHPO Homeobox transcription factor phx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=phx1 PE=3 SV=1 11 172 5.0E-14
sp|Q8SW18|HD10_ENCCU Homeobox protein HD-10 OS=Encephalitozoon cuniculi (strain GB-M1) GN=HD-10 PE=3 SV=1 73 140 1.0E-13
sp|Q10328|PHX1_SCHPO Homeobox transcription factor phx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=phx1 PE=3 SV=1 192 338 7.0E-12
sp|Q99160|HOY1_YARLI Homeobox protein HOY1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HOY1 PE=3 SV=2 199 324 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99160|HOY1_YARLI Homeobox protein HOY1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HOY1 PE=3 SV=2 56 137 2.0E-17
sp|Q10328|PHX1_SCHPO Homeobox transcription factor phx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=phx1 PE=3 SV=1 11 172 5.0E-14
sp|Q8SW18|HD10_ENCCU Homeobox protein HD-10 OS=Encephalitozoon cuniculi (strain GB-M1) GN=HD-10 PE=3 SV=1 73 140 1.0E-13
sp|Q10328|PHX1_SCHPO Homeobox transcription factor phx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=phx1 PE=3 SV=1 192 338 7.0E-12
sp|Q99160|HOY1_YARLI Homeobox protein HOY1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HOY1 PE=3 SV=2 199 324 2.0E-10
sp|P07269|PHO2_YEAST Regulatory protein PHO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO2 PE=1 SV=1 72 251 1.0E-09
sp|Q54PU1|HBX10_DICDI Homeobox protein 10 OS=Dictyostelium discoideum GN=hbx10 PE=3 SV=1 71 125 3.0E-09
sp|Q93356|HM37_CAEEL Homeobox protein ceh-37 OS=Caenorhabditis elegans GN=ceh-37 PE=1 SV=2 69 130 5.0E-09
sp|P34161|YOX1_YEAST Homeobox protein YOX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOX1 PE=1 SV=2 71 125 6.0E-09
sp|P39021|MEOX2_XENLA Homeobox protein MOX-2 OS=Xenopus laevis GN=meox2 PE=2 SV=2 26 127 9.0E-09
sp|A2T777|HESX1_PANTR Homeobox expressed in ES cells 1 OS=Pan troglodytes GN=HESX1 PE=3 SV=1 53 135 1.0E-08
sp|A1YGA2|HESX1_PANPA Homeobox expressed in ES cells 1 OS=Pan paniscus GN=HESX1 PE=3 SV=1 53 135 1.0E-08
sp|Q9UBX0|HESX1_HUMAN Homeobox expressed in ES cells 1 OS=Homo sapiens GN=HESX1 PE=1 SV=1 53 135 1.0E-08
sp|Q8N693|ESX1_HUMAN Homeobox protein ESX1 OS=Homo sapiens GN=ESX1 PE=1 SV=3 49 125 2.0E-08
sp|Q28EM7|OTX5_XENTR Homeobox protein otx5 OS=Xenopus tropicalis GN=otx5 PE=2 SV=1 69 125 2.0E-08
sp|Q91994|OTX1B_DANRE Homeobox protein OTX1 B OS=Danio rerio GN=otx1b PE=2 SV=1 69 125 3.0E-08
sp|Q6DKN2|OTX2B_XENLA Homeobox protein OTX2-B OS=Xenopus laevis GN=otx2-b PE=2 SV=1 69 125 3.0E-08
sp|Q91813|OTX2A_XENLA Homeobox protein OTX2-A OS=Xenopus laevis GN=otx2-a PE=1 SV=1 69 125 3.0E-08
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 71 130 3.0E-08
sp|P32242|OTX1_HUMAN Homeobox protein OTX1 OS=Homo sapiens GN=OTX1 PE=1 SV=1 69 125 3.0E-08
sp|Q26417|OTX_STRPU Homeobox protein OTX OS=Strongylocentrotus purpuratus GN=OTX PE=2 SV=1 53 125 3.0E-08
sp|Q63410|OTX1_RAT Homeobox protein OTX1 OS=Rattus norvegicus GN=Otx1 PE=2 SV=1 69 125 3.0E-08
sp|Q94398|HM08_CAEEL Homeobox protein ceh-8 OS=Caenorhabditis elegans GN=ceh-8 PE=3 SV=3 60 151 3.0E-08
sp|Q9PVM0|OTX5A_XENLA Homeobox protein otx5-A OS=Xenopus laevis GN=otx5-a PE=2 SV=1 69 125 3.0E-08
sp|Q9PT61|OTX5B_XENLA Homeobox protein otx5-B OS=Xenopus laevis GN=otx5-b PE=2 SV=1 69 125 4.0E-08
sp|Q28FN6|OTX2_XENTR Homeobox protein OTX2 OS=Xenopus tropicalis GN=otx2 PE=2 SV=1 69 125 4.0E-08
sp|Q91981|OTX2_DANRE Homeobox protein OTX2 OS=Danio rerio GN=otx2 PE=2 SV=1 69 125 4.0E-08
sp|P80206|OTX2_MOUSE Homeobox protein OTX2 OS=Mus musculus GN=Otx2 PE=1 SV=1 69 125 4.0E-08
sp|P80205|OTX1_MOUSE Homeobox protein OTX1 OS=Mus musculus GN=Otx1 PE=2 SV=1 69 125 4.0E-08
sp|P32243|OTX2_HUMAN Homeobox protein OTX2 OS=Homo sapiens GN=OTX2 PE=1 SV=1 69 125 4.0E-08
sp|P22810|HMOC_DROME Homeotic protein ocelliless OS=Drosophila melanogaster GN=oc PE=2 SV=2 69 125 7.0E-08
sp|O97670|HESX1_RABIT Homeobox expressed in ES cells 1 (Fragment) OS=Oryctolagus cuniculus GN=HESX1 PE=2 SV=1 53 131 8.0E-08
sp|Q90963|PRRX2_CHICK Paired mesoderm homeobox protein 2 (Fragment) OS=Gallus gallus GN=PRRX2 PE=2 SV=1 79 131 9.0E-08
sp|Q99811|PRRX2_HUMAN Paired mesoderm homeobox protein 2 OS=Homo sapiens GN=PRRX2 PE=2 SV=2 80 131 9.0E-08
sp|Q05437|PRRX1_CHICK Paired mesoderm homeobox protein 1 OS=Gallus gallus GN=PRRX1 PE=1 SV=2 80 131 1.0E-07
sp|Q9WUI0|MIXL1_MOUSE Homeobox protein MIXL1 OS=Mus musculus GN=Mixl1 PE=1 SV=1 31 133 1.0E-07
sp|P63014|PRRX1_RAT Paired mesoderm homeobox protein 1 OS=Rattus norvegicus GN=Prrx1 PE=1 SV=1 80 131 1.0E-07
sp|P63013|PRRX1_MOUSE Paired mesoderm homeobox protein 1 OS=Mus musculus GN=Prrx1 PE=1 SV=1 80 131 1.0E-07
sp|F1NEA7|DMBX1_CHICK Diencephalon/mesencephalon homeobox protein 1 OS=Gallus gallus GN=DMBX1 PE=2 SV=2 67 140 1.0E-07
sp|Q06348|PRRX2_MOUSE Paired mesoderm homeobox protein 2 OS=Mus musculus GN=Prrx2 PE=2 SV=2 80 131 1.0E-07
sp|P54821|PRRX1_HUMAN Paired mesoderm homeobox protein 1 OS=Homo sapiens GN=PRRX1 PE=1 SV=2 80 131 1.0E-07
sp|Q61658|HESX1_MOUSE Homeobox expressed in ES cells 1 OS=Mus musculus GN=Hesx1 PE=2 SV=2 61 131 1.0E-07
sp|Q91685|MIX2_XENLA Homeobox protein Mix.2 OS=Xenopus laevis GN=mix-b PE=2 SV=1 47 133 1.0E-07
sp|O18381|PAX6_DROME Paired box protein Pax-6 OS=Drosophila melanogaster GN=ey PE=2 SV=3 46 129 1.0E-07
sp|Q9W5Z2|PITX2_DANRE Pituitary homeobox 2 OS=Danio rerio GN=pitx2 PE=2 SV=1 40 125 1.0E-07
sp|P23397|HMEN_HELTR Homeobox protein Ht-En (Fragment) OS=Helobdella triserialis GN=HT-EN PE=3 SV=1 67 125 2.0E-07
sp|Q8JI10|DMX1A_DANRE Diencephalon/mesencephalon homeobox protein 1-A OS=Danio rerio GN=dmbx1a PE=2 SV=1 67 140 2.0E-07
sp|O35160|PITX3_MOUSE Pituitary homeobox 3 OS=Mus musculus GN=Pitx3 PE=1 SV=1 68 125 2.0E-07
sp|P81062|PITX3_RAT Pituitary homeobox 3 OS=Rattus norvegicus GN=Pitx3 PE=1 SV=2 68 125 2.0E-07
sp|O75364|PITX3_HUMAN Pituitary homeobox 3 OS=Homo sapiens GN=PITX3 PE=1 SV=1 68 125 2.0E-07
sp|A9ZPC9|HMEN_LYMST Homeobox protein engrailed OS=Lymnaea stagnalis GN=EN PE=2 SV=1 57 157 2.0E-07
sp|Q9W751|PITX1_XENLA Pituitary homeobox 1 OS=Xenopus laevis GN=pitx1 PE=2 SV=1 50 125 2.0E-07
sp|O18400|PITX_DROME Pituitary homeobox homolog Ptx1 OS=Drosophila melanogaster GN=Ptx1 PE=2 SV=2 66 125 2.0E-07
sp|P24341|HXD10_CHICK Homeobox protein Hox-D10 (Fragment) OS=Gallus gallus GN=HOXD10 PE=2 SV=2 59 131 2.0E-07
sp|Q9PWL6|HXA9A_DANRE Homeobox protein Hox-A9a OS=Danio rerio GN=hoxa9a PE=2 SV=2 71 137 3.0E-07
sp|Q9PWR3|PITX2_XENLA Pituitary homeobox 2 OS=Xenopus laevis GN=pitx2 PE=2 SV=1 30 125 3.0E-07
sp|P09022|HXA1_MOUSE Homeobox protein Hox-A1 OS=Mus musculus GN=Hoxa1 PE=1 SV=2 19 132 3.0E-07
sp|P70314|PITX1_MOUSE Pituitary homeobox 1 OS=Mus musculus GN=Pitx1 PE=2 SV=2 67 125 3.0E-07
sp|Q99NA7|PITX1_RAT Pituitary homeobox 1 OS=Rattus norvegicus GN=Pitx1 PE=2 SV=1 67 125 3.0E-07
sp|P78337|PITX1_HUMAN Pituitary homeobox 1 OS=Homo sapiens GN=PITX1 PE=1 SV=2 67 125 3.0E-07
sp|P49639|HXA1_HUMAN Homeobox protein Hox-A1 OS=Homo sapiens GN=HOXA1 PE=1 SV=2 19 132 3.0E-07
sp|P56673|PITX1_CHICK Pituitary homeobox 1 OS=Gallus gallus GN=PITX1 PE=2 SV=1 67 125 3.0E-07
sp|Q1KKZ6|HXADB_TAKRU Homeobox protein Hox-A13b OS=Takifugu rubripes GN=hoxa13b PE=3 SV=1 43 130 3.0E-07
sp|P50222|MEOX2_HUMAN Homeobox protein MOX-2 OS=Homo sapiens GN=MEOX2 PE=1 SV=2 38 127 4.0E-07
sp|Q9XSK0|CRX_BOVIN Cone-rod homeobox protein OS=Bos taurus GN=CRX PE=1 SV=1 69 124 4.0E-07
sp|O43248|HXC11_HUMAN Homeobox protein Hox-C11 OS=Homo sapiens GN=HOXC11 PE=1 SV=1 43 133 4.0E-07
sp|Q9I8K3|PITX3_XENLA Pituitary homeobox 3 OS=Xenopus laevis GN=pitx3 PE=2 SV=1 68 125 4.0E-07
sp|P52729|HME2A_XENLA Homeobox protein engrailed-2-A OS=Xenopus laevis GN=en2-a PE=2 SV=1 57 125 4.0E-07
sp|P47237|PAX6_CHICK Paired box protein Pax-6 (Fragment) OS=Gallus gallus GN=PAX6 PE=1 SV=1 66 129 4.0E-07
sp|A6NNA5|DRGX_HUMAN Dorsal root ganglia homeobox protein OS=Homo sapiens GN=DRGX PE=3 SV=1 68 125 4.0E-07
sp|Q62798|DRGX_RAT Dorsal root ganglia homeobox protein OS=Rattus norvegicus GN=Drgx PE=2 SV=1 68 125 4.0E-07
sp|Q9R0W1|PITX2_RAT Pituitary homeobox 2 OS=Rattus norvegicus GN=Pitx2 PE=2 SV=1 67 125 4.0E-07
sp|Q6QU75|PITX3_DANRE Pituitary homeobox 3 OS=Danio rerio GN=pitx3 PE=2 SV=1 68 125 4.0E-07
sp|Q8BYH0|DRGX_MOUSE Dorsal root ganglia homeobox protein OS=Mus musculus GN=Drgx PE=1 SV=2 68 125 4.0E-07
sp|O93385|PITX2_CHICK Pituitary homeobox 2 OS=Gallus gallus GN=PITX2 PE=2 SV=1 67 125 5.0E-07
sp|Q9PWD5|HXA9_MORSA Homeobox protein Hox-A9 OS=Morone saxatilis GN=hoxa9 PE=3 SV=1 19 129 6.0E-07
sp|Q9PVX0|RX2_CHICK Retinal homeobox protein Rx2 OS=Gallus gallus GN=RX2 PE=2 SV=1 36 140 6.0E-07
sp|Q96QS3|ARX_HUMAN Homeobox protein ARX OS=Homo sapiens GN=ARX PE=1 SV=1 64 134 6.0E-07
sp|Q9BZM3|GSX2_HUMAN GS homeobox 2 OS=Homo sapiens GN=GSX2 PE=2 SV=2 32 129 6.0E-07
sp|A6YP92|ARX_RAT Homeobox protein ARX OS=Rattus norvegicus GN=Arx PE=2 SV=1 64 134 7.0E-07
sp|P55864|PAX6_XENLA Paired box protein Pax-6 OS=Xenopus laevis GN=pax6 PE=2 SV=1 52 129 7.0E-07
sp|Q99697|PITX2_HUMAN Pituitary homeobox 2 OS=Homo sapiens GN=PITX2 PE=1 SV=2 67 125 7.0E-07
sp|P31316|GSX2_MOUSE GS homeobox 2 OS=Mus musculus GN=Gsx2 PE=1 SV=2 65 129 7.0E-07
sp|P97474|PITX2_MOUSE Pituitary homeobox 2 OS=Mus musculus GN=Pitx2 PE=1 SV=2 67 125 8.0E-07
sp|Q1LZF1|PAX6_BOVIN Paired box protein Pax-6 OS=Bos taurus GN=PAX6 PE=2 SV=1 52 129 8.0E-07
sp|P79775|ANF1_CHICK Homeobox protein ANF-1 OS=Gallus gallus PE=2 SV=2 61 131 8.0E-07
sp|P26630|PAX6_DANRE Paired box protein Pax-6 OS=Danio rerio GN=pax6a PE=2 SV=1 52 129 8.0E-07
sp|P47238|PAX6_COTJA Paired box protein Pax-6 OS=Coturnix coturnix japonica GN=PAX6 PE=2 SV=1 52 129 8.0E-07
sp|P63015|PAX6_MOUSE Paired box protein Pax-6 OS=Mus musculus GN=Pax6 PE=1 SV=1 52 129 8.0E-07
sp|P26367|PAX6_HUMAN Paired box protein Pax-6 OS=Homo sapiens GN=PAX6 PE=1 SV=2 52 129 8.0E-07
sp|A2T764|MSX2_PANTR Homeobox protein MSX-2 OS=Pan troglodytes GN=MSX2 PE=3 SV=1 59 133 8.0E-07
sp|P63016|PAX6_RAT Paired box protein Pax-6 OS=Rattus norvegicus GN=Pax6 PE=2 SV=1 52 129 9.0E-07
sp|O73917|PAX6_ORYLA Paired box protein Pax-6 OS=Oryzias latipes GN=pax6 PE=2 SV=1 52 129 1.0E-06
sp|P09082|GSB_DROME Protein gooseberry OS=Drosophila melanogaster GN=gsb PE=2 SV=1 65 125 1.0E-06
sp|O35085|ARX_MOUSE Homeobox protein ARX OS=Mus musculus GN=Arx PE=1 SV=3 64 134 1.0E-06
sp|Q9IA26|HXA9_HETFR Homeobox protein Hox-A9 OS=Heterodontus francisci GN=HOXA9 PE=3 SV=1 30 130 1.0E-06
sp|O97581|LHX3_PIG LIM/homeobox protein Lhx3 (Fragment) OS=Sus scrofa GN=LHX3 PE=2 SV=1 73 131 1.0E-06
sp|Q03358|MSX2_MOUSE Homeobox protein MSX-2 OS=Mus musculus GN=Msx2 PE=1 SV=2 59 133 1.0E-06
sp|Q5UP03|Y749_MIMIV Putative homeobox protein R749 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R749 PE=3 SV=1 72 135 1.0E-06
sp|P23410|MSX2_COTJA Homeobox protein MSX-2 OS=Coturnix coturnix japonica GN=MSX2 PE=2 SV=1 59 133 1.0E-06
sp|O08656|HXA1_RAT Homeobox protein Hox-A1 OS=Rattus norvegicus GN=Hoxa1 PE=2 SV=1 19 132 1.0E-06
sp|Q9GK08|MSX2_CANLF Homeobox protein MSX-2 OS=Canis lupus familiaris GN=MSX2 PE=2 SV=1 59 133 1.0E-06
sp|P21711|MIX1_XENLA Homeobox protein Mix.1 OS=Xenopus laevis GN=mix-a PE=2 SV=2 47 133 1.0E-06
sp|P52953|MSX2_RAT Homeobox protein MSX-2 (Fragment) OS=Rattus norvegicus GN=Msx2 PE=3 SV=1 59 133 1.0E-06
sp|Q1KKZ5|HXABB_TAKRU Homeobox protein Hox-A11b OS=Takifugu rubripes GN=hoxa11b PE=3 SV=1 19 133 2.0E-06
sp|P28362|MSX2_CHICK Homeobox protein MSX-2 OS=Gallus gallus GN=MSX2 PE=2 SV=2 59 133 2.0E-06
sp|P02831|HXA3_MOUSE Homeobox protein Hox-A3 OS=Mus musculus GN=Hoxa3 PE=1 SV=2 38 129 2.0E-06
sp|A1A546|ISX_MOUSE Intestine-specific homeobox OS=Mus musculus GN=Isx PE=2 SV=2 53 129 2.0E-06
sp|A1YG93|MSX2_PANPA Homeobox protein MSX-2 OS=Pan paniscus GN=MSX2 PE=3 SV=1 59 133 2.0E-06
sp|P35548|MSX2_HUMAN Homeobox protein MSX-2 OS=Homo sapiens GN=MSX2 PE=1 SV=3 59 133 2.0E-06
sp|A1YF16|MSX2_GORGO Homeobox protein MSX-2 OS=Gorilla gorilla gorilla GN=MSX2 PE=3 SV=1 59 133 2.0E-06
sp|P50481|LHX3_MOUSE LIM/homeobox protein Lhx3 OS=Mus musculus GN=Lhx3 PE=1 SV=1 73 131 2.0E-06
sp|Q1LVQ7|ALX1_DANRE ALX homeobox protein 1 OS=Danio rerio GN=alx1 PE=2 SV=1 62 125 2.0E-06
sp|Q1KKT0|HXDAA_TAKRU Homeobox protein Hox-D10a OS=Takifugu rubripes GN=hoxd10a PE=3 SV=1 15 131 2.0E-06
sp|Q0P5C3|MSX2_BOVIN Homeobox protein MSX-2 OS=Bos taurus GN=MSX2 PE=2 SV=1 59 133 2.0E-06
sp|P53412|LHX3_CHICK LIM/homeobox protein Lhx3 OS=Gallus gallus GN=LHX3 PE=2 SV=1 73 131 2.0E-06
sp|Q62066|PHX2A_MOUSE Paired mesoderm homeobox protein 2A OS=Mus musculus GN=Phox2a PE=2 SV=1 59 125 2.0E-06
sp|Q90267|OTX1A_DANRE Homeobox protein OTX1 A OS=Danio rerio GN=otx1a PE=2 SV=1 80 125 2.0E-06
sp|P50209|HXA9_AMBME Homeobox protein Hox-A9 (Fragment) OS=Ambystoma mexicanum GN=HOXA9 PE=2 SV=1 7 129 2.0E-06
sp|Q62782|PHX2A_RAT Paired mesoderm homeobox protein 2A OS=Rattus norvegicus GN=Phox2a PE=2 SV=1 59 125 2.0E-06
sp|Q91898|HESXB_XENLA Homeobox expressed in ES cells 1-B OS=Xenopus laevis GN=hesx1-b PE=1 SV=2 61 131 2.0E-06
sp|Q9IA15|HXD11_HETFR Homeobox protein Hox-D11 OS=Heterodontus francisci GN=HOXD11 PE=3 SV=1 5 132 2.0E-06
sp|Q9I9D5|RX1_ASTFA Retinal homeobox protein Rx1 OS=Astyanax fasciatus GN=rx1 PE=2 SV=1 52 129 2.0E-06
sp|Q801E1|VAX2_DANRE Ventral anterior homeobox 2 OS=Danio rerio GN=vax2 PE=2 SV=1 72 161 2.0E-06
sp|Q06453|AL_DROME Homeobox protein aristaless OS=Drosophila melanogaster GN=al PE=1 SV=2 68 129 2.0E-06
sp|Q9PVY0|RX1_CHICK Retinal homeobox protein Rx1 OS=Gallus gallus GN=RX1 PE=2 SV=1 58 129 2.0E-06
sp|A6NLW8|DUXA_HUMAN Double homeobox protein A OS=Homo sapiens GN=DUXA PE=3 SV=1 73 123 2.0E-06
sp|Q08DG7|HXA3_BOVIN Homeobox protein Hox-A3 OS=Bos taurus GN=HOXA3 PE=2 SV=1 38 129 2.0E-06
sp|P09083|GSBN_DROME Protein gooseberry-neuro OS=Drosophila melanogaster GN=gsb-n PE=1 SV=2 11 125 2.0E-06
sp|O14813|PHX2A_HUMAN Paired mesoderm homeobox protein 2A OS=Homo sapiens GN=PHOX2A PE=1 SV=2 67 125 2.0E-06
sp|P53406|ISL2A_DANRE Insulin gene enhancer protein isl-2a OS=Danio rerio GN=isl2a PE=2 SV=1 55 132 2.0E-06
sp|P36200|LHX3_XENLA LIM/homeobox protein Lhx3 OS=Xenopus laevis GN=lhx3 PE=1 SV=1 73 131 2.0E-06
sp|P52730|HME2B_XENLA Homeobox protein engrailed-2-B OS=Xenopus laevis GN=en2-b PE=2 SV=1 57 125 3.0E-06
sp|O42567|RXB_XENLA Retinal homeobox protein Rx-B OS=Xenopus laevis GN=rax-b PE=2 SV=2 29 140 3.0E-06
sp|Q9H2W2|MIXL1_HUMAN Homeobox protein MIXL1 OS=Homo sapiens GN=MIXL1 PE=1 SV=1 69 133 3.0E-06
sp|P35993|HOX7P_XENLA Homeobox protein XHOX-7.1' (Fragment) OS=Xenopus laevis PE=2 SV=1 43 133 3.0E-06
sp|Q9NZR4|VSX1_HUMAN Visual system homeobox 1 OS=Homo sapiens GN=VSX1 PE=1 SV=2 38 130 3.0E-06
sp|Q9Y2V3|RX_HUMAN Retinal homeobox protein Rx OS=Homo sapiens GN=RAX PE=1 SV=2 37 140 4.0E-06
sp|Q9NYD6|HXC10_HUMAN Homeobox protein Hox-C10 OS=Homo sapiens GN=HOXC10 PE=1 SV=2 13 131 4.0E-06
sp|Q05640|HMEN_ARTSF Homeobox protein engrailed OS=Artemia franciscana PE=2 SV=1 50 125 4.0E-06
sp|Q03356|MSXB_DANRE Homeobox protein MSH-B OS=Danio rerio GN=msxb PE=2 SV=3 15 133 4.0E-06
sp|P53411|LHX1_CHICK LIM/homeobox protein Lhx1 OS=Gallus gallus GN=LHX1 PE=2 SV=1 3 131 4.0E-06
sp|P53408|ISL2A_ONCTS Insulin gene enhancer protein ISL-2A OS=Oncorhynchus tshawytscha GN=isl2a PE=2 SV=1 54 125 4.0E-06
sp|P50212|ISL2B_ONCTS Insulin gene enhancer protein ISL-2B (Fragment) OS=Oncorhynchus tshawytscha GN=isl2b PE=2 SV=1 54 139 4.0E-06
sp|Q03372|HMSH_DROME Muscle segmentation homeobox OS=Drosophila melanogaster GN=Dr PE=2 SV=2 50 133 5.0E-06
sp|Q04116|YHP1_YEAST Homeobox protein YHP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHP1 PE=1 SV=1 80 125 5.0E-06
sp|Q90469|HXDAA_DANRE Homeobox protein Hox-D10a OS=Danio rerio GN=hoxd10a PE=2 SV=4 49 131 5.0E-06
sp|A2T6F8|HXC10_MACNE Homeobox protein Hox-C10 OS=Macaca nemestrina GN=HOXC10 PE=3 SV=1 64 131 6.0E-06
sp|A2D635|HXC10_MACMU Homeobox protein Hox-C10 OS=Macaca mulatta GN=HOXC10 PE=3 SV=1 64 131 6.0E-06
sp|A6NFQ7|DPRX_HUMAN Divergent paired-related homeobox OS=Homo sapiens GN=DPRX PE=3 SV=1 66 137 6.0E-06
sp|Q28J15|HESX1_XENTR Homeobox expressed in ES cells 1 OS=Xenopus tropicalis GN=hesx1 PE=2 SV=1 61 131 6.0E-06
sp|P09015|HME2A_DANRE Homeobox protein engrailed-2a OS=Danio rerio GN=eng2a PE=2 SV=2 57 125 6.0E-06
sp|Q9JLT7|RX_RAT Retinal homeobox protein Rx OS=Rattus norvegicus GN=Rax PE=2 SV=1 29 140 7.0E-06
sp|P32443|MEOX2_MOUSE Homeobox protein MOX-2 OS=Mus musculus GN=Meox2 PE=2 SV=1 71 127 7.0E-06
sp|P31257|HXC10_MOUSE Homeobox protein Hox-C10 OS=Mus musculus GN=Hoxc10 PE=2 SV=1 64 131 7.0E-06
sp|P39020|MEOX2_RAT Homeobox protein MOX-2 OS=Rattus norvegicus GN=Meox2 PE=2 SV=1 70 127 8.0E-06
sp|Q9H4S2|GSX1_HUMAN GS homeobox 1 OS=Homo sapiens GN=GSX1 PE=2 SV=1 65 131 8.0E-06
sp|Q01703|MSXC_DANRE Homeobox protein MSH-C OS=Danio rerio GN=msxc PE=2 SV=1 63 133 8.0E-06
sp|P48742|LHX1_HUMAN LIM/homeobox protein Lhx1 OS=Homo sapiens GN=LHX1 PE=2 SV=2 5 131 9.0E-06
sp|A2T7D1|HXD10_PANTR Homeobox protein Hox-D10 OS=Pan troglodytes GN=HOXD10 PE=3 SV=1 59 131 9.0E-06
sp|P63007|LHX1_RAT LIM/homeobox protein Lhx1 OS=Rattus norvegicus GN=Lhx1 PE=1 SV=1 5 131 9.0E-06
sp|P63006|LHX1_MOUSE LIM/homeobox protein Lhx1 OS=Mus musculus GN=Lhx1 PE=1 SV=1 5 131 9.0E-06
sp|P63008|LHX1_MESAU LIM/homeobox protein Lhx1 OS=Mesocricetus auratus GN=Lhx1 PE=2 SV=1 5 131 9.0E-06
sp|P14150|HMEN_SCHAM Segmentation polarity homeobox protein engrailed (Fragment) OS=Schistocerca americana GN=en PE=2 SV=1 67 125 9.0E-06
sp|P56672|OTP_DROME Homeobox protein orthopedia OS=Drosophila melanogaster GN=otp PE=2 SV=2 67 119 9.0E-06
sp|Q9IA14|HXD10_HETFR Homeobox protein Hox-D10 OS=Heterodontus francisci GN=HOXD10 PE=3 SV=1 43 131 9.0E-06
sp|Q5IS89|LHX1_SAIBB LIM/homeobox protein Lhx1 OS=Saimiri boliviensis boliviensis GN=LHX1 PE=2 SV=1 5 131 9.0E-06
sp|Q5IS44|LHX1_PANTR LIM/homeobox protein Lhx1 OS=Pan troglodytes GN=LHX1 PE=2 SV=1 5 131 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Homeodomain

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6874
MATEVEHSMAMCQAVSAPALSTTSSNVTPTSATASTPNRASPTSTSSMGGQSSNAKRPPRKSTLTQQQKNQKRQR
ATQDQLSILELEFNKNPTPTALVRDRIAEEINMTERSVQIWFQNRRAKIKMLAKKSLETGEDIDSIPESMRAYLA
MQAMESGKGLAGNYLGRTGLLPLGHGGMLLGGEQGAQGKVLIHHLTCRSLSIGKWTRVAQTSMDLIVFHSPDKCT
MTYYIHSEQAGYKIEYPFSYIKNIWLENNESDQNKVGGIVIELNRPPHFFMDSSPTTNGFFMCGDFTEDLQASQC
LIHHLGGNPKVLTNQLAKLVSLEAFMNRHNPHAYGDPHASSASAPVSPTARPSSQPNFAQAHPPPVLQEPWAGNQ
MHSAMRPPHGHKRQRSRSVPGPVDFAMFQNQPMPSFYIQPPGEMGPPQHNPNIYAPIPQQPAASPAGGMAHHLRI
DTQAGFGLEMRQYPMSATTASPSEFPASPGYFSQGPDGSAMPGSANFHTPYGGSFLSPMVHADSGAASAVSPLPF
NGPSEPSIVEHSPPIAMIGRPGSTEMYMGHEASCAVSEDGSSLNEMYSKHTINLPMHTPSPGNYVQPHQGEIDMD
QLVQFDAVEASSMSPETIHPSQ*
Coding >OphauB2|6874
ATGGCTACCGAGGTGGAGCATTCAATGGCCATGTGCCAGGCAGTATCAGCCCCTGCACTATCCACCACCAGTTCC
AATGTCACGCCCACCTCTGCCACAGCCTCGACCCCCAACAGGGCTTCGCCTACCTCGACTTCGAGCATGGGTGGC
CAATCGTCCAATGCAAAGCGTCCTCCGCGCAAGAGCACCTTGACACAGCAGCAAAAGAACCAGAAACGCCAGCGC
GCGACCCAGGACCAACTCAGCATCCTCGAGCTGGAGTTTAACAAGAATCCCACGCCGACTGCTCTGGTCAGGGAC
AGAATTGCCGAAGAGATCAACATGACGGAGCGATCTGTGCAAATCTGGTTTCAGAATCGACGCGCCAAGATTAAG
ATGCTGGCCAAGAAGAGTCTGGAGACTGGTGAAGACATTGATTCCATCCCCGAGTCGATGCGCGCCTATCTGGCC
ATGCAGGCAATGGAGTCTGGAAAGGGGCTCGCGGGTAACTACCTAGGGCGGACCGGACTCTTGCCGCTAGGCCAC
GGAGGCATGCTACTCGGTGGCGAACAAGGCGCTCAGGGCAAAGTTTTAATCCACCACCTGACCTGCCGATCGCTC
AGCATTGGCAAGTGGACTCGAGTCGCACAAACTTCAATGGACCTTATTGTGTTCCATTCGCCAGACAAGTGCACA
ATGACGTACTATATTCACAGCGAGCAGGCCGGCTACAAGATCGAGTACCCGTTTTCATACATCAAGAACATTTGG
CTCGAGAATAACGAGTCGGACCAGAACAAGGTGGGCGGCATCGTGATTGAGCTCAATCGCCCGCCTCACTTTTTT
ATGGACTCATCGCCGACGACGAATGGCTTCTTCATGTGCGGCGACTTCACGGAGGATCTGCAGGCTTCGCAGTGC
TTGATTCACCACCTGGGCGGCAACCCCAAGGTGCTGACCAATCAGCTGGCCAAGCTTGTCTCGCTCGAGGCCTTT
ATGAACCGCCACAACCCTCACGCCTATGGCGACCCTCACGCGTCGTCGGCCTCGGCTCCTGTTTCGCCTACTGCG
AGGCCGTCGTCGCAGCCCAACTTTGCTCAGGCGCATCCGCCGCCAGTGCTCCAAGAGCCTTGGGCCGGCAATCAA
ATGCACTCGGCCATGCGCCCACCGCACGGACACAAAAGGCAGCGCAGCCGATCGGTTCCCGGGCCCGTCGATTTT
GCCATGTTTCAGAACCAGCCCATGCCATCCTTTTATATCCAGCCGCCTGGCGAGATGGGGCCGCCGCAGCATAAC
CCCAACATTTATGCTCCCATTCCACAGCAGCCGGCAGCAAGCCCTGCCGGCGGCATGGCCCATCACTTGCGCATC
GACACACAGGCTGGATTTGGCCTTGAGATGCGACAGTATCCCATGTCAGCCACGACGGCGTCGCCCTCGGAATTC
CCCGCTAGCCCCGGCTACTTTTCGCAGGGCCCTGACGGCAGTGCTATGCCTGGCTCGGCCAACTTTCACACGCCC
TATGGCGGCTCCTTTTTGTCGCCAATGGTGCATGCGGATAGCGGCGCAGCGTCGGCAGTATCGCCATTGCCGTTT
AACGGACCATCTGAGCCGTCGATTGTTGAGCACTCTCCACCGATTGCCATGATTGGCCGCCCTGGCTCTACTGAA
ATGTACATGGGCCACGAGGCTTCATGTGCCGTTTCAGAAGATGGTAGCAGCCTCAACGAGATGTACTCGAAGCAT
ACAATCAATCTGCCCATGCACACGCCTTCTCCAGGCAACTATGTTCAACCTCACCAAGGCGAGATTGACATGGAT
CAACTGGTACAGTTTGACGCTGTGGAAGCGTCAAGCATGTCTCCCGAGACTATTCACCCAAGTCAATGA
Transcript >OphauB2|6874
ATGGCTACCGAGGTGGAGCATTCAATGGCCATGTGCCAGGCAGTATCAGCCCCTGCACTATCCACCACCAGTTCC
AATGTCACGCCCACCTCTGCCACAGCCTCGACCCCCAACAGGGCTTCGCCTACCTCGACTTCGAGCATGGGTGGC
CAATCGTCCAATGCAAAGCGTCCTCCGCGCAAGAGCACCTTGACACAGCAGCAAAAGAACCAGAAACGCCAGCGC
GCGACCCAGGACCAACTCAGCATCCTCGAGCTGGAGTTTAACAAGAATCCCACGCCGACTGCTCTGGTCAGGGAC
AGAATTGCCGAAGAGATCAACATGACGGAGCGATCTGTGCAAATCTGGTTTCAGAATCGACGCGCCAAGATTAAG
ATGCTGGCCAAGAAGAGTCTGGAGACTGGTGAAGACATTGATTCCATCCCCGAGTCGATGCGCGCCTATCTGGCC
ATGCAGGCAATGGAGTCTGGAAAGGGGCTCGCGGGTAACTACCTAGGGCGGACCGGACTCTTGCCGCTAGGCCAC
GGAGGCATGCTACTCGGTGGCGAACAAGGCGCTCAGGGCAAAGTTTTAATCCACCACCTGACCTGCCGATCGCTC
AGCATTGGCAAGTGGACTCGAGTCGCACAAACTTCAATGGACCTTATTGTGTTCCATTCGCCAGACAAGTGCACA
ATGACGTACTATATTCACAGCGAGCAGGCCGGCTACAAGATCGAGTACCCGTTTTCATACATCAAGAACATTTGG
CTCGAGAATAACGAGTCGGACCAGAACAAGGTGGGCGGCATCGTGATTGAGCTCAATCGCCCGCCTCACTTTTTT
ATGGACTCATCGCCGACGACGAATGGCTTCTTCATGTGCGGCGACTTCACGGAGGATCTGCAGGCTTCGCAGTGC
TTGATTCACCACCTGGGCGGCAACCCCAAGGTGCTGACCAATCAGCTGGCCAAGCTTGTCTCGCTCGAGGCCTTT
ATGAACCGCCACAACCCTCACGCCTATGGCGACCCTCACGCGTCGTCGGCCTCGGCTCCTGTTTCGCCTACTGCG
AGGCCGTCGTCGCAGCCCAACTTTGCTCAGGCGCATCCGCCGCCAGTGCTCCAAGAGCCTTGGGCCGGCAATCAA
ATGCACTCGGCCATGCGCCCACCGCACGGACACAAAAGGCAGCGCAGCCGATCGGTTCCCGGGCCCGTCGATTTT
GCCATGTTTCAGAACCAGCCCATGCCATCCTTTTATATCCAGCCGCCTGGCGAGATGGGGCCGCCGCAGCATAAC
CCCAACATTTATGCTCCCATTCCACAGCAGCCGGCAGCAAGCCCTGCCGGCGGCATGGCCCATCACTTGCGCATC
GACACACAGGCTGGATTTGGCCTTGAGATGCGACAGTATCCCATGTCAGCCACGACGGCGTCGCCCTCGGAATTC
CCCGCTAGCCCCGGCTACTTTTCGCAGGGCCCTGACGGCAGTGCTATGCCTGGCTCGGCCAACTTTCACACGCCC
TATGGCGGCTCCTTTTTGTCGCCAATGGTGCATGCGGATAGCGGCGCAGCGTCGGCAGTATCGCCATTGCCGTTT
AACGGACCATCTGAGCCGTCGATTGTTGAGCACTCTCCACCGATTGCCATGATTGGCCGCCCTGGCTCTACTGAA
ATGTACATGGGCCACGAGGCTTCATGTGCCGTTTCAGAAGATGGTAGCAGCCTCAACGAGATGTACTCGAAGCAT
ACAATCAATCTGCCCATGCACACGCCTTCTCCAGGCAACTATGTTCAACCTCACCAAGGCGAGATTGACATGGAT
CAACTGGTACAGTTTGACGCTGTGGAAGCGTCAAGCATGTCTCCCGAGACTATTCACCCAAGTCAATGA
Gene >OphauB2|6874
ATGGCTACCGAGGTGGAGCATTCAATGGCCATGTGCCAGGCAGTATCAGCCCCTGCACTATCCACCACCAGTTCC
AATGTCACGCCCACCTCTGCCACAGCCTCGACCCCCAACAGGGCTTCGCCTACCTCGACTTCGAGCATGGGTGGC
CAATCGTCCAATGCAAAGCGTCCTCCGCGCAAGAGCACCTTGACACAGCAGCAAAAGAACCAGAAACGCCAGCGC
GCGACCCAGGACCAACTCAGCATCCTCGAGCTGGAGTTTAACAAGAATCCCACGCCGACTGCTCTGGTCAGGGAC
AGAATTGCCGAAGAGATCAACATGACGGAGCGATCTGTGCAAATCTGGTTTCAGAATCGGTACGACGGCTTTGCT
AAGCTATTCTTGGCGGTGGCTCTTTGTTATGAAGATGGCTAACATTCTTTTTTACTTCTAGACGCGCCAAGATTA
AGATGCTGGCCAAGAAGAGTCTGGAGACTGGTGAAGACATTGATTCCATCCCCGAGTCGATGCGCGCCTATCTGG
CCATGCAGGCAATGGAGTCTGGAAAGGGGCTCGCGGGTAACTACCTAGGGCGGACCGGACTCTTGCCGCTAGGCC
ACGGAGGCATGCTACTCGGTGGCGAACAAGGCGCTCAGGGCAAAGTTTGTAAGTGGCTCCTAGGGACAATAGGCT
CTAGACTCGGGCTAACGGGCTCTAGTAATCCACCACCTGACCTGCCGATCGCTCAGCATTGGCAAGTGGACTCGA
GTCGCACAAACTTCAATGGACCTTATTGTGTTCCATTCGCCAGACAAGTGCACAATGACGTACTATATTCACAGC
GAGCAGGCCGGCTACAAGATCGAGTACCCGTTTTCATACATCAAGAACATTTGGCTCGAGAATAACGAGTCGGAC
CAGAACAAGGTGGGCGGCATCGTGATTGAGCTCAATCGCCCGCCTCACTTTTTTATGGACTCATCGCCGACGACG
AATGGCTTCTTCATGTGCGGCGACTTCACGGAGGATCTGCAGGCTTCGCAGTGCTTGATTCACCACCTGGGCGGC
AACCCCAAGGTGCTGACCAATCAGCTGGCCAAGCTTGTCTCGCTCGAGGCCTTTATGAACCGCCACAACCCTCAC
GCCTATGGCGACCCTCACGCGTCGTCGGCCTCGGCTCCTGTTTCGCCTACTGCGAGGCCGTCGTCGCAGCCCAAC
TTTGCTCAGGCGCATCCGCCGCCAGTGCTCCAAGAGCCTTGGGCCGGCAATCAAATGCACTCGGCCATGCGCCCA
CCGCACGGACACAAAAGGCAGCGCAGCCGATCGGTTCCCGGGCCCGTCGATTTTGCCATGTTTCAGAACCAGCCC
ATGCCATCCTTTTATATCCAGCCGCCTGGCGAGATGGGGCCGCCGCAGCATAACCCCAACATTTATGCTCCCATT
CCACAGCAGCCGGCAGCAAGCCCTGCCGGCGGCATGGCCCATCACTTGCGCATCGACACACAGGCTGGATTTGGC
CTTGAGATGCGACAGTATCCCATGTCAGCCACGACGGCGTCGCCCTCGGAATTCCCCGCTAGCCCCGGCTACTTT
TCGCAGGGCCCTGACGGCAGTGCTATGCCTGGCTCGGCCAACTTTCACACGCCCTATGGCGGCTCCTTTTTGTCG
CCAATGGTGCATGCGGATAGCGGCGCAGCGTCGGCAGTATCGCCATTGCCGTTTAACGGACCATCTGAGCCGTCG
ATTGTTGAGCACTCTCCACCGATTGCCATGATTGGCCGCCCTGGCTCTACTGAAATGTACATGGGCCACGAGGCT
TCATGTGCCGTTTCAGAAGATGGTAGCAGCCTCAACGAGATGTACTCGAAGCATACAATCAATCTGCCCATGCAC
ACGCCTTCTCCAGGCAACTATGTTCAACCTCACCAAGGCGAGATTGACATGGATCAACTGGTACAGTTTGACGCT
GTGGAAGCGTCAAGCATGTCTCCCGAGACTATTCACCCAAGTCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail