Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6872
Gene name
LocationContig_67:89312..90789
Strand-
Gene length (bp)1477
Transcript length (bp)1410
Coding sequence length (bp)1410
Protein length (aa) 470

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07571 TAF6_C TAF6 C-terminal HEAT repeat domain 3.4E-26 290 382
PF02969 TAF TATA box binding protein associated factor (TAF) 4.3E-17 18 80

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74462|TAF6_SCHPO Transcription initiation factor TFIID subunit 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf6 PE=1 SV=1 17 397 3.0E-113
sp|P53040|TAF6_YEAST Transcription initiation factor TFIID subunit 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF6 PE=1 SV=1 17 447 6.0E-84
sp|Q9MAU3|TAF6_ARATH Transcription initiation factor TFIID subunit 6 OS=Arabidopsis thaliana GN=TAF6 PE=1 SV=1 21 391 2.0E-71
sp|Q91857|TAF6_XENLA Transcription initiation factor TFIID subunit 6 OS=Xenopus laevis GN=taf6 PE=2 SV=3 10 381 1.0E-53
sp|P49848|TAF6_HUMAN Transcription initiation factor TFIID subunit 6 OS=Homo sapiens GN=TAF6 PE=1 SV=1 20 382 5.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74462|TAF6_SCHPO Transcription initiation factor TFIID subunit 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf6 PE=1 SV=1 17 397 3.0E-113
sp|P53040|TAF6_YEAST Transcription initiation factor TFIID subunit 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF6 PE=1 SV=1 17 447 6.0E-84
sp|Q9MAU3|TAF6_ARATH Transcription initiation factor TFIID subunit 6 OS=Arabidopsis thaliana GN=TAF6 PE=1 SV=1 21 391 2.0E-71
sp|Q91857|TAF6_XENLA Transcription initiation factor TFIID subunit 6 OS=Xenopus laevis GN=taf6 PE=2 SV=3 10 381 1.0E-53
sp|P49848|TAF6_HUMAN Transcription initiation factor TFIID subunit 6 OS=Homo sapiens GN=TAF6 PE=1 SV=1 20 382 5.0E-53
sp|Q62311|TAF6_MOUSE Transcription initiation factor TFIID subunit 6 OS=Mus musculus GN=Taf6 PE=1 SV=1 20 382 1.0E-52
sp|Q63801|TAF6_RAT Transcription initiation factor TFIID subunit 6 OS=Rattus norvegicus GN=Taf6 PE=1 SV=1 20 382 1.0E-52
sp|F4HVA6|TAF6B_ARATH Transcription initiation factor TFIID subunit 6b OS=Arabidopsis thaliana GN=TAF6B PE=1 SV=1 21 455 2.0E-51
sp|P49847|TAF6_DROME Transcription initiation factor TFIID subunit 6 OS=Drosophila melanogaster GN=Taf6 PE=1 SV=2 19 455 2.0E-46
sp|Q8R2K4|TAF6L_MOUSE TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L OS=Mus musculus GN=Taf6l PE=2 SV=1 21 376 1.0E-24
sp|Q9Y6J9|TAF6L_HUMAN TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L OS=Homo sapiens GN=TAF6L PE=1 SV=1 21 376 4.0E-24
[Show less]

GO

GO Term Description Terminal node
GO:0006367 transcription initiation from RNA polymerase II promoter Yes
GO:0006352 DNA-templated transcription, initiation Yes
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0008150 biological_process No
GO:0009059 macromolecule biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0009058 biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:0016070 RNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6872
MTTTSIDPPATGKQRLLWNSENARDVAESVGINGLSDEAQKALTQDIEYRIGQVIAEGMRLMRAARRTELTVGDV
TLALRVLDVEPLYGYDSTRPLRYGEASLGPGQPLFYLEDEEVDFEKIINAPLPRVSRDMMYTVHWLAIEGVQPSI
PQNPTLHEARTQDMLPKGPGAHPSLAALAGNDTGVNKPSVKHVVSKELILYFDKIQAALLDENPDDEVVRLRHAA
LGSVRDDPGLHQLVPYFVNFIMDRVTHHLDDIFTLHRMMELTTALIENHSLFLDPYASSLSSCTLTCLMARKLGS
EDGPDALARQYELRQLSASLVGRIAYKYAASNTLLRPKLTRTCLKYLLDPTRPAAVLYGAISGLFEAGGPEAVRV
LVLRNLKAFDAGILQPLREKAEGSMDYEMLVQGLVQAVTSLATSLQDADGDNAPATETELEALNGFIGPIIGQRV
ASLANRGLIKVILDARYLD*
Coding >OphauB2|6872
ATGACAACCACATCAATTGACCCCCCGGCGACCGGCAAGCAGCGCCTGCTCTGGAATTCGGAAAACGCCCGCGAC
GTTGCCGAGTCGGTGGGCATAAACGGCCTCAGCGATGAGGCTCAGAAGGCCCTGACCCAGGACATTGAGTACCGC
ATTGGCCAGGTCATTGCCGAGGGCATGCGTCTGATGCGCGCAGCGCGTCGCACCGAGCTGACTGTGGGAGATGTG
ACGCTGGCCCTGCGAGTGCTAGACGTGGAGCCACTCTATGGCTACGACTCGACGCGCCCACTGCGCTATGGCGAG
GCCAGTCTTGGCCCTGGCCAGCCGCTCTTTTACCTCGAGGACGAAGAGGTTGACTTTGAGAAAATCATCAACGCC
CCGTTGCCCAGGGTATCCCGAGACATGATGTATACTGTCCACTGGCTGGCTATCGAAGGCGTCCAGCCATCTATC
CCCCAAAATCCAACTCTTCATGAAGCGCGTACCCAAGACATGCTGCCCAAGGGTCCTGGCGCCCATCCCTCGCTC
GCTGCTCTCGCTGGAAACGACACGGGCGTCAACAAGCCATCGGTGAAGCACGTCGTTAGCAAAGAGCTCATTTTA
TACTTTGATAAGATCCAAGCGGCCTTGCTCGACGAGAACCCCGATGACGAAGTGGTGCGTCTGCGTCACGCGGCC
CTTGGCTCTGTGCGCGACGACCCTGGCCTCCACCAGCTCGTGCCGTATTTTGTAAACTTCATCATGGACCGCGTA
ACGCATCATCTGGACGACATCTTCACCTTGCATCGCATGATGGAGCTTACAACGGCACTCATTGAAAACCATTCC
TTGTTTCTCGACCCCTATGCGAGCTCCCTCTCCTCTTGCACCCTGACTTGCCTCATGGCTCGCAAGCTCGGTTCT
GAGGACGGTCCGGATGCGCTTGCCCGTCAGTACGAGCTGCGCCAACTATCCGCCTCTCTTGTCGGTCGCATTGCC
TACAAGTACGCTGCCTCCAACACACTGCTGCGCCCTAAATTGACCCGCACTTGCCTCAAGTATCTGCTGGATCCT
ACGCGTCCGGCGGCTGTACTCTATGGTGCCATTTCTGGCTTGTTTGAGGCTGGCGGACCCGAGGCTGTGCGCGTC
TTGGTCCTACGTAACCTCAAGGCCTTTGACGCTGGCATCCTGCAGCCGCTGCGTGAAAAGGCTGAAGGAAGCATG
GACTATGAGATGTTGGTGCAGGGACTTGTGCAAGCGGTTACGTCCTTGGCGACCTCTTTACAGGATGCTGACGGC
GATAATGCGCCAGCTACGGAAACTGAGCTGGAAGCACTAAATGGTTTCATTGGTCCTATAATTGGGCAGCGCGTT
GCGTCGCTTGCCAACCGAGGGCTCATTAAAGTCATTCTCGATGCTCGATACCTCGACTAG
Transcript >OphauB2|6872
ATGACAACCACATCAATTGACCCCCCGGCGACCGGCAAGCAGCGCCTGCTCTGGAATTCGGAAAACGCCCGCGAC
GTTGCCGAGTCGGTGGGCATAAACGGCCTCAGCGATGAGGCTCAGAAGGCCCTGACCCAGGACATTGAGTACCGC
ATTGGCCAGGTCATTGCCGAGGGCATGCGTCTGATGCGCGCAGCGCGTCGCACCGAGCTGACTGTGGGAGATGTG
ACGCTGGCCCTGCGAGTGCTAGACGTGGAGCCACTCTATGGCTACGACTCGACGCGCCCACTGCGCTATGGCGAG
GCCAGTCTTGGCCCTGGCCAGCCGCTCTTTTACCTCGAGGACGAAGAGGTTGACTTTGAGAAAATCATCAACGCC
CCGTTGCCCAGGGTATCCCGAGACATGATGTATACTGTCCACTGGCTGGCTATCGAAGGCGTCCAGCCATCTATC
CCCCAAAATCCAACTCTTCATGAAGCGCGTACCCAAGACATGCTGCCCAAGGGTCCTGGCGCCCATCCCTCGCTC
GCTGCTCTCGCTGGAAACGACACGGGCGTCAACAAGCCATCGGTGAAGCACGTCGTTAGCAAAGAGCTCATTTTA
TACTTTGATAAGATCCAAGCGGCCTTGCTCGACGAGAACCCCGATGACGAAGTGGTGCGTCTGCGTCACGCGGCC
CTTGGCTCTGTGCGCGACGACCCTGGCCTCCACCAGCTCGTGCCGTATTTTGTAAACTTCATCATGGACCGCGTA
ACGCATCATCTGGACGACATCTTCACCTTGCATCGCATGATGGAGCTTACAACGGCACTCATTGAAAACCATTCC
TTGTTTCTCGACCCCTATGCGAGCTCCCTCTCCTCTTGCACCCTGACTTGCCTCATGGCTCGCAAGCTCGGTTCT
GAGGACGGTCCGGATGCGCTTGCCCGTCAGTACGAGCTGCGCCAACTATCCGCCTCTCTTGTCGGTCGCATTGCC
TACAAGTACGCTGCCTCCAACACACTGCTGCGCCCTAAATTGACCCGCACTTGCCTCAAGTATCTGCTGGATCCT
ACGCGTCCGGCGGCTGTACTCTATGGTGCCATTTCTGGCTTGTTTGAGGCTGGCGGACCCGAGGCTGTGCGCGTC
TTGGTCCTACGTAACCTCAAGGCCTTTGACGCTGGCATCCTGCAGCCGCTGCGTGAAAAGGCTGAAGGAAGCATG
GACTATGAGATGTTGGTGCAGGGACTTGTGCAAGCGGTTACGTCCTTGGCGACCTCTTTACAGGATGCTGACGGC
GATAATGCGCCAGCTACGGAAACTGAGCTGGAAGCACTAAATGGTTTCATTGGTCCTATAATTGGGCAGCGCGTT
GCGTCGCTTGCCAACCGAGGGCTCATTAAAGTCATTCTCGATGCTCGATACCTCGACTAG
Gene >OphauB2|6872
ATGACAACCACATCAATTGACCCCCCGGCGACCGGCAAGCAGCGCCTGCTCTGGAATTCGGAAAACGCCCGCGAC
GTTGCCGAGTCGGTGGGCATAAACGGCCTCAGCGATGAGGCTCAGAAGGCCCTGACCCAGGACATTGAGTACCGC
ATTGGCCAGGTCATTGCCGAGGGCATGCGTCTGATGCGCGCAGCGCGTCGCACCGAGCTGACTGTGGGAGATGTG
ACGCTGGCCCTGCGAGTGCTAGACGTGGAGCCACTCTATGGCTACGACTCGACGCGCCCACTGCGCTATGGCGAG
GCCAGTCTTGGCCCTGGCCAGCCGCTCTTTTACCTCGAGGACGAAGAGGTTGACTTTGAGAAAATCATCAACGCC
CCGTTGCCCAGGGTATCCCGAGACATGATGTATACTGGTTCGTCTCTGCTCACCCAAAAAAAAAACGTTTGCTAG
AGTTGGTGTCGCTAATCCAAGGTGAATAGTCCACTGGCTGGCTATCGAAGGCGTCCAGCCATCTATCCCCCAAAA
TCCAACTCTTCATGAAGCGCGTACCCAAGACATGCTGCCCAAGGGTCCTGGCGCCCATCCCTCGCTCGCTGCTCT
CGCTGGAAACGACACGGGCGTCAACAAGCCATCGGTGAAGCACGTCGTTAGCAAAGAGCTCATTTTATACTTTGA
TAAGATCCAAGCGGCCTTGCTCGACGAGAACCCCGATGACGAAGTGGTGCGTCTGCGTCACGCGGCCCTTGGCTC
TGTGCGCGACGACCCTGGCCTCCACCAGCTCGTGCCGTATTTTGTAAACTTCATCATGGACCGCGTAACGCATCA
TCTGGACGACATCTTCACCTTGCATCGCATGATGGAGCTTACAACGGCACTCATTGAAAACCATTCCTTGTTTCT
CGACCCCTATGCGAGCTCCCTCTCCTCTTGCACCCTGACTTGCCTCATGGCTCGCAAGCTCGGTTCTGAGGACGG
TCCGGATGCGCTTGCCCGTCAGTACGAGCTGCGCCAACTATCCGCCTCTCTTGTCGGTCGCATTGCCTACAAGTA
CGCTGCCTCCAACACACTGCTGCGCCCTAAATTGACCCGCACTTGCCTCAAGTATCTGCTGGATCCTACGCGTCC
GGCGGCTGTACTCTATGGTGCCATTTCTGGCTTGTTTGAGGCTGGCGGACCCGAGGCTGTGCGCGTCTTGGTCCT
ACGTAACCTCAAGGCCTTTGACGCTGGCATCCTGCAGCCGCTGCGTGAAAAGGCTGAAGGAAGCATGGACTATGA
GATGTTGGTGCAGGGACTTGTGCAAGCGGTTACGTCCTTGGCGACCTCTTTACAGGATGCTGACGGCGATAATGC
GCCAGCTACGGAAACTGAGCTGGAAGCACTAAATGGTTTCATTGGTCCTATAATTGGGCAGCGCGTTGCGTCGCT
TGCCAACCGAGGGCTCATTAAAGTCATTCTCGATGCTCGATACCTCGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail