Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6871
Gene name
LocationContig_67:88420..89043
Strand+
Gene length (bp)623
Transcript length (bp)567
Coding sequence length (bp)567
Protein length (aa) 189

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit 3.3E-15 61 182

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74882|SDH3_SCHPO Succinate dehydrogenase cytochrome B subunit, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sdh3 PE=3 SV=1 44 186 6.0E-28
sp|Q04487|SHH3_YEAST Mitochondrial inner membrane protein SHH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHH3 PE=3 SV=1 49 185 2.0E-14
sp|P41955|C560_CAEBR Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Caenorhabditis briggsae GN=mev-1 PE=2 SV=1 30 182 8.0E-10
sp|P41956|C560_CAEEL Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Caenorhabditis elegans GN=mev-1 PE=2 SV=1 30 160 2.0E-09
sp|P70097|C560_CRIGR Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Cricetulus griseus GN=SDHC PE=2 SV=1 64 185 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74882|SDH3_SCHPO Succinate dehydrogenase cytochrome B subunit, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sdh3 PE=3 SV=1 44 186 6.0E-28
sp|Q04487|SHH3_YEAST Mitochondrial inner membrane protein SHH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHH3 PE=3 SV=1 49 185 2.0E-14
sp|P41955|C560_CAEBR Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Caenorhabditis briggsae GN=mev-1 PE=2 SV=1 30 182 8.0E-10
sp|P41956|C560_CAEEL Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Caenorhabditis elegans GN=mev-1 PE=2 SV=1 30 160 2.0E-09
sp|P70097|C560_CRIGR Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Cricetulus griseus GN=SDHC PE=2 SV=1 64 185 1.0E-07
sp|P35720|C560_BOVIN Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Bos taurus GN=SDHC PE=1 SV=2 63 185 6.0E-07
sp|P33421|SDH3_YEAST Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDH3 PE=1 SV=1 1 184 1.0E-06
sp|Q9CZB0|C560_MOUSE Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Mus musculus GN=Sdhc PE=1 SV=1 63 162 2.0E-06
sp|D0VWV4|C560_PIG Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Sus scrofa GN=SDHC PE=1 SV=2 63 185 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 90 112 22
2 127 149 22
3 170 187 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6871
MNAQRVGLAALRKGIAHTPSLARTSPAFFLAARLCSTPTRPFASSTHISTTEANQILAAQRRHRPVSPHLGIYKI
NQTWFGASAWTRITGCTLSGAVYAYFAAYLVAPLLGLHIESASLAAAFATWPVAAKGALKLALSFPFAFHFFAGC
KHLLYDMGKGFAKQTIRNGEIALWGVSIASALYLAFGL*
Coding >OphauB2|6871
ATGAATGCTCAACGTGTTGGCCTCGCCGCCCTGCGCAAAGGCATCGCGCATACTCCCTCCCTAGCCCGCACCTCT
CCGGCCTTTTTTCTCGCCGCCCGCCTCTGCTCGACGCCCACTCGCCCTTTTGCTTCATCCACCCACATCTCCACC
ACGGAAGCCAACCAAATCCTTGCTGCGCAGCGCCGCCACCGCCCCGTGTCGCCGCACCTTGGCATCTACAAGATT
AATCAAACGTGGTTTGGCGCCTCGGCGTGGACGCGCATCACGGGCTGCACGCTCTCGGGAGCCGTGTACGCTTAT
TTTGCTGCTTACCTGGTTGCCCCGCTGCTCGGCCTCCACATTGAGAGCGCGAGTCTGGCGGCGGCGTTTGCTACT
TGGCCAGTCGCGGCAAAGGGCGCCTTGAAGCTTGCGCTCAGCTTCCCCTTTGCTTTTCACTTTTTTGCCGGCTGC
AAGCATTTGCTATACGACATGGGCAAGGGCTTTGCCAAGCAAACCATTCGGAATGGCGAAATTGCTCTCTGGGGA
GTCAGCATTGCTTCAGCGCTCTACCTTGCCTTTGGTCTATAA
Transcript >OphauB2|6871
ATGAATGCTCAACGTGTTGGCCTCGCCGCCCTGCGCAAAGGCATCGCGCATACTCCCTCCCTAGCCCGCACCTCT
CCGGCCTTTTTTCTCGCCGCCCGCCTCTGCTCGACGCCCACTCGCCCTTTTGCTTCATCCACCCACATCTCCACC
ACGGAAGCCAACCAAATCCTTGCTGCGCAGCGCCGCCACCGCCCCGTGTCGCCGCACCTTGGCATCTACAAGATT
AATCAAACGTGGTTTGGCGCCTCGGCGTGGACGCGCATCACGGGCTGCACGCTCTCGGGAGCCGTGTACGCTTAT
TTTGCTGCTTACCTGGTTGCCCCGCTGCTCGGCCTCCACATTGAGAGCGCGAGTCTGGCGGCGGCGTTTGCTACT
TGGCCAGTCGCGGCAAAGGGCGCCTTGAAGCTTGCGCTCAGCTTCCCCTTTGCTTTTCACTTTTTTGCCGGCTGC
AAGCATTTGCTATACGACATGGGCAAGGGCTTTGCCAAGCAAACCATTCGGAATGGCGAAATTGCTCTCTGGGGA
GTCAGCATTGCTTCAGCGCTCTACCTTGCCTTTGGTCTATAA
Gene >OphauB2|6871
ATGAATGCTCAACGTGTTGGCCTCGCCGCCCTGCGCAAAGGTAAAAAAAACCCTCGTCCCATAACTCTTGGCCGT
CAAAGACTCACCCACCAACAGGCATCGCGCATACTCCCTCCCTAGCCCGCACCTCTCCGGCCTTTTTTCTCGCCG
CCCGCCTCTGCTCGACGCCCACTCGCCCTTTTGCTTCATCCACCCACATCTCCACCACGGAAGCCAACCAAATCC
TTGCTGCGCAGCGCCGCCACCGCCCCGTGTCGCCGCACCTTGGCATCTACAAGATTAATCAAACGTGGTTTGGCG
CCTCGGCGTGGACGCGCATCACGGGCTGCACGCTCTCGGGAGCCGTGTACGCTTATTTTGCTGCTTACCTGGTTG
CCCCGCTGCTCGGCCTCCACATTGAGAGCGCGAGTCTGGCGGCGGCGTTTGCTACTTGGCCAGTCGCGGCAAAGG
GCGCCTTGAAGCTTGCGCTCAGCTTCCCCTTTGCTTTTCACTTTTTTGCCGGCTGCAAGCATTTGCTATACGACA
TGGGCAAGGGCTTTGCCAAGCAAACCATTCGGAATGGCGAAATTGCTCTCTGGGGAGTCAGCATTGCTTCAGCGC
TCTACCTTGCCTTTGGTCTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail