Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6865
Gene name
LocationContig_67:74185..76630
Strand-
Gene length (bp)2445
Transcript length (bp)2388
Coding sequence length (bp)2388
Protein length (aa) 796

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00330 Aconitase Aconitase family (aconitate hydratase) 6.1E-113 113 532
PF00694 Aconitase_C Aconitase C-terminal domain 5.7E-26 597 720

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q870W1|LYS4_NEUCR Homoaconitase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lys-4 PE=3 SV=1 1 792 0.0E+00
sp|Q4HVQ9|LYS4_GIBZE Homoaconitase, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=LYS4 PE=3 SV=1 84 792 0.0E+00
sp|Q92412|LYS4_EMENI Homoaconitase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lys4 PE=3 SV=2 37 789 0.0E+00
sp|Q2U9G3|LYS4_ASPOR Homoaconitase, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lys4 PE=3 SV=1 63 792 0.0E+00
sp|Q2GN26|LYS4_CHAGB Homoaconitase, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=LYS4 PE=3 SV=1 70 795 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q870W1|LYS4_NEUCR Homoaconitase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lys-4 PE=3 SV=1 1 792 0.0E+00
sp|Q4HVQ9|LYS4_GIBZE Homoaconitase, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=LYS4 PE=3 SV=1 84 792 0.0E+00
sp|Q92412|LYS4_EMENI Homoaconitase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lys4 PE=3 SV=2 37 789 0.0E+00
sp|Q2U9G3|LYS4_ASPOR Homoaconitase, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lys4 PE=3 SV=1 63 792 0.0E+00
sp|Q2GN26|LYS4_CHAGB Homoaconitase, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=LYS4 PE=3 SV=1 70 795 0.0E+00
sp|Q58FL6|LYS4_ASPNC Homoaconitase, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=lysA PE=3 SV=1 63 789 0.0E+00
sp|Q4WUL6|LYS4_ASPFU Homoaconitase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lys4 PE=2 SV=1 82 795 0.0E+00
sp|Q6BM98|LYS4_DEBHA Homoaconitase, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=LYS4 PE=3 SV=1 89 792 0.0E+00
sp|Q5A644|LYS4_CANAL Homoaconitase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LYS4 PE=3 SV=1 89 792 0.0E+00
sp|Q6CT61|LYS4_KLULA Homoaconitase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LYS4 PE=3 SV=1 89 792 0.0E+00
sp|Q6FM51|LYS4_CANGA Homoaconitase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS4 PE=3 SV=1 89 792 0.0E+00
sp|Q6C791|LYS4_YARLI Homoaconitase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LYS4 PE=3 SV=1 83 792 0.0E+00
sp|Q2HZ33|LYS4_CANPA Homoaconitase, mitochondrial OS=Candida parapsilosis GN=LYS4 PE=3 SV=1 73 794 0.0E+00
sp|P49367|LYS4_YEAST Homoaconitase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS4 PE=1 SV=1 89 792 0.0E+00
sp|Q9UT74|LYS4_SCHPO Homoaconitase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys2 PE=3 SV=1 88 795 0.0E+00
sp|Q75DX9|LYS4_ASHGO Homoaconitase, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS4 PE=3 SV=2 89 795 0.0E+00
sp|P0CM02|LYS4_CRYNJ Homoaconitase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=LYS4 PE=3 SV=1 77 792 0.0E+00
sp|P0CM03|LYS4_CRYNB Homoaconitase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=LYS4 PE=3 SV=1 77 792 0.0E+00
sp|Q4P521|LYS4_USTMA Homoaconitase, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=LYS4 PE=3 SV=2 69 792 0.0E+00
sp|O28084|LEUC2_ARCFU 3-isopropylmalate dehydratase large subunit 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=leuC2 PE=3 SV=1 89 537 6.0E-71
sp|Q9WYC7|LEUC1_THEMA 3-isopropylmalate dehydratase large subunit 1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=leuC1 PE=3 SV=1 89 540 7.0E-70
sp|Q8PUG1|LEUC_METMA Probable 3-isopropylmalate dehydratase large subunit OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=leuC PE=3 SV=2 89 537 2.0E-69
sp|O67078|LEUC_AQUAE 3-isopropylmalate dehydratase large subunit OS=Aquifex aeolicus (strain VF5) GN=leuC PE=3 SV=1 89 537 5.0E-69
sp|Q6L0K5|LEUC_PICTO 3-isopropylmalate dehydratase large subunit OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=leuC PE=3 SV=1 89 541 2.0E-68
sp|Q8TQZ3|LEUC_METAC Probable 3-isopropylmalate dehydratase large subunit OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=leuC PE=3 SV=1 89 537 4.0E-68
sp|B2KBD7|LEUC_ELUMP 3-isopropylmalate dehydratase large subunit OS=Elusimicrobium minutum (strain Pei191) GN=leuC PE=3 SV=1 88 537 2.0E-67
sp|Q8TVF2|LEUC1_METKA 3-isopropylmalate dehydratase large subunit 1 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=leuC1 PE=3 SV=1 89 540 4.0E-67
sp|O27668|HACA_METTH Probable methanogen homoaconitase large subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hacA PE=3 SV=1 91 537 1.0E-66
sp|Q9WZ24|LEUC2_THEMA 3-isopropylmalate dehydratase large subunit 2 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=leuC2 PE=3 SV=1 89 537 9.0E-66
sp|Q9ZNE0|HACA_THET2 Homoaconitase large subunit OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=hacA PE=1 SV=1 89 537 1.0E-65
sp|Q726X4|LEUC_DESVH 3-isopropylmalate dehydratase large subunit OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=leuC PE=3 SV=1 89 537 7.0E-65
sp|A1VAE7|LEUC_DESVV 3-isopropylmalate dehydratase large subunit OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=leuC PE=3 SV=1 89 537 7.0E-65
sp|A7IA28|LEUC_METB6 3-isopropylmalate dehydratase large subunit OS=Methanoregula boonei (strain 6A8) GN=leuC PE=3 SV=1 90 537 8.0E-64
sp|O27439|LEUC_METTH Probable 3-isopropylmalate dehydratase large subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=leuC PE=3 SV=1 89 538 2.0E-63
sp|O28316|LEUC1_ARCFU 3-isopropylmalate dehydratase large subunit 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=leuC1 PE=3 SV=2 89 537 4.0E-63
sp|B0K0Y2|LEUC_THEPX 3-isopropylmalate dehydratase large subunit OS=Thermoanaerobacter sp. (strain X514) GN=leuC PE=3 SV=1 90 537 6.0E-62
sp|Q30WD3|LEUC_DESAG 3-isopropylmalate dehydratase large subunit OS=Desulfovibrio alaskensis (strain G20) GN=leuC PE=3 SV=1 89 537 2.0E-61
sp|Q58409|HACA_METJA Methanogen homoaconitase large subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hacA PE=1 SV=1 89 534 3.0E-61
sp|B8DM92|LEUC_DESVM 3-isopropylmalate dehydratase large subunit OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=leuC PE=3 SV=1 89 519 3.0E-61
sp|Q8RDK2|LEUC_CALS4 3-isopropylmalate dehydratase large subunit OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=leuC PE=3 SV=1 90 537 4.0E-61
sp|Q8U2A1|LEUC1_PYRFU 3-isopropylmalate dehydratase large subunit 1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=leuC1 PE=3 SV=1 89 537 5.0E-61
sp|B0KAH5|LEUC_THEP3 3-isopropylmalate dehydratase large subunit OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=leuC PE=3 SV=1 90 537 7.0E-61
sp|B4U7U5|LEUC_HYDS0 3-isopropylmalate dehydratase large subunit OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=leuC PE=3 SV=1 89 537 9.0E-61
sp|Q8TLF1|HACA_METAC Probable methanogen homoaconitase large subunit OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hacA PE=3 SV=1 90 511 1.0E-60
sp|B8J4F9|LEUC_DESDA 3-isopropylmalate dehydratase large subunit OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=leuC PE=3 SV=1 89 537 2.0E-60
sp|Q0QLE2|DMDA_EUBBA 2,3-dimethylmalate dehydratase large subunit OS=Eubacterium barkeri GN=dmdA PE=1 SV=1 89 537 3.0E-60
sp|Q9UZ07|LEUC1_PYRAB 3-isopropylmalate dehydratase large subunit 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=leuC1 PE=3 SV=1 89 537 7.0E-59
sp|Q2LWJ2|LEUC_SYNAS 3-isopropylmalate dehydratase large subunit OS=Syntrophus aciditrophicus (strain SB) GN=leuC PE=3 SV=1 89 537 1.0E-58
sp|A9B805|LEUC_HERA2 3-isopropylmalate dehydratase large subunit OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=leuC PE=3 SV=1 89 537 2.0E-58
sp|B8CX22|LEUC_HALOH 3-isopropylmalate dehydratase large subunit OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=leuC PE=3 SV=1 90 537 2.0E-58
sp|B9MLV4|LEUC_CALBD 3-isopropylmalate dehydratase large subunit OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=leuC PE=3 SV=1 88 537 5.0E-58
sp|Q97EE0|LEUC_CLOAB 3-isopropylmalate dehydratase large subunit OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=leuC PE=3 SV=1 88 537 6.0E-58
sp|B2V844|LEUC_SULSY 3-isopropylmalate dehydratase large subunit OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=leuC PE=3 SV=1 89 550 8.0E-58
sp|P81291|LEUC_METJA Isopropylmalate/citramalate isomerase large subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=leuC PE=1 SV=1 90 537 8.0E-58
sp|A5MZ75|LEUC_CLOK5 3-isopropylmalate dehydratase large subunit OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=leuC PE=3 SV=1 89 537 1.0E-57
sp|A4XJ48|LEUC_CALS8 3-isopropylmalate dehydratase large subunit OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=leuC PE=3 SV=1 88 537 1.0E-57
sp|Q4JC09|LEUC_SULAC 3-isopropylmalate dehydratase large subunit OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=leuC PE=3 SV=1 88 537 3.0E-57
sp|Q30NZ0|LEUC_SULDN 3-isopropylmalate dehydratase large subunit OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=leuC PE=3 SV=1 89 537 1.0E-56
sp|B2UYH6|LEUC_CLOBA 3-isopropylmalate dehydratase large subunit OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=leuC PE=3 SV=1 89 537 8.0E-55
sp|Q2RG98|LEUC_MOOTA 3-isopropylmalate dehydratase large subunit OS=Moorella thermoacetica (strain ATCC 39073) GN=leuC PE=3 SV=1 90 537 9.0E-55
sp|Q1AVC5|LEUC2_RUBXD 3-isopropylmalate dehydratase large subunit 2 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=leuC2 PE=3 SV=1 88 537 1.0E-54
sp|B8FMM4|LEUC_DESAA 3-isopropylmalate dehydratase large subunit OS=Desulfatibacillum alkenivorans (strain AK-01) GN=leuC PE=3 SV=1 89 537 2.0E-54
sp|Q18AJ2|LEUC_PEPD6 3-isopropylmalate dehydratase large subunit OS=Peptoclostridium difficile (strain 630) GN=leuC PE=3 SV=1 89 537 3.0E-54
sp|A4YF03|LEUC_METS5 3-isopropylmalate dehydratase large subunit OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=leuC PE=3 SV=1 90 537 4.0E-54
sp|A6Q5L6|LEUC_NITSB 3-isopropylmalate dehydratase large subunit OS=Nitratiruptor sp. (strain SB155-2) GN=leuC PE=3 SV=1 89 537 4.0E-54
sp|Q8PZT3|HACA_METMA Probable methanogen homoaconitase large subunit OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hacA PE=3 SV=1 121 537 4.0E-54
sp|A7ZFP0|LEUC_CAMC1 3-isopropylmalate dehydratase large subunit OS=Campylobacter concisus (strain 13826) GN=leuC PE=3 SV=1 89 537 8.0E-54
sp|Q9RTI6|LEUC2_DEIRA 3-isopropylmalate dehydratase large subunit 2 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=leuC2 PE=3 SV=1 90 540 2.0E-53
sp|Q7VH31|LEUC_HELHP 3-isopropylmalate dehydratase large subunit OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=leuC PE=3 SV=1 89 537 2.0E-53
sp|A8MDY8|LEUC_CALMQ 3-isopropylmalate dehydratase large subunit OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=leuC PE=3 SV=1 90 540 3.0E-53
sp|Q7M9Z9|LEUC_WOLSU 3-isopropylmalate dehydratase large subunit OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=leuC PE=3 SV=1 89 537 4.0E-53
sp|Q938C9|LEUC_MYCS2 3-isopropylmalate dehydratase large subunit OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=leuC PE=3 SV=1 89 534 6.0E-53
sp|A3DHI4|LEUC_CLOTH 3-isopropylmalate dehydratase large subunit OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=leuC PE=3 SV=1 89 537 7.0E-53
sp|Q97VY2|LEUC_SULSO 3-isopropylmalate dehydratase large subunit OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=leuC PE=3 SV=1 89 537 8.0E-53
sp|B9L6Y8|LEUC_NAUPA 3-isopropylmalate dehydratase large subunit OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=leuC PE=3 SV=1 88 537 1.0E-52
sp|Q9RTY9|LEUC1_DEIRA 3-isopropylmalate dehydratase large subunit 1 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=leuC1 PE=3 SV=1 74 537 1.0E-52
sp|B2TIQ9|LEUC_CLOBB 3-isopropylmalate dehydratase large subunit OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=leuC PE=3 SV=1 89 537 2.0E-52
sp|Q24XT4|LEUC_DESHY 3-isopropylmalate dehydratase large subunit OS=Desulfitobacterium hafniense (strain Y51) GN=leuC PE=3 SV=2 90 537 4.0E-52
sp|A9KT79|LEUC_CLOPH 3-isopropylmalate dehydratase large subunit OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=leuC PE=3 SV=1 89 537 7.0E-52
sp|A6Q6J8|LEUC_SULNB 3-isopropylmalate dehydratase large subunit OS=Sulfurovum sp. (strain NBC37-1) GN=leuC PE=3 SV=1 89 537 1.0E-51
sp|B1H0A6|LEUC_UNCTG 3-isopropylmalate dehydratase large subunit OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=leuC PE=3 SV=1 89 537 2.0E-51
sp|B0TCR2|LEUC_HELMI 3-isopropylmalate dehydratase large subunit OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=leuC PE=3 SV=1 89 537 5.0E-51
sp|Q974R0|LEUC_SULTO 3-isopropylmalate dehydratase large subunit OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=leuC PE=3 SV=1 88 537 6.0E-51
sp|B5YKE0|LEUC_THEYD 3-isopropylmalate dehydratase large subunit OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=leuC PE=3 SV=1 89 537 8.0E-51
sp|A1RVH3|LEUC_PYRIL 3-isopropylmalate dehydratase large subunit OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=leuC PE=3 SV=1 90 540 5.0E-50
sp|A7HZP6|LEUC_CAMHC 3-isopropylmalate dehydratase large subunit OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=leuC PE=3 SV=1 89 537 8.0E-50
sp|A6LPX4|LEUC_CLOB8 3-isopropylmalate dehydratase large subunit OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=leuC PE=3 SV=1 89 537 9.0E-50
sp|A7H0L8|LEUC_CAMC5 3-isopropylmalate dehydratase large subunit OS=Campylobacter curvus (strain 525.92) GN=leuC PE=3 SV=1 89 537 1.0E-49
sp|Q8ZW41|LEUC_PYRAE 3-isopropylmalate dehydratase large subunit OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=leuC PE=3 SV=1 106 542 3.0E-49
sp|B1YD98|LEUC_PYRNV 3-isopropylmalate dehydratase large subunit OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=leuC PE=3 SV=1 90 543 5.0E-49
sp|A8EQZ0|LEUC_ARCB4 3-isopropylmalate dehydratase large subunit OS=Arcobacter butzleri (strain RM4018) GN=leuC PE=3 SV=1 89 537 7.0E-49
sp|A4WMI6|LEUC_PYRAR 3-isopropylmalate dehydratase large subunit OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=leuC PE=3 SV=1 90 542 8.0E-49
sp|Q74BX5|LEUC_GEOSL 3-isopropylmalate dehydratase large subunit OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=leuC PE=3 SV=1 89 540 1.0E-48
sp|A0RMG7|LEUC_CAMFF 3-isopropylmalate dehydratase large subunit OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=leuC PE=3 SV=1 89 537 2.0E-48
sp|Q39W70|LEUC_GEOMG 3-isopropylmalate dehydratase large subunit OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=leuC PE=3 SV=1 123 540 2.0E-48
sp|Q67MJ2|LEUC_SYMTH 3-isopropylmalate dehydratase large subunit OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=leuC PE=3 SV=1 89 534 7.0E-48
sp|A9A043|LEUC_DESOH 3-isopropylmalate dehydratase large subunit OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=leuC PE=3 SV=1 89 511 8.0E-48
sp|A3MWJ4|LEUC_PYRCJ 3-isopropylmalate dehydratase large subunit OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=leuC PE=3 SV=1 106 540 9.0E-48
sp|Q5WEN5|LEUC_BACSK 3-isopropylmalate dehydratase large subunit OS=Bacillus clausii (strain KSM-K16) GN=leuC PE=3 SV=1 89 522 2.0E-47
sp|Q5KWJ5|LEUC_GEOKA 3-isopropylmalate dehydratase large subunit OS=Geobacillus kaustophilus (strain HTA426) GN=leuC PE=3 SV=1 88 534 4.0E-47
sp|Q1AZC4|LEUC1_RUBXD 3-isopropylmalate dehydratase large subunit 1 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=leuC1 PE=3 SV=1 88 537 4.0E-47
sp|A4IRH6|LEUC_GEOTN 3-isopropylmalate dehydratase large subunit OS=Geobacillus thermodenitrificans (strain NG80-2) GN=leuC PE=3 SV=2 88 532 8.0E-47
sp|Q8U0C0|LEUC2_PYRFU 3-isopropylmalate dehydratase large subunit 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=leuC2 PE=3 SV=1 110 537 2.0E-46
sp|O14289|LEUC_SCHPO 3-isopropylmalate dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=leu2 PE=1 SV=1 87 719 4.0E-46
sp|Q9K8F0|LEUC_BACHD 3-isopropylmalate dehydratase large subunit OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=leuC PE=3 SV=1 88 546 4.0E-46
sp|A7Z7B6|LEUC_BACMF 3-isopropylmalate dehydratase large subunit OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=leuC PE=3 SV=1 88 534 7.0E-46
sp|C5D5L8|LEUC_GEOSW 3-isopropylmalate dehydratase large subunit OS=Geobacillus sp. (strain WCH70) GN=leuC PE=3 SV=1 88 542 1.0E-45
sp|B7GH21|LEUC_ANOFW 3-isopropylmalate dehydratase large subunit OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=leuC PE=3 SV=1 88 534 2.0E-45
sp|B5EHU2|LEUC_GEOBB 3-isopropylmalate dehydratase large subunit OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=leuC PE=3 SV=1 106 540 3.0E-45
sp|P49601|LEUC_USTMA 3-isopropylmalate dehydratase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=LEU1 PE=3 SV=1 88 723 4.0E-45
sp|Q65GJ0|LEUC_BACLD 3-isopropylmalate dehydratase large subunit OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=leuC PE=3 SV=1 88 546 4.0E-45
sp|A5G7U4|LEUC_GEOUR 3-isopropylmalate dehydratase large subunit OS=Geobacter uraniireducens (strain Rf4) GN=leuC PE=3 SV=1 123 540 4.0E-45
sp|A7NJH2|LEUC_ROSCS 3-isopropylmalate dehydratase large subunit OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=leuC PE=3 SV=1 88 540 5.0E-45
sp|A5UUP5|LEUC_ROSS1 3-isopropylmalate dehydratase large subunit OS=Roseiflexus sp. (strain RS-1) GN=leuC PE=3 SV=1 87 540 8.0E-45
sp|A0QJB7|LEUC_MYCA1 3-isopropylmalate dehydratase large subunit OS=Mycobacterium avium (strain 104) GN=leuC PE=3 SV=1 84 537 8.0E-45
sp|P80858|LEUC_BACSU 3-isopropylmalate dehydratase large subunit OS=Bacillus subtilis (strain 168) GN=leuC PE=1 SV=1 88 542 8.0E-45
sp|Q8TW29|LEUC2_METKA 3-isopropylmalate dehydratase large subunit 2 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=leuC2 PE=3 SV=1 106 537 1.0E-44
sp|Q73VI7|LEUC_MYCPA 3-isopropylmalate dehydratase large subunit OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=leuC PE=3 SV=1 82 537 1.0E-44
sp|A4X4C8|LEUC_SALTO 3-isopropylmalate dehydratase large subunit OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=leuC PE=3 SV=1 88 537 3.0E-44
sp|A8FFW3|LEUC_BACP2 3-isopropylmalate dehydratase large subunit OS=Bacillus pumilus (strain SAFR-032) GN=leuC PE=3 SV=1 88 532 3.0E-44
sp|Q4WBR0|ACON3_ASPFU Putative aconitate hydratase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=acoC PE=2 SV=1 90 735 3.0E-44
sp|Q94AR8|LEUC_ARATH 3-isopropylmalate dehydratase large subunit OS=Arabidopsis thaliana GN=IIL1 PE=1 SV=1 81 537 3.0E-44
sp|O59391|LEUC_PYRHO 3-isopropylmalate dehydratase large subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=leuC PE=3 SV=1 110 538 3.0E-44
sp|Q5JFV6|LEUC_THEKO 3-isopropylmalate dehydratase large subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=leuC PE=3 SV=1 110 537 4.0E-44
sp|P55811|LEUC_RHINI 3-isopropylmalate dehydratase OS=Rhizopus niveus GN=LEU1 PE=3 SV=1 89 720 1.0E-43
sp|A1T700|LEUC_MYCVP 3-isopropylmalate dehydratase large subunit OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=leuC PE=3 SV=1 83 537 1.0E-43
sp|P18250|LEUC_PHYB8 3-isopropylmalate dehydratase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=leu1 PE=3 SV=2 123 716 1.0E-43
sp|Q8EN69|LEUC_OCEIH 3-isopropylmalate dehydratase large subunit OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=leuC PE=3 SV=1 88 534 5.0E-43
sp|B1ZKX6|LEUC_METPB 3-isopropylmalate dehydratase large subunit OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=leuC PE=3 SV=1 88 522 7.0E-43
sp|P55251|LEUC_RHIPU 3-isopropylmalate dehydratase OS=Rhizomucor pusillus GN=LEUA PE=3 SV=1 117 720 1.0E-42
sp|A0LVA3|LEUC_ACIC1 3-isopropylmalate dehydratase large subunit OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=leuC PE=3 SV=1 89 537 3.0E-42
sp|A0PPZ6|LEUC_MYCUA 3-isopropylmalate dehydratase large subunit OS=Mycobacterium ulcerans (strain Agy99) GN=leuC PE=3 SV=1 89 537 3.0E-42
sp|Q5YRY0|LEUC_NOCFA 3-isopropylmalate dehydratase large subunit OS=Nocardia farcinica (strain IFM 10152) GN=leuC PE=3 SV=1 85 537 3.0E-42
sp|Q00464|LEUC_CANMA 3-isopropylmalate dehydratase OS=Candida maltosa GN=LEU1 PE=3 SV=1 87 720 4.0E-42
sp|Q47SA3|LEUC_THEFY 3-isopropylmalate dehydratase large subunit OS=Thermobifida fusca (strain YX) GN=leuC PE=3 SV=1 89 537 4.0E-42
sp|B2HII1|LEUC_MYCMM 3-isopropylmalate dehydratase large subunit OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=leuC PE=3 SV=1 89 537 4.0E-42
sp|Q9V1J0|LEUC2_PYRAB 3-isopropylmalate dehydratase large subunit 2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=leuC2 PE=3 SV=1 125 537 6.0E-42
sp|Q44427|LEUC_ACTTI 3-isopropylmalate dehydratase large subunit OS=Actinoplanes teichomyceticus GN=leuC PE=3 SV=1 85 537 1.0E-41
sp|B8DBU2|LEUC_LISMH 3-isopropylmalate dehydratase large subunit OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=leuC PE=3 SV=1 89 534 2.0E-41
sp|A4TE23|LEUC_MYCGI 3-isopropylmalate dehydratase large subunit OS=Mycobacterium gilvum (strain PYR-GCK) GN=leuC PE=3 SV=1 83 537 2.0E-41
sp|Q71Y33|LEUC_LISMF 3-isopropylmalate dehydratase large subunit OS=Listeria monocytogenes serotype 4b (strain F2365) GN=leuC PE=3 SV=1 89 534 2.0E-41
sp|C1KWT3|LEUC_LISMC 3-isopropylmalate dehydratase large subunit OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=leuC PE=3 SV=1 89 534 2.0E-41
sp|Q5FUG3|LEUC_GLUOX 3-isopropylmalate dehydratase large subunit OS=Gluconobacter oxydans (strain 621H) GN=leuC PE=3 SV=1 85 534 2.0E-41
sp|Q4L7U2|LEUC_STAHJ 3-isopropylmalate dehydratase large subunit OS=Staphylococcus haemolyticus (strain JCSC1435) GN=leuC PE=3 SV=1 117 532 3.0E-41
sp|P07264|LEUC_YEAST 3-isopropylmalate dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEU1 PE=1 SV=3 85 718 3.0E-41
sp|Q8CNL1|LEUC_STAES 3-isopropylmalate dehydratase large subunit OS=Staphylococcus epidermidis (strain ATCC 12228) GN=leuC PE=3 SV=1 89 532 3.0E-41
sp|A3PXR2|LEUC_MYCSJ 3-isopropylmalate dehydratase large subunit OS=Mycobacterium sp. (strain JLS) GN=leuC PE=3 SV=1 87 537 3.0E-41
sp|Q54XS2|ACON_DICDI Probable aconitate hydratase, mitochondrial OS=Dictyostelium discoideum GN=aco2 PE=3 SV=1 86 534 4.0E-41
sp|A8M5I3|LEUC_SALAI 3-isopropylmalate dehydratase large subunit OS=Salinispora arenicola (strain CNS-205) GN=leuC PE=3 SV=1 88 537 5.0E-41
sp|Q1BAQ4|LEUC_MYCSS 3-isopropylmalate dehydratase large subunit OS=Mycobacterium sp. (strain MCS) GN=leuC PE=3 SV=1 87 537 5.0E-41
sp|A1UEA8|LEUC_MYCSK 3-isopropylmalate dehydratase large subunit OS=Mycobacterium sp. (strain KMS) GN=leuC PE=3 SV=1 87 537 5.0E-41
sp|B1LXK9|LEUC_METRJ 3-isopropylmalate dehydratase large subunit OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=leuC PE=3 SV=1 87 522 1.0E-40
sp|C1F700|LEUC_ACIC5 3-isopropylmalate dehydratase large subunit OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=leuC PE=3 SV=1 89 535 2.0E-40
sp|Q8Y5R7|LEUC_LISMO 3-isopropylmalate dehydratase large subunit OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=leuC PE=3 SV=1 89 534 4.0E-40
sp|A0AK94|LEUC_LISW6 3-isopropylmalate dehydratase large subunit OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=leuC PE=3 SV=1 89 534 5.0E-40
sp|Q92A26|LEUC_LISIN 3-isopropylmalate dehydratase large subunit OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=leuC PE=3 SV=1 89 534 5.0E-40
sp|Q8F4E6|LEUC_LEPIN 3-isopropylmalate dehydratase large subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=leuC PE=3 SV=1 89 534 6.0E-40
sp|Q72RC4|LEUC_LEPIC 3-isopropylmalate dehydratase large subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=leuC PE=3 SV=1 89 534 6.0E-40
sp|Q47WG2|LEUC_COLP3 3-isopropylmalate dehydratase large subunit OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=leuC PE=3 SV=1 84 534 8.0E-40
sp|Q3Z5T8|LEUC_SHISS 3-isopropylmalate dehydratase large subunit OS=Shigella sonnei (strain Ss046) GN=leuC PE=3 SV=1 117 535 9.0E-40
sp|A5G0G6|LEUC_ACICJ 3-isopropylmalate dehydratase large subunit OS=Acidiphilium cryptum (strain JF-5) GN=leuC PE=3 SV=1 117 537 1.0E-39
sp|B2GCB8|LEUC_LACF3 3-isopropylmalate dehydratase large subunit OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=leuC PE=3 SV=1 89 534 1.0E-39
sp|Q8UBY9|LEUC_AGRFC 3-isopropylmalate dehydratase large subunit OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=leuC PE=3 SV=2 88 534 1.0E-39
sp|A6T015|LEUC_JANMA 3-isopropylmalate dehydratase large subunit OS=Janthinobacterium sp. (strain Marseille) GN=leuC PE=3 SV=1 89 534 1.0E-39
sp|Q89X34|LEUC2_BRADU 3-isopropylmalate dehydratase large subunit 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=leuC2 PE=3 SV=1 117 534 1.0E-39
sp|A4W6H7|LEUC_ENT38 3-isopropylmalate dehydratase large subunit OS=Enterobacter sp. (strain 638) GN=leuC PE=3 SV=1 117 535 2.0E-39
sp|A4G4F5|LEUC_HERAR 3-isopropylmalate dehydratase large subunit OS=Herminiimonas arsenicoxydans GN=leuC PE=3 SV=1 89 534 2.0E-39
sp|Q5HMF7|LEUC_STAEQ 3-isopropylmalate dehydratase large subunit OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=leuC PE=3 SV=1 89 532 3.0E-39
sp|Q2RV55|LEUC_RHORT 3-isopropylmalate dehydratase large subunit OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=leuC PE=3 SV=1 88 534 4.0E-39
sp|A6UE05|LEUC_SINMW 3-isopropylmalate dehydratase large subunit OS=Sinorhizobium medicae (strain WSM419) GN=leuC PE=3 SV=1 88 534 5.0E-39
sp|Q21CT4|LEUC_RHOPB 3-isopropylmalate dehydratase large subunit OS=Rhodopseudomonas palustris (strain BisB18) GN=leuC PE=3 SV=1 81 534 5.0E-39
sp|Q4JUX2|LEUC_CORJK 3-isopropylmalate dehydratase large subunit OS=Corynebacterium jeikeium (strain K411) GN=leuC PE=3 SV=1 85 537 6.0E-39
sp|C1AGA3|LEUC_MYCBT 3-isopropylmalate dehydratase large subunit OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=leuC PE=3 SV=1 88 537 6.0E-39
sp|A1KMY2|LEUC_MYCBP 3-isopropylmalate dehydratase large subunit OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=leuC PE=3 SV=1 88 537 6.0E-39
sp|Q7TXH6|LEUC_MYCBO 3-isopropylmalate dehydratase large subunit OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=leuC PE=1 SV=1 88 537 6.0E-39
sp|B7UIC2|LEUC_ECO27 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=leuC PE=3 SV=1 117 535 8.0E-39
sp|B1IRA6|LEUC_ECOLC 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=leuC PE=3 SV=1 117 535 8.0E-39
sp|A7ZW23|LEUC_ECOHS 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O9:H4 (strain HS) GN=leuC PE=3 SV=1 117 535 8.0E-39
sp|B7L4J3|LEUC_ECO55 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain 55989 / EAEC) GN=leuC PE=3 SV=1 117 535 9.0E-39
sp|P9WQF5|LEUC_MYCTU 3-isopropylmalate dehydratase large subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=leuC PE=1 SV=1 88 537 1.0E-38
sp|P9WQF4|LEUC_MYCTO 3-isopropylmalate dehydratase large subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=leuC PE=3 SV=1 88 537 1.0E-38
sp|A5U6Z9|LEUC_MYCTA 3-isopropylmalate dehydratase large subunit OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=leuC PE=3 SV=1 88 537 1.0E-38
sp|Q74ZM9|LEUC_ASHGO 3-isopropylmalate dehydratase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LEU1 PE=3 SV=2 117 720 1.0E-38
sp|A7ZHG4|LEUC_ECO24 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=leuC PE=3 SV=1 117 535 1.0E-38
sp|B2U279|LEUC_SHIB3 3-isopropylmalate dehydratase large subunit OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=leuC PE=3 SV=1 117 535 1.0E-38
sp|Q1RGC5|LEUC_ECOUT 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain UTI89 / UPEC) GN=leuC PE=3 SV=1 117 535 1.0E-38
sp|B1LG09|LEUC_ECOSM 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=leuC PE=3 SV=1 117 535 1.0E-38
sp|B6HZ52|LEUC_ECOSE 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain SE11) GN=leuC PE=3 SV=1 117 535 1.0E-38
sp|P0A6A6|LEUC_ECOLI 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain K12) GN=leuC PE=1 SV=2 117 535 1.0E-38
sp|P0A6A7|LEUC_ECOL6 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=leuC PE=3 SV=2 117 535 1.0E-38
sp|Q0TLR7|LEUC_ECOL5 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=leuC PE=3 SV=1 117 535 1.0E-38
sp|A1A7C0|LEUC_ECOK1 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O1:K1 / APEC GN=leuC PE=3 SV=1 117 535 1.0E-38
sp|C4ZPZ5|LEUC_ECOBW 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=leuC PE=3 SV=1 117 535 1.0E-38
sp|B7M117|LEUC_ECO8A 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O8 (strain IAI1) GN=leuC PE=3 SV=1 117 535 1.0E-38
sp|B7MNT0|LEUC_ECO81 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O81 (strain ED1a) GN=leuC PE=3 SV=1 117 535 1.0E-38
sp|B7NHI0|LEUC_ECO7I 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=leuC PE=3 SV=1 117 535 1.0E-38
sp|B7MAJ7|LEUC_ECO45 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=leuC PE=3 SV=1 117 535 1.0E-38
sp|O33123|LEUC_MYCLE 3-isopropylmalate dehydratase large subunit OS=Mycobacterium leprae (strain TN) GN=leuC PE=3 SV=1 88 537 1.0E-38
sp|B8HAC9|LEUC_ARTCA 3-isopropylmalate dehydratase large subunit OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=leuC PE=3 SV=1 89 537 1.0E-38
sp|Q0T8C6|LEUC_SHIF8 3-isopropylmalate dehydratase large subunit OS=Shigella flexneri serotype 5b (strain 8401) GN=leuC PE=3 SV=1 117 535 1.0E-38
sp|B7N7U7|LEUC_ECOLU 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=leuC PE=3 SV=1 117 535 1.0E-38
sp|B5YZA8|LEUC_ECO5E 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=leuC PE=3 SV=1 117 535 2.0E-38
sp|Q8XA00|LEUC_ECO57 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O157:H7 GN=leuC PE=3 SV=3 117 535 2.0E-38
sp|A6T4L7|LEUC_KLEP7 3-isopropylmalate dehydratase large subunit OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=leuC PE=3 SV=1 117 535 2.0E-38
sp|A1B513|LEUC_PARDP 3-isopropylmalate dehydratase large subunit OS=Paracoccus denitrificans (strain Pd 1222) GN=leuC PE=3 SV=1 82 534 2.0E-38
sp|Q6NHL0|LEUC_CORDI 3-isopropylmalate dehydratase large subunit OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=leuC PE=3 SV=1 79 537 2.0E-38
sp|B5Y1W4|LEUC_KLEP3 3-isopropylmalate dehydratase large subunit OS=Klebsiella pneumoniae (strain 342) GN=leuC PE=3 SV=1 117 535 2.0E-38
sp|B7KRK4|LEUC_METC4 3-isopropylmalate dehydratase large subunit OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=leuC PE=3 SV=1 88 522 2.0E-38
sp|P58947|LEUC_STAAW 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain MW2) GN=leuC PE=3 SV=1 89 532 2.0E-38
sp|Q6G7P9|LEUC_STAAS 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain MSSA476) GN=leuC PE=3 SV=1 89 532 2.0E-38
sp|A8Z4W2|LEUC_STAAT 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=leuC PE=3 SV=1 89 532 3.0E-38
sp|P63436|LEUC_STAAN 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain N315) GN=leuC PE=3 SV=1 89 532 3.0E-38
sp|P63435|LEUC_STAAM 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=leuC PE=3 SV=1 89 532 3.0E-38
sp|A6QIQ5|LEUC_STAAE 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain Newman) GN=leuC PE=3 SV=1 89 532 3.0E-38
sp|Q5HEE2|LEUC_STAAC 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain COL) GN=leuC PE=3 SV=1 89 532 3.0E-38
sp|Q2YUF0|LEUC_STAAB 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=leuC PE=3 SV=1 89 532 3.0E-38
sp|A5IUK5|LEUC_STAA9 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain JH9) GN=leuC PE=3 SV=1 89 532 3.0E-38
sp|Q2FWK1|LEUC_STAA8 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain NCTC 8325) GN=leuC PE=3 SV=1 89 532 3.0E-38
sp|Q2FF65|LEUC_STAA3 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain USA300) GN=leuC PE=3 SV=1 89 532 3.0E-38
sp|A6U3E4|LEUC_STAA2 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain JH1) GN=leuC PE=3 SV=1 89 532 3.0E-38
sp|A7X4N3|LEUC_STAA1 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=leuC PE=3 SV=1 89 532 3.0E-38
sp|Q65VS0|LEUC1_MANSM 3-isopropylmalate dehydratase large subunit 1 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=leuC1 PE=3 SV=1 89 534 3.0E-38
sp|Q6GF14|LEUC_STAAR 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain MRSA252) GN=leuC PE=3 SV=1 89 532 3.0E-38
sp|Q32K22|LEUC_SHIDS 3-isopropylmalate dehydratase large subunit OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=leuC PE=3 SV=1 117 535 3.0E-38
sp|A4QDS8|LEUC_CORGB 3-isopropylmalate dehydratase large subunit OS=Corynebacterium glutamicum (strain R) GN=leuC PE=3 SV=1 82 537 3.0E-38
sp|P58945|LEUC_BUCPS 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Pemphigus spyrothecae GN=leuC PE=3 SV=1 117 535 4.0E-38
sp|B7LWE0|LEUC_ESCF3 3-isopropylmalate dehydratase large subunit OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=leuC PE=3 SV=1 117 535 4.0E-38
sp|A7HT10|LEUC_PARL1 3-isopropylmalate dehydratase large subunit OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=leuC PE=3 SV=1 117 534 5.0E-38
sp|B1MDQ1|LEUC_MYCA9 3-isopropylmalate dehydratase large subunit OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=leuC PE=3 SV=1 88 537 6.0E-38
sp|Q8FPR3|LEUC_COREF 3-isopropylmalate dehydratase large subunit OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=leuC PE=3 SV=1 83 537 6.0E-38
sp|Q821C2|LEUC_SHIFL 3-isopropylmalate dehydratase large subunit OS=Shigella flexneri GN=leuC PE=3 SV=1 117 535 7.0E-38
sp|A1R7K0|LEUC_ARTAT 3-isopropylmalate dehydratase large subunit OS=Arthrobacter aurescens (strain TC1) GN=leuC PE=3 SV=1 89 537 9.0E-38
sp|P58946|LEUC_CORGL 3-isopropylmalate dehydratase large subunit OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=leuC PE=2 SV=1 82 537 9.0E-38
sp|Q92L76|LEUC_RHIME 3-isopropylmalate dehydratase large subunit OS=Rhizobium meliloti (strain 1021) GN=leuC PE=3 SV=1 117 534 1.0E-37
sp|Q1MAJ9|LEUC_RHIL3 3-isopropylmalate dehydratase large subunit OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=leuC PE=3 SV=1 88 534 1.0E-37
sp|Q98EF1|LEUC_RHILO 3-isopropylmalate dehydratase large subunit OS=Rhizobium loti (strain MAFF303099) GN=leuC PE=3 SV=1 88 534 1.0E-37
sp|Q57SN1|LEUC2_SALCH 3-isopropylmalate dehydratase large subunit 2 OS=Salmonella choleraesuis (strain SC-B67) GN=leuC2 PE=3 SV=1 87 534 1.0E-37
sp|Q326G3|LEUC_SHIBS 3-isopropylmalate dehydratase large subunit OS=Shigella boydii serotype 4 (strain Sb227) GN=leuC PE=3 SV=1 117 535 1.0E-37
sp|A8ALM7|LEUC_CITK8 3-isopropylmalate dehydratase large subunit OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=leuC PE=3 SV=1 117 535 2.0E-37
sp|Q4FP15|LEUC_PELUB 3-isopropylmalate dehydratase large subunit OS=Pelagibacter ubique (strain HTCC1062) GN=leuC PE=3 SV=1 117 541 2.0E-37
sp|Q07UU3|LEUC_RHOP5 3-isopropylmalate dehydratase large subunit OS=Rhodopseudomonas palustris (strain BisA53) GN=leuC PE=3 SV=1 117 534 2.0E-37
sp|B5ZTI5|LEUC_RHILW 3-isopropylmalate dehydratase large subunit OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=leuC PE=3 SV=1 88 534 2.0E-37
sp|Q2J3A1|LEUC_RHOP2 3-isopropylmalate dehydratase large subunit OS=Rhodopseudomonas palustris (strain HaA2) GN=leuC PE=3 SV=1 117 534 2.0E-37
sp|Q7UIA7|LEUC_RHOBA 3-isopropylmalate dehydratase large subunit OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=leuC PE=3 SV=2 123 534 2.0E-37
sp|B3Q851|LEUC_RHOPT 3-isopropylmalate dehydratase large subunit OS=Rhodopseudomonas palustris (strain TIE-1) GN=leuC PE=3 SV=1 117 534 3.0E-37
sp|P19414|ACON_YEAST Aconitate hydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACO1 PE=1 SV=2 88 532 3.0E-37
sp|Q8ZRJ0|LEUC2_SALTY 3-isopropylmalate dehydratase large subunit 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=leuC2 PE=3 SV=1 87 534 3.0E-37
sp|A9MQE0|LEUC_SALAR 3-isopropylmalate dehydratase large subunit OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=leuC PE=3 SV=1 89 535 3.0E-37
sp|B9JUD6|LEUC_AGRVS 3-isopropylmalate dehydratase large subunit OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=leuC PE=3 SV=1 88 534 4.0E-37
sp|Q01Z81|LEUC_SOLUE 3-isopropylmalate dehydratase large subunit OS=Solibacter usitatus (strain Ellin6076) GN=leuC PE=3 SV=1 88 534 4.0E-37
sp|C3M9V0|LEUC_RHISN 3-isopropylmalate dehydratase large subunit OS=Rhizobium sp. (strain NGR234) GN=leuC PE=3 SV=1 117 534 4.0E-37
sp|A4WNV5|LEUC_RHOS5 3-isopropylmalate dehydratase large subunit OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=leuC PE=3 SV=1 88 534 4.0E-37
sp|Q8Z9I2|LEUC_SALTI 3-isopropylmalate dehydratase large subunit OS=Salmonella typhi GN=leuC PE=3 SV=2 89 535 5.0E-37
sp|B4TWV9|LEUC_SALSV 3-isopropylmalate dehydratase large subunit OS=Salmonella schwarzengrund (strain CVM19633) GN=leuC PE=3 SV=1 89 535 5.0E-37
sp|B5F7U7|LEUC_SALA4 3-isopropylmalate dehydratase large subunit OS=Salmonella agona (strain SL483) GN=leuC PE=3 SV=1 89 535 5.0E-37
sp|Q57TE8|LEUC1_SALCH 3-isopropylmalate dehydratase large subunit 1 OS=Salmonella choleraesuis (strain SC-B67) GN=leuC1 PE=3 SV=1 89 535 5.0E-37
sp|Q49Z14|LEUC_STAS1 3-isopropylmalate dehydratase large subunit OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=leuC PE=3 SV=1 89 532 5.0E-37
sp|Q13DU7|LEUC_RHOPS 3-isopropylmalate dehydratase large subunit OS=Rhodopseudomonas palustris (strain BisB5) GN=leuC PE=3 SV=1 117 534 5.0E-37
sp|P15717|LEUC1_SALTY 3-isopropylmalate dehydratase large subunit 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=leuC1 PE=1 SV=4 89 535 6.0E-37
sp|B5BLB3|LEUC_SALPK 3-isopropylmalate dehydratase large subunit OS=Salmonella paratyphi A (strain AKU_12601) GN=leuC PE=3 SV=1 89 535 7.0E-37
sp|Q5PDG3|LEUC_SALPA 3-isopropylmalate dehydratase large subunit OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=leuC PE=3 SV=1 89 535 7.0E-37
sp|Q6ND69|LEUC_RHOPA 3-isopropylmalate dehydratase large subunit OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=leuC PE=3 SV=1 117 534 8.0E-37
sp|B9DMJ8|LEUC_STACT 3-isopropylmalate dehydratase large subunit OS=Staphylococcus carnosus (strain TM300) GN=leuC PE=3 SV=1 89 539 9.0E-37
sp|A0JXX8|LEUC_ARTS2 3-isopropylmalate dehydratase large subunit OS=Arthrobacter sp. (strain FB24) GN=leuC PE=3 SV=1 89 537 9.0E-37
sp|A7MIC7|LEUC_CROS8 3-isopropylmalate dehydratase large subunit OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=leuC PE=3 SV=1 89 535 1.0E-36
sp|Q1QHI4|LEUC_NITHX 3-isopropylmalate dehydratase large subunit OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=leuC PE=3 SV=1 88 534 1.0E-36
sp|Q7VDT0|LEUC_PROMA 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=leuC PE=3 SV=1 87 534 1.0E-36
sp|Q3IZI8|LEUC_RHOS4 3-isopropylmalate dehydratase large subunit OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=leuC PE=3 SV=1 117 534 2.0E-36
sp|A3PMQ9|LEUC_RHOS1 3-isopropylmalate dehydratase large subunit OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=leuC PE=3 SV=1 117 534 2.0E-36
sp|Q0BRH4|LEUC_GRABC 3-isopropylmalate dehydratase large subunit OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=leuC PE=3 SV=1 117 534 2.0E-36
sp|B8F3W8|LEUC_HAEPS 3-isopropylmalate dehydratase large subunit OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=leuC PE=3 SV=1 89 532 2.0E-36
sp|B9KMK4|LEUC_RHOSK 3-isopropylmalate dehydratase large subunit OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=leuC PE=3 SV=1 117 534 2.0E-36
sp|Q6AFK7|LEUC_LEIXX 3-isopropylmalate dehydratase large subunit OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=leuC PE=3 SV=1 84 537 2.0E-36
sp|Q82WI9|LEUC_NITEU 3-isopropylmalate dehydratase large subunit OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=leuC PE=3 SV=1 82 534 2.0E-36
sp|B8GQD6|LEUC_THISH 3-isopropylmalate dehydratase large subunit OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=leuC PE=3 SV=1 117 534 3.0E-36
sp|B0CG35|LEUC_ACAM1 3-isopropylmalate dehydratase large subunit OS=Acaryochloris marina (strain MBIC 11017) GN=leuC PE=3 SV=1 90 535 3.0E-36
sp|A1SLW5|LEUC_NOCSJ 3-isopropylmalate dehydratase large subunit OS=Nocardioides sp. (strain BAA-499 / JS614) GN=leuC PE=3 SV=1 89 537 3.0E-36
sp|Q2VZV4|LEUC_MAGSA 3-isopropylmalate dehydratase large subunit OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=leuC PE=3 SV=1 117 534 4.0E-36
sp|Q4WLN1|ACON_ASPFU Aconitate hydratase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=acoA PE=1 SV=1 88 534 4.0E-36
sp|B0JY97|LEUC_MICAN 3-isopropylmalate dehydratase large subunit OS=Microcystis aeruginosa (strain NIES-843) GN=leuC PE=3 SV=1 89 537 4.0E-36
sp|P54384|LEUC_SYNY3 3-isopropylmalate dehydratase large subunit OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=leuC PE=3 SV=2 87 535 4.0E-36
sp|Q5V518|LEUC_HALMA 3-isopropylmalate dehydratase large subunit OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=leuC PE=3 SV=1 90 535 5.0E-36
sp|Q4WJ90|ACON2_ASPFU Putative aconitate hydratase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=acoB PE=2 SV=1 68 707 5.0E-36
sp|Q3SNV3|LEUC_NITWN 3-isopropylmalate dehydratase large subunit OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=leuC PE=3 SV=1 88 534 6.0E-36
sp|Q2K376|LEUC_RHIEC 3-isopropylmalate dehydratase large subunit OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=leuC PE=3 SV=1 88 534 7.0E-36
sp|Q8YJC9|LEUC_BRUME 3-isopropylmalate dehydratase large subunit OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=leuC PE=3 SV=1 117 534 8.0E-36
sp|C0RFF1|LEUC_BRUMB 3-isopropylmalate dehydratase large subunit OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=leuC PE=3 SV=1 117 534 8.0E-36
sp|Q8FYG9|LEUC_BRUSU 3-isopropylmalate dehydratase large subunit OS=Brucella suis biovar 1 (strain 1330) GN=leuC PE=3 SV=1 117 534 8.0E-36
sp|B0CIF7|LEUC_BRUSI 3-isopropylmalate dehydratase large subunit OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=leuC PE=3 SV=1 117 534 8.0E-36
sp|A5VSN3|LEUC_BRUO2 3-isopropylmalate dehydratase large subunit OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=leuC PE=3 SV=1 117 534 8.0E-36
sp|A9M8P2|LEUC_BRUC2 3-isopropylmalate dehydratase large subunit OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=leuC PE=3 SV=1 117 534 8.0E-36
sp|Q57AZ0|LEUC_BRUAB 3-isopropylmalate dehydratase large subunit OS=Brucella abortus biovar 1 (strain 9-941) GN=leuC PE=3 SV=1 117 534 8.0E-36
sp|Q2YLP7|LEUC_BRUA2 3-isopropylmalate dehydratase large subunit OS=Brucella abortus (strain 2308) GN=leuC PE=3 SV=1 117 534 8.0E-36
sp|B2S860|LEUC_BRUA1 3-isopropylmalate dehydratase large subunit OS=Brucella abortus (strain S19) GN=leuC PE=3 SV=1 117 534 8.0E-36
sp|B7KH96|LEUC_CYAP7 3-isopropylmalate dehydratase large subunit OS=Cyanothece sp. (strain PCC 7424) GN=leuC PE=3 SV=1 90 535 9.0E-36
sp|P39533|ACON2_YEAST Homocitrate dehydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACO2 PE=1 SV=1 73 532 1.0E-35
sp|Q7ZAG7|LEUC_HALVD 3-isopropylmalate dehydratase large subunit OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=leuC PE=3 SV=2 90 534 1.0E-35
sp|A4FMP2|LEUC_SACEN 3-isopropylmalate dehydratase large subunit OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=leuC PE=3 SV=1 89 537 1.0E-35
sp|Q7NFV7|LEUC_GLOVI 3-isopropylmalate dehydratase large subunit OS=Gloeobacter violaceus (strain PCC 7421) GN=leuC PE=3 SV=1 90 522 1.0E-35
sp|Q1GR84|LEUC_SPHAL 3-isopropylmalate dehydratase large subunit OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=leuC PE=3 SV=1 88 534 2.0E-35
sp|Q9EVI6|LEUC_BUCUN 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon sonchi GN=leuC PE=3 SV=1 123 511 2.0E-35
sp|B1WZV3|LEUC_CYAA5 3-isopropylmalate dehydratase large subunit OS=Cyanothece sp. (strain ATCC 51142) GN=leuC PE=3 SV=1 90 535 2.0E-35
sp|B3PR22|LEUC_RHIE6 3-isopropylmalate dehydratase large subunit OS=Rhizobium etli (strain CIAT 652) GN=leuC PE=3 SV=1 88 534 2.0E-35
sp|B8EN95|LEUC_METSB 3-isopropylmalate dehydratase large subunit OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=leuC PE=3 SV=1 88 522 3.0E-35
sp|Q9EVG8|LEUC_BUCUM 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon ambrosiae GN=leuC PE=3 SV=2 87 511 3.0E-35
sp|A1JJH5|LEUC_YERE8 3-isopropylmalate dehydratase large subunit OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=leuC PE=3 SV=1 89 535 3.0E-35
sp|A6W7Q7|LEUC_KINRD 3-isopropylmalate dehydratase large subunit OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=leuC PE=3 SV=1 89 547 3.0E-35
sp|B9LUZ3|LEUC_HALLT 3-isopropylmalate dehydratase large subunit OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=leuC PE=3 SV=1 90 534 3.0E-35
sp|A7H665|LEUC_CAMJD 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=leuC PE=3 SV=1 117 540 3.0E-35
sp|A1W1X0|LEUC_CAMJJ 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=leuC PE=3 SV=1 117 540 3.0E-35
sp|Q9P7D4|ACON2_SCHPO Homocitrate dehydratase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP4H10.15 PE=3 SV=3 90 707 4.0E-35
sp|Q11CQ6|LEUC_CHESB 3-isopropylmalate dehydratase large subunit OS=Chelativorans sp. (strain BNC1) GN=leuC PE=3 SV=1 88 534 4.0E-35
sp|Q9PLW1|LEUC_CAMJE 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=leuC PE=3 SV=1 117 540 4.0E-35
sp|Q5HS78|LEUC_CAMJR 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni (strain RM1221) GN=leuC PE=3 SV=1 117 540 5.0E-35
sp|P49609|ACON_GRAGA Aconitate hydratase, mitochondrial OS=Gracilaria gracilis PE=3 SV=1 88 534 5.0E-35
sp|B7GNM7|LEUC_BIFLS 3-isopropylmalate dehydratase large subunit OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=leuC PE=3 SV=1 117 537 5.0E-35
sp|A8FP33|LEUC_CAMJ8 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=leuC PE=3 SV=1 117 540 6.0E-35
sp|B8CM41|LEUC_SHEPW 3-isopropylmalate dehydratase large subunit OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=leuC PE=3 SV=1 89 534 7.0E-35
sp|B6JAQ9|LEUC_OLICO 3-isopropylmalate dehydratase large subunit OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=leuC PE=3 SV=1 88 534 9.0E-35
sp|C6DEW0|LEUC_PECCP 3-isopropylmalate dehydratase large subunit OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=leuC PE=3 SV=1 89 535 9.0E-35
sp|B9JCN5|LEUC_AGRRK 3-isopropylmalate dehydratase large subunit OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=leuC PE=3 SV=1 117 534 1.0E-34
sp|Q0RDK7|LEUC_FRAAA 3-isopropylmalate dehydratase large subunit OS=Frankia alni (strain ACN14a) GN=leuC PE=3 SV=1 89 537 1.0E-34
sp|Q2J6W9|LEUC_FRASC 3-isopropylmalate dehydratase large subunit OS=Frankia sp. (strain CcI3) GN=leuC PE=3 SV=1 89 537 1.0E-34
sp|A3M1S8|LEUC_ACIBT 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=leuC PE=3 SV=2 124 534 1.0E-34
sp|B4RVU9|LEUC_ALTMD 3-isopropylmalate dehydratase large subunit OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=leuC PE=3 SV=1 89 542 1.0E-34
sp|O85072|LEUC_BUCDN 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Diuraphis noxia GN=leuC PE=3 SV=1 117 537 1.0E-34
sp|A2RKR3|LEUC_LACLM 3-isopropylmalate dehydratase large subunit OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=leuC PE=3 SV=1 89 532 2.0E-34
sp|Q7N127|LEUC_PHOLL 3-isopropylmalate dehydratase large subunit OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=leuC PE=3 SV=1 117 534 2.0E-34
sp|P17279|LEUC_MUCCL 3-isopropylmalate dehydratase OS=Mucor circinelloides f. lusitanicus GN=LEUA PE=3 SV=1 117 534 2.0E-34
sp|A9VLG9|LEUC_BACWK 3-isopropylmalate dehydratase large subunit OS=Bacillus weihenstephanensis (strain KBAB4) GN=leuC PE=3 SV=1 117 535 2.0E-34
sp|Q1H0L4|LEUC_METFK 3-isopropylmalate dehydratase large subunit OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=leuC PE=3 SV=1 117 534 2.0E-34
sp|P16276|ACON_PIG Aconitate hydratase, mitochondrial OS=Sus scrofa GN=ACO2 PE=1 SV=1 86 534 2.0E-34
sp|Q5P1J8|LEUC_AROAE 3-isopropylmalate dehydratase large subunit OS=Aromatoleum aromaticum (strain EbN1) GN=leuC PE=3 SV=1 89 534 2.0E-34
sp|Q2G958|LEUC_NOVAD 3-isopropylmalate dehydratase large subunit OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=leuC PE=3 SV=1 84 534 3.0E-34
sp|P56934|LEUC_BUCAI 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=leuC PE=3 SV=2 117 532 3.0E-34
sp|Q99798|ACON_HUMAN Aconitate hydratase, mitochondrial OS=Homo sapiens GN=ACO2 PE=1 SV=2 86 534 3.0E-34
sp|Q2S0M6|LEUC_SALRD 3-isopropylmalate dehydratase large subunit OS=Salinibacter ruber (strain DSM 13855 / M31) GN=leuC PE=3 SV=1 90 534 3.0E-34
sp|A7GMU3|LEUC_BACCN 3-isopropylmalate dehydratase large subunit OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=leuC PE=3 SV=1 117 534 3.0E-34
sp|Q1IMI3|LEUC_KORVE 3-isopropylmalate dehydratase large subunit OS=Koribacter versatilis (strain Ellin345) GN=leuC PE=3 SV=1 88 534 3.0E-34
sp|Q82JR8|LEUC_STRAW 3-isopropylmalate dehydratase large subunit OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=leuC PE=3 SV=1 89 537 4.0E-34
sp|Q9ER34|ACON_RAT Aconitate hydratase, mitochondrial OS=Rattus norvegicus GN=Aco2 PE=1 SV=2 86 534 4.0E-34
sp|A8L567|LEUC_FRASN 3-isopropylmalate dehydratase large subunit OS=Frankia sp. (strain EAN1pec) GN=leuC PE=3 SV=1 89 537 4.0E-34
sp|Q2JPG2|LEUC_SYNJB 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=leuC PE=3 SV=1 87 534 5.0E-34
sp|Q66EM3|LEUC_YERPS 3-isopropylmalate dehydratase large subunit OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=leuC PE=3 SV=1 84 535 5.0E-34
sp|B2K4C7|LEUC_YERPB 3-isopropylmalate dehydratase large subunit OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=leuC PE=3 SV=1 84 535 5.0E-34
sp|C8VG90|ACON_EMENI Aconitate hydratase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acoA PE=2 SV=1 88 534 5.0E-34
sp|Q9CJN7|LEUC_PASMU 3-isopropylmalate dehydratase large subunit OS=Pasteurella multocida (strain Pm70) GN=leuC PE=3 SV=3 89 532 5.0E-34
sp|A0L1Q8|LEUC_SHESA 3-isopropylmalate dehydratase large subunit OS=Shewanella sp. (strain ANA-3) GN=leuC PE=3 SV=1 80 534 5.0E-34
sp|B1JKA0|LEUC_YERPY 3-isopropylmalate dehydratase large subunit OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=leuC PE=3 SV=1 84 535 6.0E-34
sp|A4TQA4|LEUC_YERPP 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis (strain Pestoides F) GN=leuC PE=3 SV=1 84 535 6.0E-34
sp|Q1CMP7|LEUC_YERPN 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=leuC PE=3 SV=1 84 535 6.0E-34
sp|A9R144|LEUC_YERPG 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis bv. Antiqua (strain Angola) GN=leuC PE=3 SV=1 84 535 6.0E-34
sp|Q8ZIH0|LEUC_YERPE 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis GN=leuC PE=3 SV=1 84 535 6.0E-34
sp|Q1C1Z4|LEUC_YERPA 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=leuC PE=3 SV=1 84 535 6.0E-34
sp|A7FM86|LEUC_YERP3 3-isopropylmalate dehydratase large subunit OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=leuC PE=3 SV=1 84 535 6.0E-34
sp|B7H0T7|LEUC_ACIB3 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baumannii (strain AB307-0294) GN=leuC PE=3 SV=1 124 534 6.0E-34
sp|B1XLQ6|LEUC_SYNP2 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=leuC PE=3 SV=1 90 534 7.0E-34
sp|B2JQE1|LEUC_BURP8 3-isopropylmalate dehydratase large subunit OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=leuC PE=3 SV=1 187 534 7.0E-34
sp|Q0HE67|LEUC_SHESM 3-isopropylmalate dehydratase large subunit OS=Shewanella sp. (strain MR-4) GN=leuC PE=3 SV=1 80 534 7.0E-34
sp|Q6FEW0|LEUC_ACIAD 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=leuC PE=3 SV=1 124 534 8.0E-34
sp|B2I359|LEUC_ACIBC 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baumannii (strain ACICU) GN=leuC PE=3 SV=1 124 534 8.0E-34
sp|B8HLN1|LEUC_CYAP4 3-isopropylmalate dehydratase large subunit OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=leuC PE=3 SV=1 90 534 8.0E-34
sp|B7I4E1|LEUC_ACIB5 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baumannii (strain AB0057) GN=leuC PE=3 SV=1 124 534 1.0E-33
sp|A3MYL1|LEUC_ACTP2 3-isopropylmalate dehydratase large subunit OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=leuC PE=3 SV=1 89 522 1.0E-33
sp|Q99KI0|ACON_MOUSE Aconitate hydratase, mitochondrial OS=Mus musculus GN=Aco2 PE=1 SV=1 88 534 1.0E-33
sp|B7IN95|LEUC_BACC2 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain G9842) GN=leuC PE=3 SV=1 117 535 2.0E-33
sp|A8H999|LEUC_SHEPA 3-isopropylmalate dehydratase large subunit OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=leuC PE=3 SV=1 89 534 2.0E-33
sp|B3GZY1|LEUC_ACTP7 3-isopropylmalate dehydratase large subunit OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=leuC PE=3 SV=1 89 522 2.0E-33
sp|Q3M614|LEUC_ANAVT 3-isopropylmalate dehydratase large subunit OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=leuC PE=3 SV=1 90 535 2.0E-33
sp|O86534|LEUC_STRCO 3-isopropylmalate dehydratase large subunit OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=leuC PE=3 SV=1 89 537 2.0E-33
sp|B1HR96|LEUC_LYSSC 3-isopropylmalate dehydratase large subunit OS=Lysinibacillus sphaericus (strain C3-41) GN=leuC PE=3 SV=1 89 534 2.0E-33
sp|Q9ABN0|LEUC_CAUCR 3-isopropylmalate dehydratase large subunit OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=leuC PE=3 SV=1 89 534 2.0E-33
sp|B8GY66|LEUC_CAUCN 3-isopropylmalate dehydratase large subunit OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=leuC PE=3 SV=1 89 534 2.0E-33
sp|A6WXG4|LEUC_OCHA4 3-isopropylmalate dehydratase large subunit OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=leuC PE=3 SV=1 117 534 2.0E-33
sp|A7HBI2|LEUC_ANADF 3-isopropylmalate dehydratase large subunit OS=Anaeromyxobacter sp. (strain Fw109-5) GN=leuC PE=3 SV=1 117 511 2.0E-33
sp|B7K213|LEUC_CYAP8 3-isopropylmalate dehydratase large subunit OS=Cyanothece sp. (strain PCC 8801) GN=leuC PE=3 SV=1 90 535 2.0E-33
sp|Q5LX06|LEUC_RUEPO 3-isopropylmalate dehydratase large subunit OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=leuC PE=3 SV=1 117 534 3.0E-33
sp|B4F196|LEUC_PROMH 3-isopropylmalate dehydratase large subunit OS=Proteus mirabilis (strain HI4320) GN=leuC PE=3 SV=1 117 535 3.0E-33
sp|Q9EVI3|LEUC_BUCUS 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon solidaginis GN=leuC PE=3 SV=1 117 511 4.0E-33
sp|Q5WPZ8|LEUC_BUCCC 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=leuC PE=3 SV=1 123 532 5.0E-33
sp|Q8YX02|LEUC_NOSS1 3-isopropylmalate dehydratase large subunit OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=leuC PE=3 SV=1 90 535 6.0E-33
sp|D4AT77|ACON_ARTBC Aconitate hydratase, mitochondrial OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07441 PE=1 SV=1 88 534 7.0E-33
sp|B0BS44|LEUC_ACTPJ 3-isopropylmalate dehydratase large subunit OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=leuC PE=3 SV=1 89 522 7.0E-33
sp|Q2T7H8|LEUC_BURTA 3-isopropylmalate dehydratase large subunit OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=leuC PE=3 SV=1 187 534 1.0E-32
sp|Q07WH1|LEUC_SHEFN 3-isopropylmalate dehydratase large subunit OS=Shewanella frigidimarina (strain NCIMB 400) GN=leuC PE=3 SV=1 87 534 1.0E-32
sp|A3CMJ2|LEUC_STRSV 3-isopropylmalate dehydratase large subunit OS=Streptococcus sanguinis (strain SK36) GN=leuC PE=3 SV=1 117 522 1.0E-32
sp|C4LAV5|LEUC_TOLAT 3-isopropylmalate dehydratase large subunit OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=leuC PE=3 SV=1 89 534 1.0E-32
sp|B1KKZ2|LEUC_SHEWM 3-isopropylmalate dehydratase large subunit OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=leuC PE=3 SV=1 112 534 1.0E-32
sp|P20004|ACON_BOVIN Aconitate hydratase, mitochondrial OS=Bos taurus GN=ACO2 PE=1 SV=4 86 534 1.0E-32
sp|Q0AT09|LEUC_MARMM 3-isopropylmalate dehydratase large subunit OS=Maricaulis maris (strain MCS10) GN=leuC PE=3 SV=1 79 543 1.0E-32
sp|A1K4A1|LEUC_AZOSB 3-isopropylmalate dehydratase large subunit OS=Azoarcus sp. (strain BH72) GN=leuC PE=3 SV=1 89 534 1.0E-32
sp|A4JMB6|LEUC_BURVG 3-isopropylmalate dehydratase large subunit OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=leuC PE=3 SV=1 187 534 1.0E-32
sp|B2UPW8|LEUC_AKKM8 3-isopropylmalate dehydratase large subunit OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=leuC PE=3 SV=1 89 535 2.0E-32
sp|Q6D0G6|LEUC_PECAS 3-isopropylmalate dehydratase large subunit OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=leuC PE=3 SV=1 89 535 2.0E-32
sp|O13966|ACON_SCHPO Aconitate hydratase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24C9.06c PE=3 SV=2 88 532 2.0E-32
sp|Q03UM2|LEUC_LEUMM 3-isopropylmalate dehydratase large subunit OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=leuC PE=3 SV=1 89 534 2.0E-32
sp|Q5M406|LEUC_STRT2 3-isopropylmalate dehydratase large subunit OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=leuC PE=3 SV=2 117 535 2.0E-32
sp|Q9EVG5|LEUC_BUCUA 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon aeneum GN=leuC PE=3 SV=1 89 511 2.0E-32
sp|Q2JQU3|LEUC_SYNJA 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain JA-3-3Ab) GN=leuC PE=3 SV=1 89 534 2.0E-32
sp|Q9AIM3|LEUC_STRGN 3-isopropylmalate dehydratase large subunit (Fragment) OS=Streptococcus gordonii GN=leuC PE=3 SV=1 117 522 3.0E-32
sp|Q73B98|LEUC_BACC1 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=leuC PE=3 SV=1 117 535 3.0E-32
sp|A2BUN7|LEUC_PROM5 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain MIT 9515) GN=leuC PE=3 SV=1 90 535 3.0E-32
sp|B0TQM2|LEUC_SHEHH 3-isopropylmalate dehydratase large subunit OS=Shewanella halifaxensis (strain HAW-EB4) GN=leuC PE=3 SV=1 112 534 3.0E-32
sp|Q3AN00|LEUC_SYNSC 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain CC9605) GN=leuC PE=3 SV=1 90 534 3.0E-32
sp|A5GIG7|LEUC_SYNPW 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain WH7803) GN=leuC PE=3 SV=1 90 534 3.0E-32
sp|A8AWP5|LEUC_STRGC 3-isopropylmalate dehydratase large subunit OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=leuC PE=3 SV=1 117 522 3.0E-32
sp|Q9EVH4|LEUC_BUCUE 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon erigeronensis GN=leuC PE=3 SV=1 117 511 3.0E-32
sp|Q0IDD5|LEUC_SYNS3 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain CC9311) GN=leuC PE=3 SV=1 90 535 4.0E-32
sp|Q81G10|LEUC_BACCR 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=leuC PE=3 SV=1 117 535 4.0E-32
sp|B1MVR0|LEUC_LEUCK 3-isopropylmalate dehydratase large subunit OS=Leuconostoc citreum (strain KM20) GN=leuC PE=3 SV=1 89 534 4.0E-32
sp|Q5LZF4|LEUC_STRT1 3-isopropylmalate dehydratase large subunit OS=Streptococcus thermophilus (strain CNRZ 1066) GN=leuC PE=3 SV=2 117 535 4.0E-32
sp|B1VZ03|LEUC_STRGG 3-isopropylmalate dehydratase large subunit OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=leuC PE=3 SV=1 89 537 4.0E-32
sp|Q7W931|LEUC_BORPA 3-isopropylmalate dehydratase large subunit OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=leuC PE=3 SV=2 187 534 5.0E-32
sp|Q7WKH6|LEUC_BORBR 3-isopropylmalate dehydratase large subunit OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=leuC PE=3 SV=2 187 534 5.0E-32
sp|Q7VY75|LEUC_BORPE 3-isopropylmalate dehydratase large subunit OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=leuC PE=3 SV=1 187 534 5.0E-32
sp|Q02142|LEUC_LACLA 3-isopropylmalate dehydratase large subunit OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=leuC PE=3 SV=2 117 522 5.0E-32
sp|Q03KB3|LEUC_STRTD 3-isopropylmalate dehydratase large subunit OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=leuC PE=3 SV=1 117 535 5.0E-32
sp|Q9JZI5|LEUC_NEIMB 3-isopropylmalate dehydratase large subunit OS=Neisseria meningitidis serogroup B (strain MC58) GN=leuC PE=3 SV=1 87 532 6.0E-32
sp|B9IUZ2|LEUC_BACCQ 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain Q1) GN=leuC PE=3 SV=1 117 534 6.0E-32
sp|B7HKC6|LEUC_BACC7 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain AH187) GN=leuC PE=3 SV=1 117 534 6.0E-32
sp|Q8DTG4|LEUC_STRMU 3-isopropylmalate dehydratase large subunit OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=leuC PE=3 SV=1 110 522 6.0E-32
sp|Q0HZT2|LEUC_SHESR 3-isopropylmalate dehydratase large subunit OS=Shewanella sp. (strain MR-7) GN=leuC PE=3 SV=1 112 534 6.0E-32
sp|B2J3M9|LEUC_NOSP7 3-isopropylmalate dehydratase large subunit OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=leuC PE=3 SV=1 90 535 7.0E-32
sp|A1AW36|LEUC_RUTMC 3-isopropylmalate dehydratase large subunit OS=Ruthia magnifica subsp. Calyptogena magnifica GN=leuC PE=3 SV=2 89 511 7.0E-32
sp|A9GL99|LEUC_SORC5 3-isopropylmalate dehydratase large subunit OS=Sorangium cellulosum (strain So ce56) GN=leuC PE=3 SV=1 117 535 7.0E-32
sp|Q3IRQ4|LEUC_NATPD 3-isopropylmalate dehydratase large subunit OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=leuC PE=3 SV=1 90 534 8.0E-32
sp|A0RBL4|LEUC_BACAH 3-isopropylmalate dehydratase large subunit OS=Bacillus thuringiensis (strain Al Hakam) GN=leuC PE=3 SV=1 117 535 9.0E-32
sp|A0L8J4|LEUC_MAGMM 3-isopropylmalate dehydratase large subunit OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=leuC PE=3 SV=1 89 534 1.0E-31
sp|Q3SHL1|LEUC_THIDA 3-isopropylmalate dehydratase large subunit OS=Thiobacillus denitrificans (strain ATCC 25259) GN=leuC PE=3 SV=1 89 534 1.0E-31
sp|A9LZF7|LEUC_NEIM0 3-isopropylmalate dehydratase large subunit OS=Neisseria meningitidis serogroup C (strain 053442) GN=leuC PE=3 SV=1 87 532 1.0E-31
sp|Q65V07|LEUC2_MANSM 3-isopropylmalate dehydratase large subunit 2 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=leuC2 PE=3 SV=1 112 522 1.0E-31
sp|Q606F2|LEUC_METCA 3-isopropylmalate dehydratase large subunit OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=leuC PE=3 SV=1 187 534 1.0E-31
sp|Q9JU82|LEUC_NEIMA 3-isopropylmalate dehydratase large subunit OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=leuC PE=3 SV=1 87 532 1.0E-31
sp|Q63JK9|LEUC_BURPS 3-isopropylmalate dehydratase large subunit OS=Burkholderia pseudomallei (strain K96243) GN=leuC PE=3 SV=1 187 534 1.0E-31
sp|A3NM77|LEUC_BURP6 3-isopropylmalate dehydratase large subunit OS=Burkholderia pseudomallei (strain 668) GN=leuC PE=3 SV=1 187 534 1.0E-31
sp|Q3JKG6|LEUC_BURP1 3-isopropylmalate dehydratase large subunit OS=Burkholderia pseudomallei (strain 1710b) GN=leuC PE=3 SV=2 187 534 1.0E-31
sp|A3P7N9|LEUC_BURP0 3-isopropylmalate dehydratase large subunit OS=Burkholderia pseudomallei (strain 1106a) GN=leuC PE=3 SV=1 187 534 1.0E-31
sp|A1UZ32|LEUC_BURMS 3-isopropylmalate dehydratase large subunit OS=Burkholderia mallei (strain SAVP1) GN=leuC PE=3 SV=1 187 534 1.0E-31
sp|Q62AI6|LEUC_BURMA 3-isopropylmalate dehydratase large subunit OS=Burkholderia mallei (strain ATCC 23344) GN=leuC PE=3 SV=1 187 534 1.0E-31
sp|A2S127|LEUC_BURM9 3-isopropylmalate dehydratase large subunit OS=Burkholderia mallei (strain NCTC 10229) GN=leuC PE=3 SV=1 187 534 1.0E-31
sp|A3MBT5|LEUC_BURM7 3-isopropylmalate dehydratase large subunit OS=Burkholderia mallei (strain NCTC 10247) GN=leuC PE=3 SV=1 187 534 1.0E-31
sp|A3CZK7|LEUC_SHEB5 3-isopropylmalate dehydratase large subunit OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=leuC PE=3 SV=1 112 534 1.0E-31
sp|A0AZ60|LEUC_BURCH 3-isopropylmalate dehydratase large subunit OS=Burkholderia cenocepacia (strain HI2424) GN=leuC PE=3 SV=1 187 534 1.0E-31
sp|B1K377|LEUC_BURCC 3-isopropylmalate dehydratase large subunit OS=Burkholderia cenocepacia (strain MC0-3) GN=leuC PE=3 SV=1 187 534 1.0E-31
sp|Q1BM55|LEUC_BURCA 3-isopropylmalate dehydratase large subunit OS=Burkholderia cenocepacia (strain AU 1054) GN=leuC PE=3 SV=1 187 534 1.0E-31
sp|Q9ZND5|LEUC_THET8 3-isopropylmalate dehydratase large subunit OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=leuC PE=3 SV=1 89 535 1.0E-31
sp|Q72JB3|LEUC_THET2 3-isopropylmalate dehydratase large subunit OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=leuC PE=3 SV=1 89 535 1.0E-31
sp|A4Y2M2|LEUC_SHEPC 3-isopropylmalate dehydratase large subunit OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=leuC PE=3 SV=1 112 534 2.0E-31
sp|Q63DX6|LEUC_BACCZ 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain ZK / E33L) GN=leuC PE=3 SV=1 117 534 2.0E-31
sp|Q89X98|LEUC1_BRADU 3-isopropylmalate dehydratase large subunit 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=leuC1 PE=3 SV=2 143 511 2.0E-31
sp|A6VQL0|LEUC_ACTSZ 3-isopropylmalate dehydratase large subunit OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=leuC PE=3 SV=1 112 522 2.0E-31
sp|A1KU80|LEUC_NEIMF 3-isopropylmalate dehydratase large subunit OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=leuC PE=3 SV=1 87 532 2.0E-31
sp|Q0VPI0|LEUC_ALCBS 3-isopropylmalate dehydratase large subunit OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=leuC PE=3 SV=2 117 534 3.0E-31
sp|Q5MZY3|LEUC_SYNP6 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=leuC PE=3 SV=1 90 522 3.0E-31
sp|Q31LZ1|LEUC_SYNE7 3-isopropylmalate dehydratase large subunit OS=Synechococcus elongatus (strain PCC 7942) GN=leuC PE=3 SV=1 90 522 3.0E-31
sp|P82611|ACON_CANAL Aconitate hydratase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ACO1 PE=1 SV=2 88 532 3.0E-31
sp|B7HHF7|LEUC_BACC4 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain B4264) GN=leuC PE=3 SV=1 117 535 3.0E-31
sp|Q7VQJ8|LEUC_BLOFL 3-isopropylmalate dehydratase large subunit OS=Blochmannia floridanus GN=leuC PE=3 SV=1 117 535 3.0E-31
sp|C5CSH5|LEUC_VARPS 3-isopropylmalate dehydratase large subunit OS=Variovorax paradoxus (strain S110) GN=leuC PE=3 SV=1 117 534 3.0E-31
sp|Q8E9N4|LEUC_SHEON 3-isopropylmalate dehydratase large subunit OS=Shewanella oneidensis (strain MR-1) GN=leuC PE=3 SV=1 88 534 4.0E-31
sp|B7JFY7|LEUC_BACC0 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain AH820) GN=leuC PE=3 SV=1 117 535 4.0E-31
sp|Q6LV26|LEUC_PHOPR 3-isopropylmalate dehydratase large subunit OS=Photobacterium profundum GN=leuC PE=3 SV=2 82 534 4.0E-31
sp|A1REY2|LEUC_SHESW 3-isopropylmalate dehydratase large subunit OS=Shewanella sp. (strain W3-18-1) GN=leuC PE=3 SV=1 112 534 4.0E-31
sp|Q81T66|LEUC_BACAN 3-isopropylmalate dehydratase large subunit OS=Bacillus anthracis GN=leuC PE=3 SV=1 117 535 4.0E-31
sp|C3L9Q5|LEUC_BACAC 3-isopropylmalate dehydratase large subunit OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=leuC PE=3 SV=1 117 535 4.0E-31
sp|C3P4Z8|LEUC_BACAA 3-isopropylmalate dehydratase large subunit OS=Bacillus anthracis (strain A0248) GN=leuC PE=3 SV=1 117 535 4.0E-31
sp|B8E4K6|LEUC_SHEB2 3-isopropylmalate dehydratase large subunit OS=Shewanella baltica (strain OS223) GN=leuC PE=3 SV=1 112 534 5.0E-31
sp|Q393X2|LEUC_BURL3 3-isopropylmalate dehydratase large subunit OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=leuC PE=3 SV=1 187 534 5.0E-31
sp|Q0BAC8|LEUC_BURCM 3-isopropylmalate dehydratase large subunit OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=leuC PE=3 SV=1 187 534 5.0E-31
sp|B1Z1N0|LEUC_BURA4 3-isopropylmalate dehydratase large subunit OS=Burkholderia ambifaria (strain MC40-6) GN=leuC PE=3 SV=1 187 534 5.0E-31
sp|A5WGT5|LEUC_PSYWF 3-isopropylmalate dehydratase large subunit OS=Psychrobacter sp. (strain PRwf-1) GN=leuC PE=3 SV=1 124 534 6.0E-31
sp|A8FQ85|LEUC_SHESH 3-isopropylmalate dehydratase large subunit OS=Shewanella sediminis (strain HAW-EB3) GN=leuC PE=3 SV=1 117 534 6.0E-31
sp|B5ENJ1|LEUC_ACIF5 3-isopropylmalate dehydratase large subunit OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=leuC PE=3 SV=1 115 534 7.0E-31
sp|B7J5E0|LEUC_ACIF2 3-isopropylmalate dehydratase large subunit OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=leuC PE=3 SV=1 115 534 7.0E-31
sp|Q1GDM6|LEUC_RUEST 3-isopropylmalate dehydratase large subunit OS=Ruegeria sp. (strain TM1040) GN=leuC PE=3 SV=1 87 534 7.0E-31
sp|C1EMB1|LEUC_BACC3 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain 03BB102) GN=leuC PE=3 SV=1 117 535 7.0E-31
sp|A1VRR0|LEUC_POLNA 3-isopropylmalate dehydratase large subunit OS=Polaromonas naphthalenivorans (strain CJ2) GN=leuC PE=3 SV=1 117 534 7.0E-31
sp|Q6HLF1|LEUC_BACHK 3-isopropylmalate dehydratase large subunit OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=leuC PE=3 SV=1 117 535 8.0E-31
sp|A9KY15|LEUC_SHEB9 3-isopropylmalate dehydratase large subunit OS=Shewanella baltica (strain OS195) GN=leuC PE=3 SV=1 112 534 8.0E-31
sp|A6WIB7|LEUC_SHEB8 3-isopropylmalate dehydratase large subunit OS=Shewanella baltica (strain OS185) GN=leuC PE=3 SV=1 112 534 8.0E-31
sp|A3QIN8|LEUC_SHELP 3-isopropylmalate dehydratase large subunit OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=leuC PE=3 SV=1 89 534 9.0E-31
sp|A0ZZS7|LEUC_BIFAA 3-isopropylmalate dehydratase large subunit OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=leuC PE=3 SV=1 117 537 9.0E-31
sp|Q46YV7|LEUC_CUPPJ 3-isopropylmalate dehydratase large subunit OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=leuC PE=3 SV=1 187 534 1.0E-30
sp|A1S2E2|LEUC_SHEAM 3-isopropylmalate dehydratase large subunit OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=leuC PE=3 SV=1 111 534 1.0E-30
sp|B4RCC2|LEUC_PHEZH 3-isopropylmalate dehydratase large subunit OS=Phenylobacterium zucineum (strain HLK1) GN=leuC PE=3 SV=1 89 522 1.0E-30
sp|Q3IJS4|LEUC_PSEHT 3-isopropylmalate dehydratase large subunit OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=leuC PE=3 SV=1 89 534 1.0E-30
sp|A1WY14|LEUC_HALHL 3-isopropylmalate dehydratase large subunit OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=leuC PE=3 SV=1 187 534 1.0E-30
sp|B0USF4|LEUC_HISS2 3-isopropylmalate dehydratase large subunit OS=Histophilus somni (strain 2336) GN=leuC PE=3 SV=1 89 522 2.0E-30
sp|Q0I2G3|LEUC_HAES1 3-isopropylmalate dehydratase large subunit OS=Haemophilus somnus (strain 129Pt) GN=leuC PE=3 SV=1 89 522 2.0E-30
sp|A8G2R6|LEUC_PROM2 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain MIT 9215) GN=leuC PE=3 SV=1 90 535 2.0E-30
sp|Q3AW21|LEUC_SYNS9 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain CC9902) GN=leuC PE=3 SV=1 90 534 2.0E-30
sp|A4SWW8|LEUC_POLSQ 3-isopropylmalate dehydratase large subunit OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=leuC PE=3 SV=1 116 534 2.0E-30
sp|A2C088|LEUC_PROM1 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain NATL1A) GN=leuC PE=3 SV=1 87 534 2.0E-30
sp|Q28W60|LEUC_JANSC 3-isopropylmalate dehydratase large subunit OS=Jannaschia sp. (strain CCS1) GN=leuC PE=3 SV=1 117 534 2.0E-30
sp|Q46HB8|LEUC_PROMT 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain NATL2A) GN=leuC PE=3 SV=1 87 534 3.0E-30
sp|Q0A9B0|LEUC_ALKEH 3-isopropylmalate dehydratase large subunit OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=leuC PE=3 SV=1 117 534 3.0E-30
sp|A8G9Q9|LEUC_SERP5 3-isopropylmalate dehydratase large subunit OS=Serratia proteamaculans (strain 568) GN=leuC PE=3 SV=1 117 522 3.0E-30
sp|Q8G4W2|LEUC_BIFLO 3-isopropylmalate dehydratase large subunit OS=Bifidobacterium longum (strain NCC 2705) GN=leuC PE=3 SV=1 117 537 3.0E-30
sp|B3DPI2|LEUC_BIFLD 3-isopropylmalate dehydratase large subunit OS=Bifidobacterium longum (strain DJO10A) GN=leuC PE=3 SV=1 117 537 3.0E-30
sp|Q02YY1|LEUC_LACLS 3-isopropylmalate dehydratase large subunit OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=leuC PE=3 SV=1 87 522 3.0E-30
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6865
MLRPWPRVAAPPISRVCLSRTTPSRPLPRPGCTPGSCSSAPTSHVAAISSSNRRANAVPVSHQADAPSSAQALPP
HSRTSTNATSDTPQTLTEKIVQRYSIGLAPGKKVRAGDYVTLFAHHCMTHDNSWPVALKFMSIGASRIHDPRQIV
MTLDHDVQNRSESNLKKYRQIEQFASQHGVDFFPAGRGIGHQIMVEQGYAWPGTVTVASDSHSNMYGGLGCLGTP
VVRTDAASIWATGRTWWQIPPIAKVTLGGILPPGVSGKDVIVALCGLFNKDDVLNHAIEFTGSPETLRSIPVDYR
LTIANMTTEWGALTGLFPIDSVLVSWLRAKATSAAVLGDQADAGNRFTHQRLDDLLRNQLQADPGATYAKSLYLN
LSTLSPFVSGPNSVKVATPLRDLEAQKIPLNKAYLVSCTNSRSSDIAAAARVFIEAAQNSPKIPPIAPGVKFYIA
AASAPEQRAAEETGDWQVLLEAGAEPLPAGCGPCIGLGTGLLEPGEVGISASNRNFKGRMGSTDAKAYLASPEVV
AASALKGYIAGPGWYQKPQGVNKVILGEGSGNPEADKAASVADALEKMLAEAEGMIAGAEKKLGAAAAPAVAQEE
SLTDILPGFPEKIEGEIVFCDADNINTDAIYPGKYTYQDNVSTETMAQVCMENYDAEFRNVARQGDVLVAGFNFG
CGSSREQSATAILAKKIPLVVAGSFGNIFSRNSINNALMGVEVPRLTRRLREAFANAADEALTRRTGWRLLWDVR
RSKVVVTEADGTQWSQKVGELPPNVQEIIACGGLEKWVKAELAKS*
Coding >OphauB2|6865
ATGCTTCGTCCTTGGCCAAGAGTCGCAGCGCCGCCGATATCTCGCGTCTGCCTGTCTCGTACTACACCATCACGG
CCCTTGCCTCGTCCTGGTTGCACTCCAGGGTCATGCTCCTCAGCCCCAACCAGTCACGTCGCTGCCATTAGTAGC
AGCAATCGCCGAGCCAATGCCGTGCCTGTCTCCCACCAAGCAGACGCGCCGAGCAGCGCCCAAGCCTTGCCTCCT
CATTCGCGCACCTCTACCAATGCCACCAGCGACACACCACAGACCCTGACGGAGAAAATTGTCCAGCGCTACTCA
ATAGGCCTTGCCCCTGGCAAAAAGGTCCGCGCCGGCGACTATGTCACGCTTTTCGCACACCACTGCATGACGCAC
GACAATAGCTGGCCCGTGGCCTTGAAATTCATGTCGATTGGCGCATCGCGCATCCATGACCCTCGCCAGATTGTC
ATGACGCTCGACCACGATGTGCAAAACCGCAGTGAGTCAAATCTCAAAAAGTACCGCCAAATCGAGCAGTTTGCC
TCACAACATGGTGTCGACTTCTTTCCCGCTGGACGGGGCATTGGCCATCAAATCATGGTCGAGCAAGGCTATGCT
TGGCCCGGTACCGTCACCGTGGCCTCTGATTCGCACTCCAACATGTACGGCGGCCTGGGCTGTCTTGGCACTCCG
GTTGTTCGCACCGACGCCGCCAGCATTTGGGCCACTGGACGCACCTGGTGGCAGATTCCTCCTATAGCCAAAGTC
ACTCTGGGCGGCATCTTGCCACCAGGAGTATCGGGAAAGGATGTCATTGTCGCCCTGTGTGGCCTCTTTAACAAA
GACGATGTCCTCAATCACGCCATTGAGTTTACTGGCTCTCCAGAGACGCTGCGCAGCATCCCCGTCGACTATCGC
TTAACCATTGCAAACATGACGACTGAATGGGGGGCACTAACAGGCCTATTCCCCATTGATTCCGTCCTTGTATCC
TGGCTGCGCGCCAAGGCGACCTCGGCAGCCGTACTGGGCGACCAAGCTGACGCTGGGAACCGCTTCACCCACCAA
CGTCTTGACGACTTGTTGCGCAATCAGCTCCAAGCTGACCCAGGAGCCACATATGCAAAGTCGCTATATCTCAAT
CTCTCTACGCTCTCCCCATTCGTATCTGGTCCCAATTCAGTCAAGGTTGCCACACCACTGCGAGACCTCGAAGCC
CAAAAGATTCCCCTTAACAAAGCCTATCTCGTTTCCTGCACGAATTCGCGGTCATCGGATATTGCTGCTGCGGCG
CGTGTCTTTATCGAAGCCGCTCAAAACAGTCCCAAGATACCCCCCATTGCACCAGGAGTCAAGTTTTATATTGCT
GCTGCCTCTGCCCCCGAGCAACGGGCTGCCGAAGAGACTGGCGACTGGCAAGTGTTGCTCGAGGCCGGCGCCGAG
CCTCTGCCTGCTGGCTGTGGCCCCTGCATCGGCCTTGGAACCGGTTTGTTGGAGCCTGGCGAGGTGGGCATCAGT
GCCAGCAACCGAAACTTTAAAGGACGCATGGGCTCCACCGATGCCAAGGCGTACCTGGCAAGTCCTGAAGTGGTT
GCCGCCAGTGCTCTCAAGGGCTACATTGCCGGCCCTGGCTGGTATCAGAAACCCCAAGGCGTCAACAAGGTGATT
CTCGGCGAGGGCAGCGGAAACCCAGAAGCCGACAAGGCTGCCAGTGTGGCAGATGCTCTCGAAAAGATGCTTGCC
GAGGCTGAGGGAATGATTGCCGGCGCGGAAAAGAAGCTTGGGGCGGCAGCTGCTCCCGCCGTGGCACAAGAGGAA
TCGCTGACGGATATTCTGCCTGGCTTCCCCGAAAAGATTGAAGGCGAAATCGTCTTTTGCGATGCCGATAATATC
AACACGGATGCCATTTATCCGGGCAAGTACACATACCAAGACAATGTTTCGACCGAGACCATGGCCCAAGTGTGC
ATGGAGAATTACGACGCCGAGTTTCGAAACGTGGCCCGCCAAGGCGACGTGCTCGTCGCAGGCTTTAATTTTGGC
TGCGGCTCGTCAAGGGAGCAAAGCGCGACGGCCATTCTCGCCAAGAAGATTCCTCTTGTCGTGGCCGGCAGCTTT
GGCAACATTTTTAGCCGCAACAGCATCAACAATGCCCTCATGGGCGTCGAGGTGCCGCGGCTAACGCGCCGTTTG
AGAGAGGCATTTGCCAATGCGGCAGATGAAGCGCTGACGCGCCGGACTGGCTGGCGTCTGCTCTGGGACGTGCGC
AGAAGCAAGGTGGTTGTCACAGAGGCGGATGGGACGCAGTGGAGCCAAAAGGTGGGCGAATTGCCTCCCAATGTG
CAAGAGATTATCGCCTGCGGAGGGCTAGAGAAGTGGGTAAAGGCAGAACTTGCCAAGAGCTAG
Transcript >OphauB2|6865
ATGCTTCGTCCTTGGCCAAGAGTCGCAGCGCCGCCGATATCTCGCGTCTGCCTGTCTCGTACTACACCATCACGG
CCCTTGCCTCGTCCTGGTTGCACTCCAGGGTCATGCTCCTCAGCCCCAACCAGTCACGTCGCTGCCATTAGTAGC
AGCAATCGCCGAGCCAATGCCGTGCCTGTCTCCCACCAAGCAGACGCGCCGAGCAGCGCCCAAGCCTTGCCTCCT
CATTCGCGCACCTCTACCAATGCCACCAGCGACACACCACAGACCCTGACGGAGAAAATTGTCCAGCGCTACTCA
ATAGGCCTTGCCCCTGGCAAAAAGGTCCGCGCCGGCGACTATGTCACGCTTTTCGCACACCACTGCATGACGCAC
GACAATAGCTGGCCCGTGGCCTTGAAATTCATGTCGATTGGCGCATCGCGCATCCATGACCCTCGCCAGATTGTC
ATGACGCTCGACCACGATGTGCAAAACCGCAGTGAGTCAAATCTCAAAAAGTACCGCCAAATCGAGCAGTTTGCC
TCACAACATGGTGTCGACTTCTTTCCCGCTGGACGGGGCATTGGCCATCAAATCATGGTCGAGCAAGGCTATGCT
TGGCCCGGTACCGTCACCGTGGCCTCTGATTCGCACTCCAACATGTACGGCGGCCTGGGCTGTCTTGGCACTCCG
GTTGTTCGCACCGACGCCGCCAGCATTTGGGCCACTGGACGCACCTGGTGGCAGATTCCTCCTATAGCCAAAGTC
ACTCTGGGCGGCATCTTGCCACCAGGAGTATCGGGAAAGGATGTCATTGTCGCCCTGTGTGGCCTCTTTAACAAA
GACGATGTCCTCAATCACGCCATTGAGTTTACTGGCTCTCCAGAGACGCTGCGCAGCATCCCCGTCGACTATCGC
TTAACCATTGCAAACATGACGACTGAATGGGGGGCACTAACAGGCCTATTCCCCATTGATTCCGTCCTTGTATCC
TGGCTGCGCGCCAAGGCGACCTCGGCAGCCGTACTGGGCGACCAAGCTGACGCTGGGAACCGCTTCACCCACCAA
CGTCTTGACGACTTGTTGCGCAATCAGCTCCAAGCTGACCCAGGAGCCACATATGCAAAGTCGCTATATCTCAAT
CTCTCTACGCTCTCCCCATTCGTATCTGGTCCCAATTCAGTCAAGGTTGCCACACCACTGCGAGACCTCGAAGCC
CAAAAGATTCCCCTTAACAAAGCCTATCTCGTTTCCTGCACGAATTCGCGGTCATCGGATATTGCTGCTGCGGCG
CGTGTCTTTATCGAAGCCGCTCAAAACAGTCCCAAGATACCCCCCATTGCACCAGGAGTCAAGTTTTATATTGCT
GCTGCCTCTGCCCCCGAGCAACGGGCTGCCGAAGAGACTGGCGACTGGCAAGTGTTGCTCGAGGCCGGCGCCGAG
CCTCTGCCTGCTGGCTGTGGCCCCTGCATCGGCCTTGGAACCGGTTTGTTGGAGCCTGGCGAGGTGGGCATCAGT
GCCAGCAACCGAAACTTTAAAGGACGCATGGGCTCCACCGATGCCAAGGCGTACCTGGCAAGTCCTGAAGTGGTT
GCCGCCAGTGCTCTCAAGGGCTACATTGCCGGCCCTGGCTGGTATCAGAAACCCCAAGGCGTCAACAAGGTGATT
CTCGGCGAGGGCAGCGGAAACCCAGAAGCCGACAAGGCTGCCAGTGTGGCAGATGCTCTCGAAAAGATGCTTGCC
GAGGCTGAGGGAATGATTGCCGGCGCGGAAAAGAAGCTTGGGGCGGCAGCTGCTCCCGCCGTGGCACAAGAGGAA
TCGCTGACGGATATTCTGCCTGGCTTCCCCGAAAAGATTGAAGGCGAAATCGTCTTTTGCGATGCCGATAATATC
AACACGGATGCCATTTATCCGGGCAAGTACACATACCAAGACAATGTTTCGACCGAGACCATGGCCCAAGTGTGC
ATGGAGAATTACGACGCCGAGTTTCGAAACGTGGCCCGCCAAGGCGACGTGCTCGTCGCAGGCTTTAATTTTGGC
TGCGGCTCGTCAAGGGAGCAAAGCGCGACGGCCATTCTCGCCAAGAAGATTCCTCTTGTCGTGGCCGGCAGCTTT
GGCAACATTTTTAGCCGCAACAGCATCAACAATGCCCTCATGGGCGTCGAGGTGCCGCGGCTAACGCGCCGTTTG
AGAGAGGCATTTGCCAATGCGGCAGATGAAGCGCTGACGCGCCGGACTGGCTGGCGTCTGCTCTGGGACGTGCGC
AGAAGCAAGGTGGTTGTCACAGAGGCGGATGGGACGCAGTGGAGCCAAAAGGTGGGCGAATTGCCTCCCAATGTG
CAAGAGATTATCGCCTGCGGAGGGCTAGAGAAGTGGGTAAAGGCAGAACTTGCCAAGAGCTAG
Gene >OphauB2|6865
ATGCTTCGTCCTTGGGTAAGCAGCTTCTTGATTCAATGCCAGCTCTGACTGCTGCTGACTCCCTTGATATAGCCA
AGAGTCGCAGCGCCGCCGATATCTCGCGTCTGCCTGTCTCGTACTACACCATCACGGCCCTTGCCTCGTCCTGGT
TGCACTCCAGGGTCATGCTCCTCAGCCCCAACCAGTCACGTCGCTGCCATTAGTAGCAGCAATCGCCGAGCCAAT
GCCGTGCCTGTCTCCCACCAAGCAGACGCGCCGAGCAGCGCCCAAGCCTTGCCTCCTCATTCGCGCACCTCTACC
AATGCCACCAGCGACACACCACAGACCCTGACGGAGAAAATTGTCCAGCGCTACTCAATAGGCCTTGCCCCTGGC
AAAAAGGTCCGCGCCGGCGACTATGTCACGCTTTTCGCACACCACTGCATGACGCACGACAATAGCTGGCCCGTG
GCCTTGAAATTCATGTCGATTGGCGCATCGCGCATCCATGACCCTCGCCAGATTGTCATGACGCTCGACCACGAT
GTGCAAAACCGCAGTGAGTCAAATCTCAAAAAGTACCGCCAAATCGAGCAGTTTGCCTCACAACATGGTGTCGAC
TTCTTTCCCGCTGGACGGGGCATTGGCCATCAAATCATGGTCGAGCAAGGCTATGCTTGGCCCGGTACCGTCACC
GTGGCCTCTGATTCGCACTCCAACATGTACGGCGGCCTGGGCTGTCTTGGCACTCCGGTTGTTCGCACCGACGCC
GCCAGCATTTGGGCCACTGGACGCACCTGGTGGCAGATTCCTCCTATAGCCAAAGTCACTCTGGGCGGCATCTTG
CCACCAGGAGTATCGGGAAAGGATGTCATTGTCGCCCTGTGTGGCCTCTTTAACAAAGACGATGTCCTCAATCAC
GCCATTGAGTTTACTGGCTCTCCAGAGACGCTGCGCAGCATCCCCGTCGACTATCGCTTAACCATTGCAAACATG
ACGACTGAATGGGGGGCACTAACAGGCCTATTCCCCATTGATTCCGTCCTTGTATCCTGGCTGCGCGCCAAGGCG
ACCTCGGCAGCCGTACTGGGCGACCAAGCTGACGCTGGGAACCGCTTCACCCACCAACGTCTTGACGACTTGTTG
CGCAATCAGCTCCAAGCTGACCCAGGAGCCACATATGCAAAGTCGCTATATCTCAATCTCTCTACGCTCTCCCCA
TTCGTATCTGGTCCCAATTCAGTCAAGGTTGCCACACCACTGCGAGACCTCGAAGCCCAAAAGATTCCCCTTAAC
AAAGCCTATCTCGTTTCCTGCACGAATTCGCGGTCATCGGATATTGCTGCTGCGGCGCGTGTCTTTATCGAAGCC
GCTCAAAACAGTCCCAAGATACCCCCCATTGCACCAGGAGTCAAGTTTTATATTGCTGCTGCCTCTGCCCCCGAG
CAACGGGCTGCCGAAGAGACTGGCGACTGGCAAGTGTTGCTCGAGGCCGGCGCCGAGCCTCTGCCTGCTGGCTGT
GGCCCCTGCATCGGCCTTGGAACCGGTTTGTTGGAGCCTGGCGAGGTGGGCATCAGTGCCAGCAACCGAAACTTT
AAAGGACGCATGGGCTCCACCGATGCCAAGGCGTACCTGGCAAGTCCTGAAGTGGTTGCCGCCAGTGCTCTCAAG
GGCTACATTGCCGGCCCTGGCTGGTATCAGAAACCCCAAGGCGTCAACAAGGTGATTCTCGGCGAGGGCAGCGGA
AACCCAGAAGCCGACAAGGCTGCCAGTGTGGCAGATGCTCTCGAAAAGATGCTTGCCGAGGCTGAGGGAATGATT
GCCGGCGCGGAAAAGAAGCTTGGGGCGGCAGCTGCTCCCGCCGTGGCACAAGAGGAATCGCTGACGGATATTCTG
CCTGGCTTCCCCGAAAAGATTGAAGGCGAAATCGTCTTTTGCGATGCCGATAATATCAACACGGATGCCATTTAT
CCGGGCAAGTACACATACCAAGACAATGTTTCGACCGAGACCATGGCCCAAGTGTGCATGGAGAATTACGACGCC
GAGTTTCGAAACGTGGCCCGCCAAGGCGACGTGCTCGTCGCAGGCTTTAATTTTGGCTGCGGCTCGTCAAGGGAG
CAAAGCGCGACGGCCATTCTCGCCAAGAAGATTCCTCTTGTCGTGGCCGGCAGCTTTGGCAACATTTTTAGCCGC
AACAGCATCAACAATGCCCTCATGGGCGTCGAGGTGCCGCGGCTAACGCGCCGTTTGAGAGAGGCATTTGCCAAT
GCGGCAGATGAAGCGCTGACGCGCCGGACTGGCTGGCGTCTGCTCTGGGACGTGCGCAGAAGCAAGGTGGTTGTC
ACAGAGGCGGATGGGACGCAGTGGAGCCAAAAGGTGGGCGAATTGCCTCCCAATGTGCAAGAGATTATCGCCTGC
GGAGGGCTAGAGAAGTGGGTAAAGGCAGAACTTGCCAAGAGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail