Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6862
Gene name
LocationContig_67:69091..69645
Strand+
Gene length (bp)554
Transcript length (bp)453
Coding sequence length (bp)453
Protein length (aa) 151

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16541 AltA1 Alternaria alternata allergen 1 8.8E-09 31 132

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5EZC5|ALTA1_PLETA Allergen Ste b 1 (Fragment) OS=Pleospora tarda GN=alta1 PE=1 SV=1 28 132 5.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6862
MRASTTLNLLLAGLAAAAPASEPRLNQVFDITNFSVRKDSSDRGEFIRNVNFALSGADVMELPCNADKPGPDQVV
ECGVNSGFGFRLHQMGNPGTSYTVSVFHDIEGAKEMGDTTVGVYCHAGGDGPNDFVCTQVAPAAVTLDHVVPAAA
*
Coding >OphauB2|6862
ATGCGCGCCTCAACTACCCTCAACCTCTTGCTGGCCGGCCTCGCCGCCGCCGCTCCCGCCTCTGAGCCCCGTCTC
AACCAAGTCTTTGACATTACCAACTTCTCCGTCCGCAAGGATTCTTCTGACCGCGGCGAATTCATCCGCAACGTA
AACTTTGCGCTCTCGGGCGCAGACGTCATGGAGCTGCCGTGCAATGCCGACAAGCCTGGCCCGGATCAGGTGGTT
GAGTGTGGCGTAAACTCGGGCTTTGGCTTTAGGCTGCATCAGATGGGTAATCCTGGCACGTCGTATACTGTCAGC
GTCTTTCATGACATTGAGGGTGCCAAGGAAATGGGCGACACTACCGTTGGCGTCTACTGCCACGCTGGCGGCGAC
GGGCCAAATGACTTTGTCTGCACTCAAGTCGCCCCCGCTGCTGTTACTCTTGACCACGTCGTCCCGGCCGCTGCT
TGA
Transcript >OphauB2|6862
ATGCGCGCCTCAACTACCCTCAACCTCTTGCTGGCCGGCCTCGCCGCCGCCGCTCCCGCCTCTGAGCCCCGTCTC
AACCAAGTCTTTGACATTACCAACTTCTCCGTCCGCAAGGATTCTTCTGACCGCGGCGAATTCATCCGCAACGTA
AACTTTGCGCTCTCGGGCGCAGACGTCATGGAGCTGCCGTGCAATGCCGACAAGCCTGGCCCGGATCAGGTGGTT
GAGTGTGGCGTAAACTCGGGCTTTGGCTTTAGGCTGCATCAGATGGGTAATCCTGGCACGTCGTATACTGTCAGC
GTCTTTCATGACATTGAGGGTGCCAAGGAAATGGGCGACACTACCGTTGGCGTCTACTGCCACGCTGGCGGCGAC
GGGCCAAATGACTTTGTCTGCACTCAAGTCGCCCCCGCTGCTGTTACTCTTGACCACGTCGTCCCGGCCGCTGCT
TGA
Gene >OphauB2|6862
ATGCGCGCCTCAACTACCCTCAACCTCTTGCTGGCCGGCCTCGCCGCCGCCGCTCCCGCCTCTGAGCCCCGTCTC
AACCAAGTCTTTGACATTACCAACTTCTCCGTCCGCAAGGATTCTTCTGACCGCGGCGAATTCATCCGCAACGTA
AACTTTGCGCTCTCGGGCGCAGACGTCATGGAGCTGCCGTGCAATGCCGACAAGCCTGGCCCGGATCAGGTGGTT
GAGTGTGGCGTAAACTCGGGCTTTGGCTTTAGGCTGCATCAGATGGGTAATCCTGGCACGTCGTATACTGTCAGC
GTCTTTCATGACATTGAGGGGTAAGTTTTTTTTTCAAAAGACTTGGTTCCTAGTCTCTTTCTTTGCTTTCGTGTT
GGGGGGGGGGGCATCAAGTTGGGGGAAACAAGCTAACGTTGAGCAGTGCCAAGGAAATGGGCGACACTACCGTTG
GCGTCTACTGCCACGCTGGCGGCGACGGGCCAAATGACTTTGTCTGCACTCAAGTCGCCCCCGCTGCTGTTACTC
TTGACCACGTCGTCCCGGCCGCTGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail