Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6853
Gene name
LocationContig_67:48291..49296
Strand+
Gene length (bp)1005
Transcript length (bp)1005
Coding sequence length (bp)1005
Protein length (aa) 335

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00707 IF3_C Translation initiation factor IF-3, C-terminal domain 1.1E-08 135 210

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9CZD5|IF3M_MOUSE Translation initiation factor IF-3, mitochondrial OS=Mus musculus GN=Mtif3 PE=1 SV=1 4 175 4.0E-09
sp|Q8YNE3|IF3_NOSS1 Translation initiation factor IF-3 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=infC PE=3 SV=1 45 206 2.0E-08
sp|Q3MBH6|IF3_ANAVT Translation initiation factor IF-3 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=infC PE=3 SV=1 45 206 2.0E-08
sp|Q8R9C2|IF3_CALS4 Translation initiation factor IF-3 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=infC PE=3 SV=1 56 206 1.0E-07
sp|B2IY66|IF3_NOSP7 Translation initiation factor IF-3 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=infC PE=3 SV=1 45 206 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9CZD5|IF3M_MOUSE Translation initiation factor IF-3, mitochondrial OS=Mus musculus GN=Mtif3 PE=1 SV=1 4 175 4.0E-09
sp|Q8YNE3|IF3_NOSS1 Translation initiation factor IF-3 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=infC PE=3 SV=1 45 206 2.0E-08
sp|Q3MBH6|IF3_ANAVT Translation initiation factor IF-3 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=infC PE=3 SV=1 45 206 2.0E-08
sp|Q8R9C2|IF3_CALS4 Translation initiation factor IF-3 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=infC PE=3 SV=1 56 206 1.0E-07
sp|B2IY66|IF3_NOSP7 Translation initiation factor IF-3 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=infC PE=3 SV=1 45 206 1.0E-07
sp|P55872|IF3_BACSU Translation initiation factor IF-3 OS=Bacillus subtilis (strain 168) GN=infC PE=3 SV=3 96 208 7.0E-07
sp|P03000|IF3_GEOSE Translation initiation factor IF-3 OS=Geobacillus stearothermophilus GN=infC PE=1 SV=2 56 207 8.0E-07
sp|Q891T1|IF3_CLOTE Translation initiation factor IF-3 OS=Clostridium tetani (strain Massachusetts / E88) GN=infC PE=3 SV=1 56 215 8.0E-07
sp|Q89WH7|IF3_BRADU Translation initiation factor IF-3 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=infC PE=3 SV=1 44 215 2.0E-06
sp|Q812P6|IF3_BACCR Translation initiation factor IF-3 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=infC PE=3 SV=1 96 223 2.0E-06
sp|Q8EPF5|IF3_OCEIH Translation initiation factor IF-3 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=infC PE=3 SV=2 56 208 3.0E-06
sp|Q633M1|IF3_BACCZ Translation initiation factor IF-3 OS=Bacillus cereus (strain ZK / E33L) GN=infC PE=3 SV=2 96 223 3.0E-06
sp|Q72ZG2|IF3_BACC1 Translation initiation factor IF-3 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=infC PE=3 SV=2 96 223 3.0E-06
sp|Q81L15|IF3_BACAN Translation initiation factor IF-3 OS=Bacillus anthracis GN=infC PE=3 SV=2 96 223 3.0E-06
sp|Q8DIG8|IF3_THEEB Translation initiation factor IF-3 OS=Thermosynechococcus elongatus (strain BP-1) GN=infC PE=3 SV=1 62 206 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006413 translational initiation Yes
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6853
MECLRLCALSHLLLPLRARHVPPIPHLLSVRNSMPHRAYSTSRPKASTRQKPQDIEIEDRTIMVIDGDGPPAGPF
RTGEVISRLENHEVLIMLQRAKEGQPAVCKIMVRSQLARKQEAQAAKQRELHKRQGLDKKLKEVVLTWAIAEHDL
GIKMRQLKGFLAKGYRVEVLVGKRKKGTKMTQMADEDKEEVLRRVKSAVGEVGGVETRAESRLQGMARLYIMGKD
EVVLEKEVKELGVVWGEEDLGKLSLQLTTLLTRGCRVEIVVGKRKKGVKMGSVKEEDKEELMERVRRAVELAGGM
ETRTEVREQDMVRLFVEEKGSRAGEGGEDGQSVE*
Coding >OphauB2|6853
ATGGAATGTCTACGTCTTTGCGCTCTATCCCACCTCTTGTTGCCTCTGCGCGCCCGCCATGTGCCCCCGATACCG
CACCTCTTGTCGGTGCGCAACTCGATGCCTCATCGAGCCTATTCCACCAGCCGCCCCAAGGCCTCCACCCGGCAG
AAACCCCAAGACATTGAGATTGAAGACCGCACAATCATGGTTATTGACGGGGACGGCCCCCCCGCTGGCCCCTTT
CGCACGGGCGAAGTGATATCGCGGCTAGAAAACCACGAAGTCTTGATTATGCTGCAGCGCGCCAAGGAGGGCCAG
CCAGCAGTGTGCAAAATCATGGTGCGGTCCCAACTGGCCCGCAAGCAGGAAGCCCAAGCCGCCAAGCAGCGCGAG
CTGCACAAGAGGCAAGGGCTGGACAAGAAGCTCAAAGAAGTGGTGCTCACCTGGGCCATTGCGGAGCACGACTTG
GGGATAAAGATGAGGCAGCTAAAGGGCTTCCTAGCAAAGGGGTATAGGGTGGAGGTGTTGGTGGGCAAGAGGAAA
AAGGGGACCAAGATGACGCAAATGGCGGACGAGGACAAGGAAGAGGTTTTGCGGCGGGTGAAGAGCGCGGTGGGC
GAGGTGGGCGGGGTAGAAACAAGGGCGGAGTCGAGGCTGCAGGGCATGGCGAGGCTGTATATTATGGGCAAGGAC
GAGGTGGTGCTGGAAAAGGAGGTCAAGGAGCTGGGCGTCGTGTGGGGGGAGGAGGATCTGGGGAAGCTGAGCTTG
CAGCTAACGACTTTGCTGACAAGGGGGTGTAGGGTTGAGATTGTGGTGGGAAAGAGGAAAAAGGGGGTCAAGATG
GGGAGTGTGAAGGAGGAGGATAAGGAGGAGTTGATGGAGAGGGTGAGGAGGGCGGTGGAGTTGGCGGGCGGGATG
GAGACTAGGACTGAGGTGAGGGAGCAGGACATGGTGAGGTTGTTTGTTGAGGAAAAGGGGAGTAGGGCGGGTGAG
GGAGGAGAGGATGGGCAGAGTGTGGAGTAA
Transcript >OphauB2|6853
ATGGAATGTCTACGTCTTTGCGCTCTATCCCACCTCTTGTTGCCTCTGCGCGCCCGCCATGTGCCCCCGATACCG
CACCTCTTGTCGGTGCGCAACTCGATGCCTCATCGAGCCTATTCCACCAGCCGCCCCAAGGCCTCCACCCGGCAG
AAACCCCAAGACATTGAGATTGAAGACCGCACAATCATGGTTATTGACGGGGACGGCCCCCCCGCTGGCCCCTTT
CGCACGGGCGAAGTGATATCGCGGCTAGAAAACCACGAAGTCTTGATTATGCTGCAGCGCGCCAAGGAGGGCCAG
CCAGCAGTGTGCAAAATCATGGTGCGGTCCCAACTGGCCCGCAAGCAGGAAGCCCAAGCCGCCAAGCAGCGCGAG
CTGCACAAGAGGCAAGGGCTGGACAAGAAGCTCAAAGAAGTGGTGCTCACCTGGGCCATTGCGGAGCACGACTTG
GGGATAAAGATGAGGCAGCTAAAGGGCTTCCTAGCAAAGGGGTATAGGGTGGAGGTGTTGGTGGGCAAGAGGAAA
AAGGGGACCAAGATGACGCAAATGGCGGACGAGGACAAGGAAGAGGTTTTGCGGCGGGTGAAGAGCGCGGTGGGC
GAGGTGGGCGGGGTAGAAACAAGGGCGGAGTCGAGGCTGCAGGGCATGGCGAGGCTGTATATTATGGGCAAGGAC
GAGGTGGTGCTGGAAAAGGAGGTCAAGGAGCTGGGCGTCGTGTGGGGGGAGGAGGATCTGGGGAAGCTGAGCTTG
CAGCTAACGACTTTGCTGACAAGGGGGTGTAGGGTTGAGATTGTGGTGGGAAAGAGGAAAAAGGGGGTCAAGATG
GGGAGTGTGAAGGAGGAGGATAAGGAGGAGTTGATGGAGAGGGTGAGGAGGGCGGTGGAGTTGGCGGGCGGGATG
GAGACTAGGACTGAGGTGAGGGAGCAGGACATGGTGAGGTTGTTTGTTGAGGAAAAGGGGAGTAGGGCGGGTGAG
GGAGGAGAGGATGGGCAGAGTGTGGAGTAA
Gene >OphauB2|6853
ATGGAATGTCTACGTCTTTGCGCTCTATCCCACCTCTTGTTGCCTCTGCGCGCCCGCCATGTGCCCCCGATACCG
CACCTCTTGTCGGTGCGCAACTCGATGCCTCATCGAGCCTATTCCACCAGCCGCCCCAAGGCCTCCACCCGGCAG
AAACCCCAAGACATTGAGATTGAAGACCGCACAATCATGGTTATTGACGGGGACGGCCCCCCCGCTGGCCCCTTT
CGCACGGGCGAAGTGATATCGCGGCTAGAAAACCACGAAGTCTTGATTATGCTGCAGCGCGCCAAGGAGGGCCAG
CCAGCAGTGTGCAAAATCATGGTGCGGTCCCAACTGGCCCGCAAGCAGGAAGCCCAAGCCGCCAAGCAGCGCGAG
CTGCACAAGAGGCAAGGGCTGGACAAGAAGCTCAAAGAAGTGGTGCTCACCTGGGCCATTGCGGAGCACGACTTG
GGGATAAAGATGAGGCAGCTAAAGGGCTTCCTAGCAAAGGGGTATAGGGTGGAGGTGTTGGTGGGCAAGAGGAAA
AAGGGGACCAAGATGACGCAAATGGCGGACGAGGACAAGGAAGAGGTTTTGCGGCGGGTGAAGAGCGCGGTGGGC
GAGGTGGGCGGGGTAGAAACAAGGGCGGAGTCGAGGCTGCAGGGCATGGCGAGGCTGTATATTATGGGCAAGGAC
GAGGTGGTGCTGGAAAAGGAGGTCAAGGAGCTGGGCGTCGTGTGGGGGGAGGAGGATCTGGGGAAGCTGAGCTTG
CAGCTAACGACTTTGCTGACAAGGGGGTGTAGGGTTGAGATTGTGGTGGGAAAGAGGAAAAAGGGGGTCAAGATG
GGGAGTGTGAAGGAGGAGGATAAGGAGGAGTTGATGGAGAGGGTGAGGAGGGCGGTGGAGTTGGCGGGCGGGATG
GAGACTAGGACTGAGGTGAGGGAGCAGGACATGGTGAGGTTGTTTGTTGAGGAAAAGGGGAGTAGGGCGGGTGAG
GGAGGAGAGGATGGGCAGAGTGTGGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail