Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6851
Gene name
LocationContig_67:44103..46302
Strand+
Gene length (bp)2199
Transcript length (bp)1767
Coding sequence length (bp)1767
Protein length (aa) 589

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00514 Arm Armadillo/beta-catenin-like repeat 7.8E-10 155 194
PF00514 Arm Armadillo/beta-catenin-like repeat 4.4E-07 197 235
PF00514 Arm Armadillo/beta-catenin-like repeat 1.1E-12 237 276
PF00514 Arm Armadillo/beta-catenin-like repeat 6.6E-07 288 320
PF00514 Arm Armadillo/beta-catenin-like repeat 1.8E-07 365 403
PF00514 Arm Armadillo/beta-catenin-like repeat 1.5E-05 447 486
PF05804 KAP Kinesin-associated protein (KAP) 1.1E-10 143 405
PF04826 Arm_2 Armadillo-like 7.5E-06 127 302

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I1B1|VAC8_GIBZE Vacuolar protein 8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=VAC8 PE=3 SV=4 1 585 0.0E+00
sp|Q7RXW1|VAC8_NEUCR Vacuolar protein 8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vac8 PE=3 SV=4 1 585 0.0E+00
sp|Q2GW27|VAC8_CHAGB Vacuolar protein 8 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=VAC8 PE=3 SV=3 1 585 0.0E+00
sp|Q4WVW4|VAC8_ASPFU Vacuolar protein 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=vac8 PE=3 SV=1 4 586 0.0E+00
sp|Q2U5T5|VAC8_ASPOR Vacuolar protein 8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=vac8 PE=3 SV=1 4 586 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I1B1|VAC8_GIBZE Vacuolar protein 8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=VAC8 PE=3 SV=4 1 585 0.0E+00
sp|Q7RXW1|VAC8_NEUCR Vacuolar protein 8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vac8 PE=3 SV=4 1 585 0.0E+00
sp|Q2GW27|VAC8_CHAGB Vacuolar protein 8 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=VAC8 PE=3 SV=3 1 585 0.0E+00
sp|Q4WVW4|VAC8_ASPFU Vacuolar protein 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=vac8 PE=3 SV=1 4 586 0.0E+00
sp|Q2U5T5|VAC8_ASPOR Vacuolar protein 8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=vac8 PE=3 SV=1 4 586 0.0E+00
sp|P0CM60|VAC8_CRYNJ Vacuolar protein 8 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=VAC8 PE=3 SV=1 1 584 0.0E+00
sp|P0CM61|VAC8_CRYNB Vacuolar protein 8 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=VAC8 PE=3 SV=1 1 584 0.0E+00
sp|Q6C5Y8|VAC8_YARLI Vacuolar protein 8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=VAC8 PE=3 SV=1 11 584 0.0E+00
sp|O43028|VAC8_SCHPO Vacuolar protein 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vac8 PE=1 SV=4 1 584 0.0E+00
sp|Q6BTZ4|VAC8_DEBHA Vacuolar protein 8 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=VAC8 PE=3 SV=4 1 585 0.0E+00
sp|Q59MN0|VAC8_CANAL Vacuolar protein 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VAC8 PE=3 SV=3 1 558 0.0E+00
sp|Q5EFZ4|VAC8_PICPA Vacuolar protein 8 OS=Komagataella pastoris GN=VAC8 PE=3 SV=3 1 584 0.0E+00
sp|P39968|VAC8_YEAST Vacuolar protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAC8 PE=1 SV=3 1 557 0.0E+00
sp|Q757R0|VAC8_ASHGO Vacuolar protein 8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VAC8 PE=3 SV=3 1 557 0.0E+00
sp|Q6FJV1|VAC8_CANGA Vacuolar protein 8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=VAC8 PE=3 SV=3 1 562 0.0E+00
sp|Q6CX49|VAC8_KLULA Vacuolar protein 8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=VAC8 PE=3 SV=3 1 576 0.0E+00
sp|B7U179|ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis thaliana GN=ABAP1 PE=1 SV=1 112 337 5.0E-19
sp|B9DHT4|ARIA_ARATH ARM REPEAT PROTEIN INTERACTING WITH ABF2 OS=Arabidopsis thaliana GN=ARIA PE=1 SV=2 138 422 1.0E-18
sp|Q9C9A6|PUB10_ARATH U-box domain-containing protein 10 OS=Arabidopsis thaliana GN=PUB10 PE=2 SV=1 123 342 3.0E-18
sp|Q5XEZ8|PUB2_ARATH U-box domain-containing protein 2 OS=Arabidopsis thaliana GN=PUB2 PE=2 SV=1 134 384 9.0E-18
sp|Q8GUG9|PUB11_ARATH U-box domain-containing protein 11 OS=Arabidopsis thaliana GN=PUB11 PE=2 SV=2 123 343 1.0E-17
sp|O22193|PUB4_ARATH U-box domain-containing protein 4 OS=Arabidopsis thaliana GN=PUB4 PE=1 SV=3 133 347 7.0E-16
sp|B7U179|ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis thaliana GN=ABAP1 PE=1 SV=1 103 344 1.0E-15
sp|Q5XEZ8|PUB2_ARATH U-box domain-containing protein 2 OS=Arabidopsis thaliana GN=PUB2 PE=2 SV=1 133 343 5.0E-15
sp|Q5VRH9|PUB12_ORYSJ U-box domain-containing protein 12 OS=Oryza sativa subsp. japonica GN=PUB12 PE=2 SV=1 123 343 2.0E-14
sp|Q5T2S8|ARMC4_HUMAN Armadillo repeat-containing protein 4 OS=Homo sapiens GN=ARMC4 PE=1 SV=1 123 498 6.0E-14
sp|B2RY50|ARMC4_MOUSE Armadillo repeat-containing protein 4 OS=Mus musculus GN=Armc4 PE=1 SV=1 123 498 9.0E-14
sp|Q8GWV5|PUB3_ARATH U-box domain-containing protein 3 OS=Arabidopsis thaliana GN=PUB3 PE=2 SV=2 134 338 3.0E-13
sp|B7U179|ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis thaliana GN=ABAP1 PE=1 SV=1 141 492 2.0E-12
sp|Q9ZV31|PUB12_ARATH U-box domain-containing protein 12 OS=Arabidopsis thaliana GN=PUB12 PE=2 SV=1 129 338 2.0E-12
sp|Q5W041|ARMC3_HUMAN Armadillo repeat-containing protein 3 OS=Homo sapiens GN=ARMC3 PE=2 SV=2 115 421 3.0E-12
sp|Q0IMG9|SL11_ORYSJ E3 ubiquitin-protein ligase SPL11 OS=Oryza sativa subsp. japonica GN=SPL11 PE=1 SV=2 123 303 8.0E-12
sp|A2ZLU6|SL11_ORYSI Protein spotted leaf 11 OS=Oryza sativa subsp. indica GN=SPL11 PE=1 SV=2 123 303 8.0E-12
sp|P35224|CTNB_URECA Catenin beta OS=Urechis caupo PE=2 SV=1 127 406 8.0E-12
sp|Q8GWV5|PUB3_ARATH U-box domain-containing protein 3 OS=Arabidopsis thaliana GN=PUB3 PE=2 SV=2 127 343 9.0E-12
sp|Q9SNC6|PUB13_ARATH U-box domain-containing protein 13 OS=Arabidopsis thaliana GN=PUB13 PE=1 SV=1 171 389 9.0E-12
sp|B7U179|ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis thaliana GN=ABAP1 PE=1 SV=1 220 536 2.0E-11
sp|B9DHT4|ARIA_ARATH ARM REPEAT PROTEIN INTERACTING WITH ABF2 OS=Arabidopsis thaliana GN=ARIA PE=1 SV=2 220 485 2.0E-11
sp|P30998|PLAK_XENLA Junction plakoglobin OS=Xenopus laevis GN=jup PE=2 SV=1 125 396 2.0E-11
sp|Q681N2|PUB15_ARATH U-box domain-containing protein 15 OS=Arabidopsis thaliana GN=PUB15 PE=2 SV=2 239 377 4.0E-11
sp|B9DHT4|ARIA_ARATH ARM REPEAT PROTEIN INTERACTING WITH ABF2 OS=Arabidopsis thaliana GN=ARIA PE=1 SV=2 103 332 7.0E-11
sp|Q02821|IMA1_YEAST Importin subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRP1 PE=1 SV=1 115 396 9.0E-11
sp|Q9SNC6|PUB13_ARATH U-box domain-containing protein 13 OS=Arabidopsis thaliana GN=PUB13 PE=1 SV=1 129 340 1.0E-10
sp|Q9FZ06|ARK3_ARATH Armadillo repeat-containing kinesin-like protein 3 OS=Arabidopsis thaliana GN=ARK3 PE=1 SV=1 115 340 1.0E-10
sp|P52293|IMA1_MOUSE Importin subunit alpha-1 OS=Mus musculus GN=Kpna2 PE=1 SV=2 171 486 2.0E-10
sp|Q9FJP6|PUB38_ARATH U-box domain-containing protein 38 OS=Arabidopsis thaliana GN=PUB38 PE=1 SV=1 141 259 2.0E-10
sp|Q5RBV0|IMA7_PONAB Importin subunit alpha-7 OS=Pongo abelii GN=KPNA6 PE=2 SV=1 52 382 3.0E-10
sp|O60684|IMA7_HUMAN Importin subunit alpha-7 OS=Homo sapiens GN=KPNA6 PE=1 SV=1 52 382 3.0E-10
sp|Q17GS9|ARM_AEDAE Armadillo segment polarity protein OS=Aedes aegypti GN=arm PE=3 SV=1 171 411 3.0E-10
sp|P52292|IMA1_HUMAN Importin subunit alpha-1 OS=Homo sapiens GN=KPNA2 PE=1 SV=1 171 486 3.0E-10
sp|O94374|IMA2_SCHPO Importin subunit alpha-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp1 PE=1 SV=1 171 441 3.0E-10
sp|Q7QHW5|ARM_ANOGA Armadillo segment polarity protein OS=Anopheles gambiae GN=arm PE=3 SV=5 171 411 3.0E-10
sp|Q9FWY7|IMPA6_ARATH Importin subunit alpha-6 OS=Arabidopsis thaliana GN=IMPA6 PE=2 SV=1 109 413 5.0E-10
sp|Q9FJ09|IMPA5_ARATH Importin subunit alpha-5 OS=Arabidopsis thaliana GN=IMPA5 PE=2 SV=1 109 409 7.0E-10
sp|Q9C9A6|PUB10_ARATH U-box domain-containing protein 10 OS=Arabidopsis thaliana GN=PUB10 PE=2 SV=1 129 340 8.0E-10
sp|Q29I35|ARM_DROPS Armadillo segment polarity protein OS=Drosophila pseudoobscura pseudoobscura GN=arm PE=3 SV=2 171 418 9.0E-10
sp|P18824|ARM_DROME Armadillo segment polarity protein OS=Drosophila melanogaster GN=arm PE=1 SV=1 171 418 1.0E-09
sp|Q9STT1|PUB39_ARATH U-box domain-containing protein 39 OS=Arabidopsis thaliana GN=PUB39 PE=2 SV=1 141 259 1.0E-09
sp|Q9ZV31|PUB12_ARATH U-box domain-containing protein 12 OS=Arabidopsis thaliana GN=PUB12 PE=2 SV=1 171 389 2.0E-09
sp|P30998|PLAK_XENLA Junction plakoglobin OS=Xenopus laevis GN=jup PE=2 SV=1 215 426 2.0E-09
sp|O94374|IMA2_SCHPO Importin subunit alpha-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp1 PE=1 SV=1 54 414 2.0E-09
sp|Q0WUF6|PUB41_ARATH U-box domain-containing protein 41 OS=Arabidopsis thaliana GN=PUB41 PE=2 SV=1 141 261 2.0E-09
sp|Q6P0K8|PLAK_RAT Junction plakoglobin OS=Rattus norvegicus GN=Jup PE=1 SV=1 125 382 2.0E-09
sp|P35223|CTNB_TRIGR Catenin beta OS=Tripneustes gratilla PE=2 SV=1 215 402 2.0E-09
sp|Q8WNW3|PLAK_PIG Junction plakoglobin OS=Sus scrofa GN=Jup PE=2 SV=1 125 382 2.0E-09
sp|Q29I35|ARM_DROPS Armadillo segment polarity protein OS=Drosophila pseudoobscura pseudoobscura GN=arm PE=3 SV=2 127 382 3.0E-09
sp|P18824|ARM_DROME Armadillo segment polarity protein OS=Drosophila melanogaster GN=arm PE=1 SV=1 127 382 3.0E-09
sp|P14923|PLAK_HUMAN Junction plakoglobin OS=Homo sapiens GN=JUP PE=1 SV=3 215 411 3.0E-09
sp|P14923|PLAK_HUMAN Junction plakoglobin OS=Homo sapiens GN=JUP PE=1 SV=3 125 382 3.0E-09
sp|A2RT91|ANKAR_MOUSE Ankyrin and armadillo repeat-containing protein OS=Mus musculus GN=Ankar PE=2 SV=1 237 487 3.0E-09
sp|O22161|ADLO1_ARATH Protein ARABIDILLO 1 OS=Arabidopsis thaliana GN=FBX5 PE=1 SV=1 127 259 3.0E-09
sp|Q8SPJ1|PLAK_BOVIN Junction plakoglobin OS=Bos taurus GN=JUP PE=2 SV=1 215 411 3.0E-09
sp|Q9SNC6|PUB13_ARATH U-box domain-containing protein 13 OS=Arabidopsis thaliana GN=PUB13 PE=1 SV=1 125 384 4.0E-09
sp|Q6P0K8|PLAK_RAT Junction plakoglobin OS=Rattus norvegicus GN=Jup PE=1 SV=1 215 411 4.0E-09
sp|Q8WNW3|PLAK_PIG Junction plakoglobin OS=Sus scrofa GN=Jup PE=2 SV=1 215 411 4.0E-09
sp|Q8SPJ1|PLAK_BOVIN Junction plakoglobin OS=Bos taurus GN=JUP PE=2 SV=1 125 382 4.0E-09
sp|Q02257|PLAK_MOUSE Junction plakoglobin OS=Mus musculus GN=Jup PE=1 SV=3 215 411 4.0E-09
sp|Q02453|ARM_MUSDO Armadillo segment polarity protein OS=Musca domestica GN=arm PE=2 SV=1 127 382 4.0E-09
sp|Q5T2S8|ARMC4_HUMAN Armadillo repeat-containing protein 4 OS=Homo sapiens GN=ARMC4 PE=1 SV=1 127 289 5.0E-09
sp|Q02257|PLAK_MOUSE Junction plakoglobin OS=Mus musculus GN=Jup PE=1 SV=3 125 382 5.0E-09
sp|Q02453|ARM_MUSDO Armadillo segment polarity protein OS=Musca domestica GN=arm PE=2 SV=1 171 418 5.0E-09
sp|C6K7I2|IMA8_PIG Importin subunit alpha-8 OS=Sus scrofa GN=KPNA7 PE=2 SV=2 122 390 5.0E-09
sp|C0LLJ0|IMA8_MOUSE Importin subunit alpha-8 OS=Mus musculus GN=Kpna7 PE=1 SV=1 122 388 5.0E-09
sp|A9QM74|IMA8_HUMAN Importin subunit alpha-8 OS=Homo sapiens GN=KPNA7 PE=1 SV=1 122 386 5.0E-09
sp|Q71VM4|IMA1A_ORYSJ Importin subunit alpha-1a OS=Oryza sativa subsp. japonica GN=Os01g0253300 PE=1 SV=2 109 425 6.0E-09
sp|Q681N2|PUB15_ARATH U-box domain-containing protein 15 OS=Arabidopsis thaliana GN=PUB15 PE=2 SV=2 118 282 7.0E-09
sp|F4JL11|IMPA2_ARATH Importin subunit alpha-2 OS=Arabidopsis thaliana GN=IMPA2 PE=1 SV=1 109 429 8.0E-09
sp|B2RY50|ARMC4_MOUSE Armadillo repeat-containing protein 4 OS=Mus musculus GN=Armc4 PE=1 SV=1 127 289 9.0E-09
sp|A2AU72|ARMC3_MOUSE Armadillo repeat-containing protein 3 OS=Mus musculus GN=Armc3 PE=1 SV=1 197 420 1.0E-08
sp|Q54I71|AARA_DICDI Protein aardvark OS=Dictyostelium discoideum GN=aarA PE=2 SV=1 137 288 1.0E-08
sp|Q9M224|ADLO2_ARATH Protein ARABIDILLO 2 OS=Arabidopsis thaliana GN=At3g60350 PE=2 SV=1 127 259 1.0E-08
sp|C1JZ66|IMA8_BOVIN Importin subunit alpha-8 OS=Bos taurus GN=KPNA7 PE=1 SV=2 127 390 1.0E-08
sp|P35224|CTNB_URECA Catenin beta OS=Urechis caupo PE=2 SV=1 215 427 2.0E-08
sp|Q0WUF6|PUB41_ARATH U-box domain-containing protein 41 OS=Arabidopsis thaliana GN=PUB41 PE=2 SV=1 195 428 2.0E-08
sp|Q02453|ARM_MUSDO Armadillo segment polarity protein OS=Musca domestica GN=arm PE=2 SV=1 136 401 2.0E-08
sp|P26233|CTNB_XENLA Catenin beta OS=Xenopus laevis GN=ctnnb1 PE=1 SV=1 170 411 2.0E-08
sp|A2AU72|ARMC3_MOUSE Armadillo repeat-containing protein 3 OS=Mus musculus GN=Armc3 PE=1 SV=1 115 358 3.0E-08
sp|P26233|CTNB_XENLA Catenin beta OS=Xenopus laevis GN=ctnnb1 PE=1 SV=1 155 382 3.0E-08
sp|Q9WU82|CTNB1_RAT Catenin beta-1 OS=Rattus norvegicus GN=Ctnnb1 PE=1 SV=1 170 411 3.0E-08
sp|Q02248|CTNB1_MOUSE Catenin beta-1 OS=Mus musculus GN=Ctnnb1 PE=1 SV=1 170 426 3.0E-08
sp|B6V8E6|CTNB1_CANLF Catenin beta-1 OS=Canis lupus familiaris GN=CTNNB1 PE=1 SV=1 170 426 3.0E-08
sp|Q0VCX4|CTNB1_BOVIN Catenin beta-1 OS=Bos taurus GN=CTNNB1 PE=1 SV=1 170 426 3.0E-08
sp|O44326|HMP2_CAEEL Beta-catenin-like protein hmp-2 OS=Caenorhabditis elegans GN=hmp-2 PE=1 SV=1 216 411 3.0E-08
sp|P35222|CTNB1_HUMAN Catenin beta-1 OS=Homo sapiens GN=CTNNB1 PE=1 SV=1 170 426 3.0E-08
sp|Q9WU82|CTNB1_RAT Catenin beta-1 OS=Rattus norvegicus GN=Ctnnb1 PE=1 SV=1 155 382 4.0E-08
sp|Q02248|CTNB1_MOUSE Catenin beta-1 OS=Mus musculus GN=Ctnnb1 PE=1 SV=1 155 382 4.0E-08
sp|B6V8E6|CTNB1_CANLF Catenin beta-1 OS=Canis lupus familiaris GN=CTNNB1 PE=1 SV=1 155 382 4.0E-08
sp|Q0VCX4|CTNB1_BOVIN Catenin beta-1 OS=Bos taurus GN=CTNNB1 PE=1 SV=1 155 382 4.0E-08
sp|P35222|CTNB1_HUMAN Catenin beta-1 OS=Homo sapiens GN=CTNNB1 PE=1 SV=1 155 382 4.0E-08
sp|Q5VQ09|ARK2_ORYSJ Armadillo repeat-containing kinesin-like protein 2 OS=Oryza sativa subsp. japonica GN=Os06g0137100 PE=2 SV=1 115 340 4.0E-08
sp|Q0DV28|ARK1_ORYSJ Armadillo repeat-containing kinesin-like protein 1 OS=Oryza sativa subsp. japonica GN=Os03g0152900 PE=2 SV=2 130 368 5.0E-08
sp|Q96321|IMPA1_ARATH Importin subunit alpha-1 OS=Arabidopsis thaliana GN=IMPA1 PE=1 SV=2 122 386 5.0E-08
sp|O04294|IMPA3_ARATH Importin subunit alpha-3 OS=Arabidopsis thaliana GN=IMPA3 PE=1 SV=2 168 486 6.0E-08
sp|Q9FL17|PUB40_ARATH U-box domain-containing protein 40 OS=Arabidopsis thaliana GN=PUB40 PE=2 SV=2 133 258 6.0E-08
sp|C6K7I2|IMA8_PIG Importin subunit alpha-8 OS=Sus scrofa GN=KPNA7 PE=2 SV=2 226 528 7.0E-08
sp|Q503E9|IMA6_DANRE Importin subunit alpha-6 OS=Danio rerio GN=kpna5 PE=2 SV=2 129 401 7.0E-08
sp|Q8VZ40|PUB14_ARATH U-box domain-containing protein 14 OS=Arabidopsis thaliana GN=PUB14 PE=1 SV=1 129 333 8.0E-08
sp|Q54I71|AARA_DICDI Protein aardvark OS=Dictyostelium discoideum GN=aarA PE=2 SV=1 141 334 2.0E-07
sp|Q9SV36|ARK1_ARATH Armadillo repeat-containing kinesin-like protein 1 OS=Arabidopsis thaliana GN=ARK1 PE=1 SV=2 127 340 2.0E-07
sp|Q02821|IMA1_YEAST Importin subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRP1 PE=1 SV=1 223 418 3.0E-07
sp|Q8VZ40|PUB14_ARATH U-box domain-containing protein 14 OS=Arabidopsis thaliana GN=PUB14 PE=1 SV=1 205 382 3.0E-07
sp|Q17GS9|ARM_AEDAE Armadillo segment polarity protein OS=Aedes aegypti GN=arm PE=3 SV=1 133 403 4.0E-07
sp|Q9FJ09|IMPA5_ARATH Importin subunit alpha-5 OS=Arabidopsis thaliana GN=IMPA5 PE=2 SV=1 244 465 4.0E-07
sp|Q0IMG9|SL11_ORYSJ E3 ubiquitin-protein ligase SPL11 OS=Oryza sativa subsp. japonica GN=SPL11 PE=1 SV=2 171 384 5.0E-07
sp|A2ZLU6|SL11_ORYSI Protein spotted leaf 11 OS=Oryza sativa subsp. indica GN=SPL11 PE=1 SV=2 171 384 5.0E-07
sp|Q17GS9|ARM_AEDAE Armadillo segment polarity protein OS=Aedes aegypti GN=arm PE=3 SV=1 127 382 5.0E-07
sp|Q7QHW5|ARM_ANOGA Armadillo segment polarity protein OS=Anopheles gambiae GN=arm PE=3 SV=5 127 382 5.0E-07
sp|P18824|ARM_DROME Armadillo segment polarity protein OS=Drosophila melanogaster GN=arm PE=1 SV=1 136 403 5.0E-07
sp|Q19969|IMA3_CAEEL Importin subunit alpha-3 OS=Caenorhabditis elegans GN=ima-3 PE=1 SV=2 216 528 5.0E-07
sp|Q9SLX0|IMA1B_ORYSJ Importin subunit alpha-1b OS=Oryza sativa subsp. japonica GN=Os05g0155500 PE=1 SV=2 164 463 5.0E-07
sp|O35345|IMA7_MOUSE Importin subunit alpha-7 OS=Mus musculus GN=Kpna6 PE=1 SV=2 129 401 6.0E-07
sp|Q9C9A6|PUB10_ARATH U-box domain-containing protein 10 OS=Arabidopsis thaliana GN=PUB10 PE=2 SV=1 218 418 7.0E-07
sp|A9QM74|IMA8_HUMAN Importin subunit alpha-8 OS=Homo sapiens GN=KPNA7 PE=1 SV=1 197 486 7.0E-07
sp|Q9FJ09|IMPA5_ARATH Importin subunit alpha-5 OS=Arabidopsis thaliana GN=IMPA5 PE=2 SV=1 203 441 8.0E-07
sp|O00505|IMA4_HUMAN Importin subunit alpha-4 OS=Homo sapiens GN=KPNA3 PE=1 SV=2 130 401 1.0E-06
sp|I3L5V6|SARM1_PIG Sterile alpha and TIR motif-containing protein 1 OS=Sus scrofa GN=SARM1 PE=2 SV=1 179 425 1.0E-06
sp|O22478|IMA_SOLLC Importin subunit alpha OS=Solanum lycopersicum PE=2 SV=2 164 486 1.0E-06
sp|Q5T2S8|ARMC4_HUMAN Armadillo repeat-containing protein 4 OS=Homo sapiens GN=ARMC4 PE=1 SV=1 127 386 2.0E-06
sp|B2RY50|ARMC4_MOUSE Armadillo repeat-containing protein 4 OS=Mus musculus GN=Armc4 PE=1 SV=1 127 386 2.0E-06
sp|Q7QHW5|ARM_ANOGA Armadillo segment polarity protein OS=Anopheles gambiae GN=arm PE=3 SV=5 133 403 2.0E-06
sp|Q9FWY7|IMPA6_ARATH Importin subunit alpha-6 OS=Arabidopsis thaliana GN=IMPA6 PE=2 SV=1 163 441 2.0E-06
sp|Q8VZ40|PUB14_ARATH U-box domain-containing protein 14 OS=Arabidopsis thaliana GN=PUB14 PE=1 SV=1 122 257 2.0E-06
sp|P91276|IMA2_CAEEL Importin subunit alpha-2 OS=Caenorhabditis elegans GN=ima-2 PE=1 SV=1 243 465 2.0E-06
sp|Q0V7M0|IMA7_BOVIN Importin subunit alpha-7 OS=Bos taurus GN=KPNA6 PE=2 SV=1 129 401 2.0E-06
sp|Q0V7M0|IMA7_BOVIN Importin subunit alpha-7 OS=Bos taurus GN=KPNA6 PE=2 SV=1 215 486 2.0E-06
sp|Q76P29|IMAB_DICDI Importin subunit alpha-B OS=Dictyostelium discoideum GN=DDB_G0272318 PE=3 SV=1 122 386 2.0E-06
sp|Q76P29|IMAB_DICDI Importin subunit alpha-B OS=Dictyostelium discoideum GN=DDB_G0272318 PE=3 SV=1 164 486 2.0E-06
sp|Q9LPC6|ARK2_ARATH Armadillo repeat-containing kinesin-like protein 2 OS=Arabidopsis thaliana GN=ARK2 PE=1 SV=2 127 340 2.0E-06
sp|O22193|PUB4_ARATH U-box domain-containing protein 4 OS=Arabidopsis thaliana GN=PUB4 PE=1 SV=3 205 491 3.0E-06
sp|Q5RBV0|IMA7_PONAB Importin subunit alpha-7 OS=Pongo abelii GN=KPNA6 PE=2 SV=1 129 401 3.0E-06
sp|O60684|IMA7_HUMAN Importin subunit alpha-7 OS=Homo sapiens GN=KPNA6 PE=1 SV=1 129 401 3.0E-06
sp|Q19969|IMA3_CAEEL Importin subunit alpha-3 OS=Caenorhabditis elegans GN=ima-3 PE=1 SV=2 130 391 3.0E-06
sp|O35344|IMA4_MOUSE Importin subunit alpha-4 OS=Mus musculus GN=Kpna3 PE=1 SV=1 130 401 3.0E-06
sp|Q6SZW1|SARM1_HUMAN Sterile alpha and TIR motif-containing protein 1 OS=Homo sapiens GN=SARM1 PE=1 SV=1 198 425 4.0E-06
sp|Q08DQ0|PKP3_BOVIN Plakophilin-3 OS=Bos taurus GN=PKP3 PE=2 SV=1 130 244 4.0E-06
sp|Q5XEZ8|PUB2_ARATH U-box domain-containing protein 2 OS=Arabidopsis thaliana GN=PUB2 PE=2 SV=1 293 531 6.0E-06
sp|Q04173|GDS1_BOVIN Rap1 GTPase-GDP dissociation stimulator 1 OS=Bos taurus GN=RAP1GDS1 PE=1 SV=1 122 401 6.0E-06
sp|Q9Y446|PKP3_HUMAN Plakophilin-3 OS=Homo sapiens GN=PKP3 PE=1 SV=1 130 244 6.0E-06
sp|A2RT91|ANKAR_MOUSE Ankyrin and armadillo repeat-containing protein OS=Mus musculus GN=Ankar PE=2 SV=1 167 382 7.0E-06
sp|Q9FL17|PUB40_ARATH U-box domain-containing protein 40 OS=Arabidopsis thaliana GN=PUB40 PE=2 SV=2 128 285 7.0E-06
sp|P26233|CTNB_XENLA Catenin beta OS=Xenopus laevis GN=ctnnb1 PE=1 SV=1 136 426 8.0E-06
sp|Q9QY23|PKP3_MOUSE Plakophilin-3 OS=Mus musculus GN=Pkp3 PE=1 SV=2 130 244 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6851
MGICHSSCCGGRSRDGLYEPILADSEREAVADLLQYLENRGETDFFSGEPLRALSTLVFSDNIDLQRSASLTFAE
ITERGTPSQRATARLTTLLHHSGPSPLAVGSLDLALHADPPVDVRQVDRDTLEPILFLLQSNDMEVQRAASAALG
NLAVNTENKVLIVQLGGLTPLIRQMMSQNVEVQCNAVGCITNLATHEDNKAKIARSGALGPLTRLAKSRDMRVQR
NATGALLNMTHSDENRQQLVNAGAMPVLVQLLASPDVDVQYYCTTALSNIAVDASNRRKLAATEPKLVQALVNLM
DSSSPKVQCQAALALRNLASDEKYQLDIVRSNGLHPLLRLLQSSYLPLILSAVACIRNISIHPMNESPIIEANFL
KPLVDLLGSTDNEEIQCHAISTLRNLAASSDRNKALVLDAGAVQKCKQLVLEVPVTVQSEMTAAIAVLALSDDLK
THLLNLGVCDVLIPLTCSPSIEVQGNSAAALGNLSSKVGDYSIFVRNWNEPNGGIHGYLGRFLQSGDATFQHIAV
WTLLQLFESEDRTLIGLIGKADDVVEQVRAIASRSVDEPNEEEDEGEVVNLAQRCLELVASVT*
Coding >OphauB2|6851
ATGGGAATCTGCCACTCGTCGTGCTGCGGAGGACGATCCCGCGATGGCCTCTATGAGCCCATCTTGGCCGACAGC
GAGCGGGAAGCTGTCGCCGACTTGTTGCAATACCTTGAAAACCGAGGCGAAACCGACTTCTTTTCCGGCGAGCCC
TTGCGCGCCTTGAGCACCTTGGTCTTCTCGGACAATATCGACCTTCAACGCAGTGCCAGTCTTACGTTTGCCGAA
ATCACTGAGCGAGGTACGCCGTCGCAGCGGGCCACCGCGCGGCTTACCACGCTGCTCCACCACTCTGGGCCAAGC
CCTCTGGCCGTCGGCTCCCTCGACCTGGCTCTCCATGCTGACCCGCCGGTAGATGTCCGCCAAGTCGACCGCGAT
ACCCTCGAGCCCATCTTGTTCCTGCTGCAGAGCAACGACATGGAGGTGCAGCGAGCTGCCAGTGCTGCCCTGGGC
AATCTAGCCGTCAATACCGAGAACAAGGTGCTCATTGTCCAGCTCGGCGGCCTCACCCCCTTGATTCGGCAAATG
ATGTCTCAAAATGTAGAGGTGCAATGCAATGCCGTTGGCTGCATCACCAATCTTGCCACCCACGAGGATAACAAG
GCCAAGATTGCCCGTTCTGGAGCGCTCGGCCCCTTGACGCGCTTGGCAAAGTCACGAGACATGCGCGTGCAACGC
AACGCCACTGGAGCCCTTTTGAACATGACGCACTCTGATGAGAACCGGCAGCAGCTTGTTAATGCCGGCGCCATG
CCCGTTCTTGTTCAGCTGCTCGCGTCGCCCGACGTGGATGTCCAGTATTACTGCACTACAGCCCTCAGCAACATT
GCTGTCGATGCCAGCAACCGCCGCAAGCTGGCCGCCACTGAGCCCAAGCTGGTGCAGGCCTTGGTCAATCTCATG
GACTCTTCATCCCCCAAGGTTCAGTGTCAGGCAGCACTGGCCCTGAGGAACCTAGCGTCCGACGAAAAGTACCAG
CTGGACATTGTGCGCTCTAATGGCCTTCATCCCTTGCTTCGTCTGCTTCAGTCGTCGTACCTGCCCCTCATCTTG
TCGGCCGTGGCGTGCATTCGCAACATTTCGATTCACCCCATGAACGAGTCCCCCATCATCGAAGCCAACTTTTTG
AAGCCCCTGGTTGACCTGCTGGGCTCAACAGACAATGAGGAGATTCAGTGCCATGCCATTTCCACCCTGCGAAAT
CTTGCCGCCAGCTCGGACCGCAACAAGGCGCTTGTTCTTGACGCTGGCGCCGTGCAAAAGTGCAAGCAGCTGGTG
CTTGAAGTGCCAGTGACGGTGCAGTCGGAAATGACGGCCGCCATTGCAGTGCTGGCGCTCAGCGACGACCTCAAG
ACACATTTGCTCAATTTGGGTGTCTGCGACGTGCTAATCCCTCTGACTTGCTCACCCAGTATTGAAGTCCAAGGC
AACAGCGCCGCCGCCCTGGGGAACCTGTCGTCCAAAGTGGGCGACTACTCCATTTTTGTGCGAAACTGGAACGAG
CCCAATGGAGGCATCCACGGCTACCTCGGCCGCTTTTTACAGTCTGGAGATGCCACCTTTCAGCACATTGCTGTG
TGGACGCTTTTGCAGCTCTTCGAGTCGGAAGACCGAACCTTGATTGGCCTCATTGGCAAAGCCGACGACGTTGTC
GAGCAGGTGCGGGCCATTGCCAGCCGTTCTGTTGACGAGCCCAACGAGGAAGAAGACGAGGGCGAGGTTGTAAAC
CTGGCGCAGCGGTGTTTGGAGCTGGTCGCGTCAGTCACATGA
Transcript >OphauB2|6851
ATGGGAATCTGCCACTCGTCGTGCTGCGGAGGACGATCCCGCGATGGCCTCTATGAGCCCATCTTGGCCGACAGC
GAGCGGGAAGCTGTCGCCGACTTGTTGCAATACCTTGAAAACCGAGGCGAAACCGACTTCTTTTCCGGCGAGCCC
TTGCGCGCCTTGAGCACCTTGGTCTTCTCGGACAATATCGACCTTCAACGCAGTGCCAGTCTTACGTTTGCCGAA
ATCACTGAGCGAGGTACGCCGTCGCAGCGGGCCACCGCGCGGCTTACCACGCTGCTCCACCACTCTGGGCCAAGC
CCTCTGGCCGTCGGCTCCCTCGACCTGGCTCTCCATGCTGACCCGCCGGTAGATGTCCGCCAAGTCGACCGCGAT
ACCCTCGAGCCCATCTTGTTCCTGCTGCAGAGCAACGACATGGAGGTGCAGCGAGCTGCCAGTGCTGCCCTGGGC
AATCTAGCCGTCAATACCGAGAACAAGGTGCTCATTGTCCAGCTCGGCGGCCTCACCCCCTTGATTCGGCAAATG
ATGTCTCAAAATGTAGAGGTGCAATGCAATGCCGTTGGCTGCATCACCAATCTTGCCACCCACGAGGATAACAAG
GCCAAGATTGCCCGTTCTGGAGCGCTCGGCCCCTTGACGCGCTTGGCAAAGTCACGAGACATGCGCGTGCAACGC
AACGCCACTGGAGCCCTTTTGAACATGACGCACTCTGATGAGAACCGGCAGCAGCTTGTTAATGCCGGCGCCATG
CCCGTTCTTGTTCAGCTGCTCGCGTCGCCCGACGTGGATGTCCAGTATTACTGCACTACAGCCCTCAGCAACATT
GCTGTCGATGCCAGCAACCGCCGCAAGCTGGCCGCCACTGAGCCCAAGCTGGTGCAGGCCTTGGTCAATCTCATG
GACTCTTCATCCCCCAAGGTTCAGTGTCAGGCAGCACTGGCCCTGAGGAACCTAGCGTCCGACGAAAAGTACCAG
CTGGACATTGTGCGCTCTAATGGCCTTCATCCCTTGCTTCGTCTGCTTCAGTCGTCGTACCTGCCCCTCATCTTG
TCGGCCGTGGCGTGCATTCGCAACATTTCGATTCACCCCATGAACGAGTCCCCCATCATCGAAGCCAACTTTTTG
AAGCCCCTGGTTGACCTGCTGGGCTCAACAGACAATGAGGAGATTCAGTGCCATGCCATTTCCACCCTGCGAAAT
CTTGCCGCCAGCTCGGACCGCAACAAGGCGCTTGTTCTTGACGCTGGCGCCGTGCAAAAGTGCAAGCAGCTGGTG
CTTGAAGTGCCAGTGACGGTGCAGTCGGAAATGACGGCCGCCATTGCAGTGCTGGCGCTCAGCGACGACCTCAAG
ACACATTTGCTCAATTTGGGTGTCTGCGACGTGCTAATCCCTCTGACTTGCTCACCCAGTATTGAAGTCCAAGGC
AACAGCGCCGCCGCCCTGGGGAACCTGTCGTCCAAAGTGGGCGACTACTCCATTTTTGTGCGAAACTGGAACGAG
CCCAATGGAGGCATCCACGGCTACCTCGGCCGCTTTTTACAGTCTGGAGATGCCACCTTTCAGCACATTGCTGTG
TGGACGCTTTTGCAGCTCTTCGAGTCGGAAGACCGAACCTTGATTGGCCTCATTGGCAAAGCCGACGACGTTGTC
GAGCAGGTGCGGGCCATTGCCAGCCGTTCTGTTGACGAGCCCAACGAGGAAGAAGACGAGGGCGAGGTTGTAAAC
CTGGCGCAGCGGTGTTTGGAGCTGGTCGCGTCAGTCACATGA
Gene >OphauB2|6851
ATGGGAATCTGCCACTCGTCGTGCTGCGGAGGTGAGCAACGTCTATTTTTTTCTTGTGCCCCCCCCCGCCTTTGG
CCGAGTCGCTGCTTTTGCTAACGGCTGTCCTTGTTGCTCCCCCCCCCCGGAATAGGACGATCCCGCGATGGCCTC
TATGAGCCCATCTTGGCCGACAGCGAGCGGGAAGCTGTCGCCGACTTGTTGCAATACCTTGAAAACGTGAGTGGT
GTAGCTCCAAGGCGCTTGCTCCAAGCTTGCTGACTGGCTGTTTGGTCTGGCGGCAGCGAGGCGAAACCGACTTCT
TTTCCGGCGAGCCCTTGCGCGCCTTGAGCACCTTGGTCTTCTCGGACAATATCGACCTTCAACGCAGTGCCAGTC
TTACGTTTGCCGAAATCACTGAGCGAGGTACGCCGTCGCAGCGGGCCACCGCGCGGCTTACCACGCTGCTCCACC
ACTCTGGGCCAAGCCCTCTGGCCGTCGGCTCCCTCGACCTGGCTCTCCATGCTGACCCGCCGGTAGATGTCCGCC
AAGTCGACCGCGATACCCTCGAGCCCATCTTGTTCCTGCTGCAGAGCAACGACATGGAGGTGCAGCGAGCTGCCA
GTGCTGCCCTGGGCAATCTAGCCGTCAATAGTGGGCCACGCCGCCCTGTCTTTCATTTTTACAGCTGCTGACTGT
CTGTTGCAGCCGAGAACAAGGTGCTCATTGTCCAGCTCGGCGGCCTCACCCCCTTGATTCGGCAAATGATGTCTC
AAAATGTAGAGGTGCAATGCAATGCCGTTGGCTGCATCACCAATCTTGCCACCCACGAGGATAACAAGGCCAAGA
TTGCCCGTTCTGGAGCGCTCGGCCCCTTGACGCGCTTGGCAAAGTCACGAGACATGCGCGTGCAACGCAACGCCA
CTGGAGCCCTTTTGAACATGACGCACTCTGGTAGTCCCGTCTCTTCTTGTCCCCATACCCACCTGCAGCTTGTTG
CCCTGCTGACACGCCTTTTTTGGGGGCAGATGAGAACCGGCAGCAGCTTGTTAATGCCGGCGCCATGCCCGTTCT
TGTTCAGCTGCTCGCGTCGCCCGACGTGGATGTCCAGTATTACTGCACTACAGCCCTCAGCAACATTGCTGTCGA
TGCCAGCAACCGCCGCAAGCTGGCCGCCACTGAGCCCAAGCTGGTGCAGGCCTTGGTCAATCTCATGGACTCTTC
ATCCCCCAAGGTTCAGTGTCAGGCAGCACTGGCCCTGAGGAACCTAGCGTCCGACGAAAAGTACCAGCTGGACAT
TGTGCGCTCTAATGGCCTTCATCCCTTGCTTCGTCTGCTTCAGTCGTCGTACCTGCCCCTCATCTTGTCGGCCGT
GGCGTGCATTCGCAACATTTCGATTCACCCCATGAACGAGTCCCCCATCATCGAAGCCAACTTTTTGAAGCCCCT
GGTTGACCTGCTGGGCTCAACAGACAATGAGGAGATTCAGTGCCATGCCATTTCCACCCTGCGAAATCTTGCCGC
CAGCTCGGACCGCAACAAGGCGCTTGTTCTTGACGCTGGCGCCGTGCAAAAGTGCAAGCAGCTGGTGCTTGAAGT
GCCAGTGACGGTGCAGTCGGAAATGACGGCCGCCATTGCAGTGCTGGCGCTCAGCGACGACCTCAAGACACATTT
GCTCAATTTGGGTGTCTGCGACGTGCTAATCCCTCTGACTTGCTCACCCAGTATTGAAGTCCAAGGCAACAGCGC
CGCCGCCCTGGGGAACCTGTCGTCCAAAGGTGGGCTCTCTTGCCAAAGTCGTTATCGTGGGCCAAGGGAGAGGAG
GGTAGACGGGGACAGACGAGCTGACTGGCGCAAACTAGTGGGCGACTACTCCATTTTTGTGCGAAACTGGAACGA
GCCCAATGGAGGCATCCACGGCTACCTCGGCCGCTTTTTACAGTCTGGAGATGCCACCTTTCAGCACATTGCTGT
GTGGACGCTTTTGCAGCTCTTCGAGTCGGAAGACCGAACCTTGATTGGCCTCATTGGCAAAGCCGACGACGTTGT
CGAGCAGGTGCGGGCCATTGCCAGCCGTTCTGTTGACGAGCCCAACGAGGAAGAAGACGAGGGCGAGGTTGTAAA
CCTGGCGCAGCGGTGTTTGGAGCTGGTCGGTCAGGATACGTCGAAGGCCCACATCGAGGGCTAGTCGCTGACACG
AGGTCAACAGCGTCAGTCACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail