Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6851
Gene name
LocationContig_67:44103..46302
Strand+
Gene length (bp)2199
Transcript length (bp)1767
Coding sequence length (bp)1767
Protein length (aa) 589

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00514 Arm Armadillo/beta-catenin-like repeat 7.8E-10 155 194
PF00514 Arm Armadillo/beta-catenin-like repeat 4.4E-07 197 235
PF00514 Arm Armadillo/beta-catenin-like repeat 1.1E-12 237 276
PF00514 Arm Armadillo/beta-catenin-like repeat 6.6E-07 288 320
PF00514 Arm Armadillo/beta-catenin-like repeat 1.8E-07 365 403
PF00514 Arm Armadillo/beta-catenin-like repeat 1.5E-05 447 486
PF05804 KAP Kinesin-associated protein (KAP) 1.1E-10 143 405
PF04826 Arm_2 Armadillo-like 7.5E-06 127 302

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I1B1|VAC8_GIBZE Vacuolar protein 8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=VAC8 PE=3 SV=4 1 585 0.0E+00
sp|Q7RXW1|VAC8_NEUCR Vacuolar protein 8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vac8 PE=3 SV=4 1 585 0.0E+00
sp|Q2GW27|VAC8_CHAGB Vacuolar protein 8 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=VAC8 PE=3 SV=3 1 585 0.0E+00
sp|Q4WVW4|VAC8_ASPFU Vacuolar protein 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=vac8 PE=3 SV=1 4 586 0.0E+00
sp|Q2U5T5|VAC8_ASPOR Vacuolar protein 8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=vac8 PE=3 SV=1 4 586 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I1B1|VAC8_GIBZE Vacuolar protein 8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=VAC8 PE=3 SV=4 1 585 0.0E+00
sp|Q7RXW1|VAC8_NEUCR Vacuolar protein 8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vac8 PE=3 SV=4 1 585 0.0E+00
sp|Q2GW27|VAC8_CHAGB Vacuolar protein 8 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=VAC8 PE=3 SV=3 1 585 0.0E+00
sp|Q4WVW4|VAC8_ASPFU Vacuolar protein 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=vac8 PE=3 SV=1 4 586 0.0E+00
sp|Q2U5T5|VAC8_ASPOR Vacuolar protein 8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=vac8 PE=3 SV=1 4 586 0.0E+00
sp|P0CM60|VAC8_CRYNJ Vacuolar protein 8 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=VAC8 PE=3 SV=1 1 584 0.0E+00
sp|P0CM61|VAC8_CRYNB Vacuolar protein 8 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=VAC8 PE=3 SV=1 1 584 0.0E+00
sp|Q6C5Y8|VAC8_YARLI Vacuolar protein 8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=VAC8 PE=3 SV=1 11 584 0.0E+00
sp|O43028|VAC8_SCHPO Vacuolar protein 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vac8 PE=1 SV=4 1 584 0.0E+00
sp|Q6BTZ4|VAC8_DEBHA Vacuolar protein 8 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=VAC8 PE=3 SV=4 1 585 0.0E+00
sp|Q59MN0|VAC8_CANAL Vacuolar protein 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VAC8 PE=3 SV=3 1 558 0.0E+00
sp|Q5EFZ4|VAC8_PICPA Vacuolar protein 8 OS=Komagataella pastoris GN=VAC8 PE=3 SV=3 1 584 0.0E+00
sp|P39968|VAC8_YEAST Vacuolar protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAC8 PE=1 SV=3 1 557 0.0E+00
sp|Q757R0|VAC8_ASHGO Vacuolar protein 8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VAC8 PE=3 SV=3 1 557 0.0E+00
sp|Q6FJV1|VAC8_CANGA Vacuolar protein 8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=VAC8 PE=3 SV=3 1 562 0.0E+00
sp|Q6CX49|VAC8_KLULA Vacuolar protein 8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=VAC8 PE=3 SV=3 1 576 0.0E+00
sp|B7U179|ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis thaliana GN=ABAP1 PE=1 SV=1 112 337 5.0E-19
sp|B9DHT4|ARIA_ARATH ARM REPEAT PROTEIN INTERACTING WITH ABF2 OS=Arabidopsis thaliana GN=ARIA PE=1 SV=2 138 422 1.0E-18
sp|Q9C9A6|PUB10_ARATH U-box domain-containing protein 10 OS=Arabidopsis thaliana GN=PUB10 PE=2 SV=1 123 342 3.0E-18
sp|Q5XEZ8|PUB2_ARATH U-box domain-containing protein 2 OS=Arabidopsis thaliana GN=PUB2 PE=2 SV=1 134 384 9.0E-18
sp|Q8GUG9|PUB11_ARATH U-box domain-containing protein 11 OS=Arabidopsis thaliana GN=PUB11 PE=2 SV=2 123 343 1.0E-17
sp|O22193|PUB4_ARATH U-box domain-containing protein 4 OS=Arabidopsis thaliana GN=PUB4 PE=1 SV=3 133 347 7.0E-16
sp|B7U179|ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis thaliana GN=ABAP1 PE=1 SV=1 103 344 1.0E-15
sp|Q5XEZ8|PUB2_ARATH U-box domain-containing protein 2 OS=Arabidopsis thaliana GN=PUB2 PE=2 SV=1 133 343 5.0E-15
sp|Q5VRH9|PUB12_ORYSJ U-box domain-containing protein 12 OS=Oryza sativa subsp. japonica GN=PUB12 PE=2 SV=1 123 343 2.0E-14
sp|Q5T2S8|ARMC4_HUMAN Armadillo repeat-containing protein 4 OS=Homo sapiens GN=ARMC4 PE=1 SV=1 123 498 6.0E-14
sp|B2RY50|ARMC4_MOUSE Armadillo repeat-containing protein 4 OS=Mus musculus GN=Armc4 PE=1 SV=1 123 498 9.0E-14
sp|Q8GWV5|PUB3_ARATH U-box domain-containing protein 3 OS=Arabidopsis thaliana GN=PUB3 PE=2 SV=2 134 338 3.0E-13
sp|B7U179|ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis thaliana GN=ABAP1 PE=1 SV=1 141 492 2.0E-12
sp|Q9ZV31|PUB12_ARATH U-box domain-containing protein 12 OS=Arabidopsis thaliana GN=PUB12 PE=2 SV=1 129 338 2.0E-12
sp|Q5W041|ARMC3_HUMAN Armadillo repeat-containing protein 3 OS=Homo sapiens GN=ARMC3 PE=2 SV=2 115 421 3.0E-12
sp|Q0IMG9|SL11_ORYSJ E3 ubiquitin-protein ligase SPL11 OS=Oryza sativa subsp. japonica GN=SPL11 PE=1 SV=2 123 303 8.0E-12
sp|A2ZLU6|SL11_ORYSI Protein spotted leaf 11 OS=Oryza sativa subsp. indica GN=SPL11 PE=1 SV=2 123 303 8.0E-12
sp|P35224|CTNB_URECA Catenin beta OS=Urechis caupo PE=2 SV=1 127 406 8.0E-12
sp|Q8GWV5|PUB3_ARATH U-box domain-containing protein 3 OS=Arabidopsis thaliana GN=PUB3 PE=2 SV=2 127 343 9.0E-12
sp|Q9SNC6|PUB13_ARATH U-box domain-containing protein 13 OS=Arabidopsis thaliana GN=PUB13 PE=1 SV=1 171 389 9.0E-12
sp|B7U179|ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis thaliana GN=ABAP1 PE=1 SV=1 220 536 2.0E-11
sp|B9DHT4|ARIA_ARATH ARM REPEAT PROTEIN INTERACTING WITH ABF2 OS=Arabidopsis thaliana GN=ARIA PE=1 SV=2 220 485 2.0E-11
sp|P30998|PLAK_XENLA Junction plakoglobin OS=Xenopus laevis GN=jup PE=2 SV=1 125 396 2.0E-11
sp|Q681N2|PUB15_ARATH U-box domain-containing protein 15 OS=Arabidopsis thaliana GN=PUB15 PE=2 SV=2 239 377 4.0E-11
sp|B9DHT4|ARIA_ARATH ARM REPEAT PROTEIN INTERACTING WITH ABF2 OS=Arabidopsis thaliana GN=ARIA PE=1 SV=2 103 332 7.0E-11
sp|Q02821|IMA1_YEAST Importin subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRP1 PE=1 SV=1 115 396 9.0E-11
sp|Q9SNC6|PUB13_ARATH U-box domain-containing protein 13 OS=Arabidopsis thaliana GN=PUB13 PE=1 SV=1 129 340 1.0E-10
sp|Q9FZ06|ARK3_ARATH Armadillo repeat-containing kinesin-like protein 3 OS=Arabidopsis thaliana GN=ARK3 PE=1 SV=1 115 340 1.0E-10
sp|P52293|IMA1_MOUSE Importin subunit alpha-1 OS=Mus musculus GN=Kpna2 PE=1 SV=2 171 486 2.0E-10
sp|Q9FJP6|PUB38_ARATH U-box domain-containing protein 38 OS=Arabidopsis thaliana GN=PUB38 PE=1 SV=1 141 259 2.0E-10
sp|Q5RBV0|IMA7_PONAB Importin subunit alpha-7 OS=Pongo abelii GN=KPNA6 PE=2 SV=1 52 382 3.0E-10
sp|O60684|IMA7_HUMAN Importin subunit alpha-7 OS=Homo sapiens GN=KPNA6 PE=1 SV=1 52 382 3.0E-10
sp|Q17GS9|ARM_AEDAE Armadillo segment polarity protein OS=Aedes aegypti GN=arm PE=3 SV=1 171 411 3.0E-10
sp|P52292|IMA1_HUMAN Importin subunit alpha-1 OS=Homo sapiens GN=KPNA2 PE=1 SV=1 171 486 3.0E-10
sp|O94374|IMA2_SCHPO Importin subunit alpha-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp1 PE=1 SV=1 171 441 3.0E-10
sp|Q7QHW5|ARM_ANOGA Armadillo segment polarity protein OS=Anopheles gambiae GN=arm PE=3 SV=5 171 411 3.0E-10
sp|Q9FWY7|IMPA6_ARATH Importin subunit alpha-6 OS=Arabidopsis thaliana GN=IMPA6 PE=2 SV=1 109 413 5.0E-10
sp|Q9FJ09|IMPA5_ARATH Importin subunit alpha-5 OS=Arabidopsis thaliana GN=IMPA5 PE=2 SV=1 109 409 7.0E-10
sp|Q9C9A6|PUB10_ARATH U-box domain-containing protein 10 OS=Arabidopsis thaliana GN=PUB10 PE=2 SV=1 129 340 8.0E-10
sp|Q29I35|ARM_DROPS Armadillo segment polarity protein OS=Drosophila pseudoobscura pseudoobscura GN=arm PE=3 SV=2 171 418 9.0E-10
sp|P18824|ARM_DROME Armadillo segment polarity protein OS=Drosophila melanogaster GN=arm PE=1 SV=1 171 418 1.0E-09
sp|Q9STT1|PUB39_ARATH U-box domain-containing protein 39 OS=Arabidopsis thaliana GN=PUB39 PE=2 SV=1 141 259 1.0E-09
sp|Q9ZV31|PUB12_ARATH U-box domain-containing protein 12 OS=Arabidopsis thaliana GN=PUB12 PE=2 SV=1 171 389 2.0E-09
sp|P30998|PLAK_XENLA Junction plakoglobin OS=Xenopus laevis GN=jup PE=2 SV=1 215 426 2.0E-09
sp|O94374|IMA2_SCHPO Importin subunit alpha-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp1 PE=1 SV=1 54 414 2.0E-09
sp|Q0WUF6|PUB41_ARATH U-box domain-containing protein 41 OS=Arabidopsis thaliana GN=PUB41 PE=2 SV=1 141 261 2.0E-09
sp|Q6P0K8|PLAK_RAT Junction plakoglobin OS=Rattus norvegicus GN=Jup PE=1 SV=1 125 382 2.0E-09
sp|P35223|CTNB_TRIGR Catenin beta OS=Tripneustes gratilla PE=2 SV=1 215 402 2.0E-09
sp|Q8WNW3|PLAK_PIG Junction plakoglobin OS=Sus scrofa GN=Jup PE=2 SV=1 125 382 2.0E-09
sp|Q29I35|ARM_DROPS Armadillo segment polarity protein OS=Drosophila pseudoobscura pseudoobscura GN=arm PE=3 SV=2 127 382 3.0E-09
sp|P18824|ARM_DROME Armadillo segment polarity protein OS=Drosophila melanogaster GN=arm PE=1 SV=1 127 382 3.0E-09
sp|P14923|PLAK_HUMAN Junction plakoglobin OS=Homo sapiens GN=JUP PE=1 SV=3 215 411 3.0E-09
sp|P14923|PLAK_HUMAN Junction plakoglobin OS=Homo sapiens GN=JUP PE=1 SV=3 125 382 3.0E-09
sp|A2RT91|ANKAR_MOUSE Ankyrin and armadillo repeat-containing protein OS=Mus musculus GN=Ankar PE=2 SV=1 237 487 3.0E-09
sp|O22161|ADLO1_ARATH Protein ARABIDILLO 1 OS=Arabidopsis thaliana GN=FBX5 PE=1 SV=1 127 259 3.0E-09
sp|Q8SPJ1|PLAK_BOVIN Junction plakoglobin OS=Bos taurus GN=JUP PE=2 SV=1 215 411 3.0E-09
sp|Q9SNC6|PUB13_ARATH U-box domain-containing protein 13 OS=Arabidopsis thaliana GN=PUB13 PE=1 SV=1 125 384 4.0E-09
sp|Q6P0K8|PLAK_RAT Junction plakoglobin OS=Rattus norvegicus GN=Jup PE=1 SV=1 215 411 4.0E-09
sp|Q8WNW3|PLAK_PIG Junction plakoglobin OS=Sus scrofa GN=Jup PE=2 SV=1 215 411 4.0E-09
sp|Q8SPJ1|PLAK_BOVIN Junction plakoglobin OS=Bos taurus GN=JUP PE=2 SV=1 125 382 4.0E-09
sp|Q02257|PLAK_MOUSE Junction plakoglobin OS=Mus musculus GN=Jup PE=1 SV=3 215 411 4.0E-09
sp|Q02453|ARM_MUSDO Armadillo segment polarity protein OS=Musca domestica GN=arm PE=2 SV=1 127 382 4.0E-09
sp|Q5T2S8|ARMC4_HUMAN Armadillo repeat-containing protein 4 OS=Homo sapiens GN=ARMC4 PE=1 SV=1 127 289 5.0E-09
sp|Q02257|PLAK_MOUSE Junction plakoglobin OS=Mus musculus GN=Jup PE=1 SV=3 125 382 5.0E-09
sp|Q02453|ARM_MUSDO Armadillo segment polarity protein OS=Musca domestica GN=arm PE=2 SV=1 171 418 5.0E-09
sp|C6K7I2|IMA8_PIG Importin subunit alpha-8 OS=Sus scrofa GN=KPNA7 PE=2 SV=2 122 390 5.0E-09
sp|C0LLJ0|IMA8_MOUSE Importin subunit alpha-8 OS=Mus musculus GN=Kpna7 PE=1 SV=1 122 388 5.0E-09
sp|A9QM74|IMA8_HUMAN Importin subunit alpha-8 OS=Homo sapiens GN=KPNA7 PE=1 SV=1 122 386 5.0E-09
sp|Q71VM4|IMA1A_ORYSJ Importin subunit alpha-1a OS=Oryza sativa subsp. japonica GN=Os01g0253300 PE=1 SV=2 109 425 6.0E-09
sp|Q681N2|PUB15_ARATH U-box domain-containing protein 15 OS=Arabidopsis thaliana GN=PUB15 PE=2 SV=2 118 282 7.0E-09
sp|F4JL11|IMPA2_ARATH Importin subunit alpha-2 OS=Arabidopsis thaliana GN=IMPA2 PE=1 SV=1 109 429 8.0E-09
sp|B2RY50|ARMC4_MOUSE Armadillo repeat-containing protein 4 OS=Mus musculus GN=Armc4 PE=1 SV=1 127 289 9.0E-09
sp|A2AU72|ARMC3_MOUSE Armadillo repeat-containing protein 3 OS=Mus musculus GN=Armc3 PE=1 SV=1 197 420 1.0E-08
sp|Q54I71|AARA_DICDI Protein aardvark OS=Dictyostelium discoideum GN=aarA PE=2 SV=1 137 288 1.0E-08
sp|Q9M224|ADLO2_ARATH Protein ARABIDILLO 2 OS=Arabidopsis thaliana GN=At3g60350 PE=2 SV=1 127 259 1.0E-08
sp|C1JZ66|IMA8_BOVIN Importin subunit alpha-8 OS=Bos taurus GN=KPNA7 PE=1 SV=2 127 390 1.0E-08
sp|P35224|CTNB_URECA Catenin beta OS=Urechis caupo PE=2 SV=1 215 427 2.0E-08
sp|Q0WUF6|PUB41_ARATH U-box domain-containing protein 41 OS=Arabidopsis thaliana GN=PUB41 PE=2 SV=1 195 428 2.0E-08
sp|Q02453|ARM_MUSDO Armadillo segment polarity protein OS=Musca domestica GN=arm PE=2 SV=1 136 401 2.0E-08
sp|P26233|CTNB_XENLA Catenin beta OS=Xenopus laevis GN=ctnnb1 PE=1 SV=1 170 411 2.0E-08
sp|A2AU72|ARMC3_MOUSE Armadillo repeat-containing protein 3 OS=Mus musculus GN=Armc3 PE=1 SV=1 115 358 3.0E-08
sp|P26233|CTNB_XENLA Catenin beta OS=Xenopus laevis GN=ctnnb1 PE=1 SV=1 155 382 3.0E-08
sp|Q9WU82|CTNB1_RAT Catenin beta-1 OS=Rattus norvegicus GN=Ctnnb1 PE=1 SV=1 170 411 3.0E-08
sp|Q02248|CTNB1_MOUSE Catenin beta-1 OS=Mus musculus GN=Ctnnb1 PE=1 SV=1 170 426 3.0E-08
sp|B6V8E6|CTNB1_CANLF Catenin beta-1 OS=Canis lupus familiaris GN=CTNNB1 PE=1 SV=1 170 426 3.0E-08
sp|Q0VCX4|CTNB1_BOVIN Catenin beta-1 OS=Bos taurus GN=CTNNB1 PE=1 SV=1 170 426 3.0E-08
sp|O44326|HMP2_CAEEL Beta-catenin-like protein hmp-2 OS=Caenorhabditis elegans GN=hmp-2 PE=1 SV=1 216 411 3.0E-08
sp|P35222|CTNB1_HUMAN Catenin beta-1 OS=Homo sapiens GN=CTNNB1 PE=1 SV=1 170 426 3.0E-08
sp|Q9WU82|CTNB1_RAT Catenin beta-1 OS=Rattus norvegicus GN=Ctnnb1 PE=1 SV=1 155 382 4.0E-08
sp|Q02248|CTNB1_MOUSE Catenin beta-1 OS=Mus musculus GN=Ctnnb1 PE=1 SV=1 155 382 4.0E-08
sp|B6V8E6|CTNB1_CANLF Catenin beta-1 OS=Canis lupus familiaris GN=CTNNB1 PE=1 SV=1 155 382 4.0E-08
sp|Q0VCX4|CTNB1_BOVIN Catenin beta-1 OS=Bos taurus GN=CTNNB1 PE=1 SV=1 155 382 4.0E-08
sp|P35222|CTNB1_HUMAN Catenin beta-1 OS=Homo sapiens GN=CTNNB1 PE=1 SV=1 155 382 4.0E-08
sp|Q5VQ09|ARK2_ORYSJ Armadillo repeat-containing kinesin-like protein 2 OS=Oryza sativa subsp. japonica GN=Os06g0137100 PE=2 SV=1 115 340 4.0E-08
sp|Q0DV28|ARK1_ORYSJ Armadillo repeat-containing kinesin-like protein 1 OS=Oryza sativa subsp. japonica GN=Os03g0152900 PE=2 SV=2 130 368 5.0E-08
sp|Q96321|IMPA1_ARATH Importin subunit alpha-1 OS=Arabidopsis thaliana GN=IMPA1 PE=1 SV=2 122 386 5.0E-08
sp|O04294|IMPA3_ARATH Importin subunit alpha-3 OS=Arabidopsis thaliana GN=IMPA3 PE=1 SV=2 168 486 6.0E-08
sp|Q9FL17|PUB40_ARATH U-box domain-containing protein 40 OS=Arabidopsis thaliana GN=PUB40 PE=2 SV=2 133 258 6.0E-08
sp|C6K7I2|IMA8_PIG Importin subunit alpha-8 OS=Sus scrofa GN=KPNA7 PE=2 SV=2 226 528 7.0E-08
sp|Q503E9|IMA6_DANRE Importin subunit alpha-6 OS=Danio rerio GN=kpna5 PE=2 SV=2 129 401 7.0E-08
sp|Q8VZ40|PUB14_ARATH U-box domain-containing protein 14 OS=Arabidopsis thaliana GN=PUB14 PE=1 SV=1 129 333 8.0E-08
sp|Q54I71|AARA_DICDI Protein aardvark OS=Dictyostelium discoideum GN=aarA PE=2 SV=1 141 334 2.0E-07
sp|Q9SV36|ARK1_ARATH Armadillo repeat-containing kinesin-like protein 1 OS=Arabidopsis thaliana GN=ARK1 PE=1 SV=2 127 340 2.0E-07
sp|Q02821|IMA1_YEAST Importin subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRP1 PE=1 SV=1 223 418 3.0E-07
sp|Q8VZ40|PUB14_ARATH U-box domain-containing protein 14 OS=Arabidopsis thaliana GN=PUB14 PE=1 SV=1 205 382 3.0E-07
sp|Q17GS9|ARM_AEDAE Armadillo segment polarity protein OS=Aedes aegypti GN=arm PE=3 SV=1 133 403 4.0E-07
sp|Q9FJ09|IMPA5_ARATH Importin subunit alpha-5 OS=Arabidopsis thaliana GN=IMPA5 PE=2 SV=1 244 465 4.0E-07
sp|Q0IMG9|SL11_ORYSJ E3 ubiquitin-protein ligase SPL11 OS=Oryza sativa subsp. japonica GN=SPL11 PE=1 SV=2 171 384 5.0E-07
sp|A2ZLU6|SL11_ORYSI Protein spotted leaf 11 OS=Oryza sativa subsp. indica GN=SPL11 PE=1 SV=2 171 384 5.0E-07
sp|Q17GS9|ARM_AEDAE Armadillo segment polarity protein OS=Aedes aegypti GN=arm PE=3 SV=1 127 382 5.0E-07
sp|Q7QHW5|ARM_ANOGA Armadillo segment polarity protein OS=Anopheles gambiae GN=arm PE=3 SV=5 127 382 5.0E-07
sp|P18824|ARM_DROME Armadillo segment polarity protein OS=Drosophila melanogaster GN=arm PE=1 SV=1 136 403 5.0E-07
sp|Q19969|IMA3_CAEEL Importin subunit alpha-3 OS=Caenorhabditis elegans GN=ima-3 PE=1 SV=2 216 528 5.0E-07
sp|Q9SLX0|IMA1B_ORYSJ Importin subunit alpha-1b OS=Oryza sativa subsp. japonica GN=Os05g0155500 PE=1 SV=2 164 463 5.0E-07
sp|O35345|IMA7_MOUSE Importin subunit alpha-7 OS=Mus musculus GN=Kpna6 PE=1 SV=2 129 401 6.0E-07
sp|Q9C9A6|PUB10_ARATH U-box domain-containing protein 10 OS=Arabidopsis thaliana GN=PUB10 PE=2 SV=1 218 418 7.0E-07
sp|A9QM74|IMA8_HUMAN Importin subunit alpha-8 OS=Homo sapiens GN=KPNA7 PE=1 SV=1 197 486 7.0E-07
sp|Q9FJ09|IMPA5_ARATH Importin subunit alpha-5 OS=Arabidopsis thaliana GN=IMPA5 PE=2 SV=1 203 441 8.0E-07
sp|O00505|IMA4_HUMAN Importin subunit alpha-4 OS=Homo sapiens GN=KPNA3 PE=1 SV=2 130 401 1.0E-06
sp|I3L5V6|SARM1_PIG Sterile alpha and TIR motif-containing protein 1 OS=Sus scrofa GN=SARM1 PE=2 SV=1 179 425 1.0E-06
sp|O22478|IMA_SOLLC Importin subunit alpha OS=Solanum lycopersicum PE=2 SV=2 164 486 1.0E-06
sp|Q5T2S8|ARMC4_HUMAN Armadillo repeat-containing protein 4 OS=Homo sapiens GN=ARMC4 PE=1 SV=1 127 386 2.0E-06
sp|B2RY50|ARMC4_MOUSE Armadillo repeat-containing protein 4 OS=Mus musculus GN=Armc4 PE=1 SV=1 127 386 2.0E-06
sp|Q7QHW5|ARM_ANOGA Armadillo segment polarity protein OS=Anopheles gambiae GN=arm PE=3 SV=5 133 403 2.0E-06
sp|Q9FWY7|IMPA6_ARATH Importin subunit alpha-6 OS=Arabidopsis thaliana GN=IMPA6 PE=2 SV=1 163 441 2.0E-06
sp|Q8VZ40|PUB14_ARATH U-box domain-containing protein 14 OS=Arabidopsis thaliana GN=PUB14 PE=1 SV=1 122 257 2.0E-06
sp|P91276|IMA2_CAEEL Importin subunit alpha-2 OS=Caenorhabditis elegans GN=ima-2 PE=1 SV=1 243 465 2.0E-06
sp|Q0V7M0|IMA7_BOVIN Importin subunit alpha-7 OS=Bos taurus GN=KPNA6 PE=2 SV=1 129 401 2.0E-06
sp|Q0V7M0|IMA7_BOVIN Importin subunit alpha-7 OS=Bos taurus GN=KPNA6 PE=2 SV=1 215 486 2.0E-06
sp|Q76P29|IMAB_DICDI Importin subunit alpha-B OS=Dictyostelium discoideum GN=DDB_G0272318 PE=3 SV=1 122 386 2.0E-06
sp|Q76P29|IMAB_DICDI Importin subunit alpha-B OS=Dictyostelium discoideum GN=DDB_G0272318 PE=3 SV=1 164 486 2.0E-06
sp|Q9LPC6|ARK2_ARATH Armadillo repeat-containing kinesin-like protein 2 OS=Arabidopsis thaliana GN=ARK2 PE=1 SV=2 127 340 2.0E-06
sp|O22193|PUB4_ARATH U-box domain-containing protein 4 OS=Arabidopsis thaliana GN=PUB4 PE=1 SV=3 205 491 3.0E-06
sp|Q5RBV0|IMA7_PONAB Importin subunit alpha-7 OS=Pongo abelii GN=KPNA6 PE=2 SV=1 129 401 3.0E-06
sp|O60684|IMA7_HUMAN Importin subunit alpha-7 OS=Homo sapiens GN=KPNA6 PE=1 SV=1 129 401 3.0E-06
sp|Q19969|IMA3_CAEEL Importin subunit alpha-3 OS=Caenorhabditis elegans GN=ima-3 PE=1 SV=2 130 391 3.0E-06
sp|O35344|IMA4_MOUSE Importin subunit alpha-4 OS=Mus musculus GN=Kpna3 PE=1 SV=1 130 401 3.0E-06
sp|Q6SZW1|SARM1_HUMAN Sterile alpha and TIR motif-containing protein 1 OS=Homo sapiens GN=SARM1 PE=1 SV=1 198 425 4.0E-06
sp|Q08DQ0|PKP3_BOVIN Plakophilin-3 OS=Bos taurus GN=PKP3 PE=2 SV=1 130 244 4.0E-06
sp|Q5XEZ8|PUB2_ARATH U-box domain-containing protein 2 OS=Arabidopsis thaliana GN=PUB2 PE=2 SV=1 293 531 6.0E-06
sp|Q04173|GDS1_BOVIN Rap1 GTPase-GDP dissociation stimulator 1 OS=Bos taurus GN=RAP1GDS1 PE=1 SV=1 122 401 6.0E-06
sp|Q9Y446|PKP3_HUMAN Plakophilin-3 OS=Homo sapiens GN=PKP3 PE=1 SV=1 130 244 6.0E-06
sp|A2RT91|ANKAR_MOUSE Ankyrin and armadillo repeat-containing protein OS=Mus musculus GN=Ankar PE=2 SV=1 167 382 7.0E-06
sp|Q9FL17|PUB40_ARATH U-box domain-containing protein 40 OS=Arabidopsis thaliana GN=PUB40 PE=2 SV=2 128 285 7.0E-06
sp|P26233|CTNB_XENLA Catenin beta OS=Xenopus laevis GN=ctnnb1 PE=1 SV=1 136 426 8.0E-06
sp|Q9QY23|PKP3_MOUSE Plakophilin-3 OS=Mus musculus GN=Pkp3 PE=1 SV=2 130 244 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3262
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1851
Ophiocordyceps australis map64 (Brazil) OphauB2|6851 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01638
Ophiocordyceps camponoti-rufipedis Ophun1|2819
Ophiocordyceps kimflemingae Ophio5|1805
Ophiocordyceps subramaniannii Hirsu2|5929

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6851
MGICHSSCCGGRSRDGLYEPILADSEREAVADLLQYLENRGETDFFSGEPLRALSTLVFSDNIDLQRSASLTFAE
ITERGTPSQRATARLTTLLHHSGPSPLAVGSLDLALHADPPVDVRQVDRDTLEPILFLLQSNDMEVQRAASAALG
NLAVNTENKVLIVQLGGLTPLIRQMMSQNVEVQCNAVGCITNLATHEDNKAKIARSGALGPLTRLAKSRDMRVQR
NATGALLNMTHSDENRQQLVNAGAMPVLVQLLASPDVDVQYYCTTALSNIAVDASNRRKLAATEPKLVQALVNLM
DSSSPKVQCQAALALRNLASDEKYQLDIVRSNGLHPLLRLLQSSYLPLILSAVACIRNISIHPMNESPIIEANFL
KPLVDLLGSTDNEEIQCHAISTLRNLAASSDRNKALVLDAGAVQKCKQLVLEVPVTVQSEMTAAIAVLALSDDLK
THLLNLGVCDVLIPLTCSPSIEVQGNSAAALGNLSSKVGDYSIFVRNWNEPNGGIHGYLGRFLQSGDATFQHIAV
WTLLQLFESEDRTLIGLIGKADDVVEQVRAIASRSVDEPNEEEDEGEVVNLAQRCLELVASVT*
Coding >OphauB2|6851
ATGGGAATCTGCCACTCGTCGTGCTGCGGAGGACGATCCCGCGATGGCCTCTATGAGCCCATCTTGGCCGACAGC
GAGCGGGAAGCTGTCGCCGACTTGTTGCAATACCTTGAAAACCGAGGCGAAACCGACTTCTTTTCCGGCGAGCCC
TTGCGCGCCTTGAGCACCTTGGTCTTCTCGGACAATATCGACCTTCAACGCAGTGCCAGTCTTACGTTTGCCGAA
ATCACTGAGCGAGGTACGCCGTCGCAGCGGGCCACCGCGCGGCTTACCACGCTGCTCCACCACTCTGGGCCAAGC
CCTCTGGCCGTCGGCTCCCTCGACCTGGCTCTCCATGCTGACCCGCCGGTAGATGTCCGCCAAGTCGACCGCGAT
ACCCTCGAGCCCATCTTGTTCCTGCTGCAGAGCAACGACATGGAGGTGCAGCGAGCTGCCAGTGCTGCCCTGGGC
AATCTAGCCGTCAATACCGAGAACAAGGTGCTCATTGTCCAGCTCGGCGGCCTCACCCCCTTGATTCGGCAAATG
ATGTCTCAAAATGTAGAGGTGCAATGCAATGCCGTTGGCTGCATCACCAATCTTGCCACCCACGAGGATAACAAG
GCCAAGATTGCCCGTTCTGGAGCGCTCGGCCCCTTGACGCGCTTGGCAAAGTCACGAGACATGCGCGTGCAACGC
AACGCCACTGGAGCCCTTTTGAACATGACGCACTCTGATGAGAACCGGCAGCAGCTTGTTAATGCCGGCGCCATG
CCCGTTCTTGTTCAGCTGCTCGCGTCGCCCGACGTGGATGTCCAGTATTACTGCACTACAGCCCTCAGCAACATT
GCTGTCGATGCCAGCAACCGCCGCAAGCTGGCCGCCACTGAGCCCAAGCTGGTGCAGGCCTTGGTCAATCTCATG
GACTCTTCATCCCCCAAGGTTCAGTGTCAGGCAGCACTGGCCCTGAGGAACCTAGCGTCCGACGAAAAGTACCAG
CTGGACATTGTGCGCTCTAATGGCCTTCATCCCTTGCTTCGTCTGCTTCAGTCGTCGTACCTGCCCCTCATCTTG
TCGGCCGTGGCGTGCATTCGCAACATTTCGATTCACCCCATGAACGAGTCCCCCATCATCGAAGCCAACTTTTTG
AAGCCCCTGGTTGACCTGCTGGGCTCAACAGACAATGAGGAGATTCAGTGCCATGCCATTTCCACCCTGCGAAAT
CTTGCCGCCAGCTCGGACCGCAACAAGGCGCTTGTTCTTGACGCTGGCGCCGTGCAAAAGTGCAAGCAGCTGGTG
CTTGAAGTGCCAGTGACGGTGCAGTCGGAAATGACGGCCGCCATTGCAGTGCTGGCGCTCAGCGACGACCTCAAG
ACACATTTGCTCAATTTGGGTGTCTGCGACGTGCTAATCCCTCTGACTTGCTCACCCAGTATTGAAGTCCAAGGC
AACAGCGCCGCCGCCCTGGGGAACCTGTCGTCCAAAGTGGGCGACTACTCCATTTTTGTGCGAAACTGGAACGAG
CCCAATGGAGGCATCCACGGCTACCTCGGCCGCTTTTTACAGTCTGGAGATGCCACCTTTCAGCACATTGCTGTG
TGGACGCTTTTGCAGCTCTTCGAGTCGGAAGACCGAACCTTGATTGGCCTCATTGGCAAAGCCGACGACGTTGTC
GAGCAGGTGCGGGCCATTGCCAGCCGTTCTGTTGACGAGCCCAACGAGGAAGAAGACGAGGGCGAGGTTGTAAAC
CTGGCGCAGCGGTGTTTGGAGCTGGTCGCGTCAGTCACATGA
Transcript >OphauB2|6851
ATGGGAATCTGCCACTCGTCGTGCTGCGGAGGACGATCCCGCGATGGCCTCTATGAGCCCATCTTGGCCGACAGC
GAGCGGGAAGCTGTCGCCGACTTGTTGCAATACCTTGAAAACCGAGGCGAAACCGACTTCTTTTCCGGCGAGCCC
TTGCGCGCCTTGAGCACCTTGGTCTTCTCGGACAATATCGACCTTCAACGCAGTGCCAGTCTTACGTTTGCCGAA
ATCACTGAGCGAGGTACGCCGTCGCAGCGGGCCACCGCGCGGCTTACCACGCTGCTCCACCACTCTGGGCCAAGC
CCTCTGGCCGTCGGCTCCCTCGACCTGGCTCTCCATGCTGACCCGCCGGTAGATGTCCGCCAAGTCGACCGCGAT
ACCCTCGAGCCCATCTTGTTCCTGCTGCAGAGCAACGACATGGAGGTGCAGCGAGCTGCCAGTGCTGCCCTGGGC
AATCTAGCCGTCAATACCGAGAACAAGGTGCTCATTGTCCAGCTCGGCGGCCTCACCCCCTTGATTCGGCAAATG
ATGTCTCAAAATGTAGAGGTGCAATGCAATGCCGTTGGCTGCATCACCAATCTTGCCACCCACGAGGATAACAAG
GCCAAGATTGCCCGTTCTGGAGCGCTCGGCCCCTTGACGCGCTTGGCAAAGTCACGAGACATGCGCGTGCAACGC
AACGCCACTGGAGCCCTTTTGAACATGACGCACTCTGATGAGAACCGGCAGCAGCTTGTTAATGCCGGCGCCATG
CCCGTTCTTGTTCAGCTGCTCGCGTCGCCCGACGTGGATGTCCAGTATTACTGCACTACAGCCCTCAGCAACATT
GCTGTCGATGCCAGCAACCGCCGCAAGCTGGCCGCCACTGAGCCCAAGCTGGTGCAGGCCTTGGTCAATCTCATG
GACTCTTCATCCCCCAAGGTTCAGTGTCAGGCAGCACTGGCCCTGAGGAACCTAGCGTCCGACGAAAAGTACCAG
CTGGACATTGTGCGCTCTAATGGCCTTCATCCCTTGCTTCGTCTGCTTCAGTCGTCGTACCTGCCCCTCATCTTG
TCGGCCGTGGCGTGCATTCGCAACATTTCGATTCACCCCATGAACGAGTCCCCCATCATCGAAGCCAACTTTTTG
AAGCCCCTGGTTGACCTGCTGGGCTCAACAGACAATGAGGAGATTCAGTGCCATGCCATTTCCACCCTGCGAAAT
CTTGCCGCCAGCTCGGACCGCAACAAGGCGCTTGTTCTTGACGCTGGCGCCGTGCAAAAGTGCAAGCAGCTGGTG
CTTGAAGTGCCAGTGACGGTGCAGTCGGAAATGACGGCCGCCATTGCAGTGCTGGCGCTCAGCGACGACCTCAAG
ACACATTTGCTCAATTTGGGTGTCTGCGACGTGCTAATCCCTCTGACTTGCTCACCCAGTATTGAAGTCCAAGGC
AACAGCGCCGCCGCCCTGGGGAACCTGTCGTCCAAAGTGGGCGACTACTCCATTTTTGTGCGAAACTGGAACGAG
CCCAATGGAGGCATCCACGGCTACCTCGGCCGCTTTTTACAGTCTGGAGATGCCACCTTTCAGCACATTGCTGTG
TGGACGCTTTTGCAGCTCTTCGAGTCGGAAGACCGAACCTTGATTGGCCTCATTGGCAAAGCCGACGACGTTGTC
GAGCAGGTGCGGGCCATTGCCAGCCGTTCTGTTGACGAGCCCAACGAGGAAGAAGACGAGGGCGAGGTTGTAAAC
CTGGCGCAGCGGTGTTTGGAGCTGGTCGCGTCAGTCACATGA
Gene >OphauB2|6851
ATGGGAATCTGCCACTCGTCGTGCTGCGGAGGTGAGCAACGTCTATTTTTTTCTTGTGCCCCCCCCCGCCTTTGG
CCGAGTCGCTGCTTTTGCTAACGGCTGTCCTTGTTGCTCCCCCCCCCCGGAATAGGACGATCCCGCGATGGCCTC
TATGAGCCCATCTTGGCCGACAGCGAGCGGGAAGCTGTCGCCGACTTGTTGCAATACCTTGAAAACGTGAGTGGT
GTAGCTCCAAGGCGCTTGCTCCAAGCTTGCTGACTGGCTGTTTGGTCTGGCGGCAGCGAGGCGAAACCGACTTCT
TTTCCGGCGAGCCCTTGCGCGCCTTGAGCACCTTGGTCTTCTCGGACAATATCGACCTTCAACGCAGTGCCAGTC
TTACGTTTGCCGAAATCACTGAGCGAGGTACGCCGTCGCAGCGGGCCACCGCGCGGCTTACCACGCTGCTCCACC
ACTCTGGGCCAAGCCCTCTGGCCGTCGGCTCCCTCGACCTGGCTCTCCATGCTGACCCGCCGGTAGATGTCCGCC
AAGTCGACCGCGATACCCTCGAGCCCATCTTGTTCCTGCTGCAGAGCAACGACATGGAGGTGCAGCGAGCTGCCA
GTGCTGCCCTGGGCAATCTAGCCGTCAATAGTGGGCCACGCCGCCCTGTCTTTCATTTTTACAGCTGCTGACTGT
CTGTTGCAGCCGAGAACAAGGTGCTCATTGTCCAGCTCGGCGGCCTCACCCCCTTGATTCGGCAAATGATGTCTC
AAAATGTAGAGGTGCAATGCAATGCCGTTGGCTGCATCACCAATCTTGCCACCCACGAGGATAACAAGGCCAAGA
TTGCCCGTTCTGGAGCGCTCGGCCCCTTGACGCGCTTGGCAAAGTCACGAGACATGCGCGTGCAACGCAACGCCA
CTGGAGCCCTTTTGAACATGACGCACTCTGGTAGTCCCGTCTCTTCTTGTCCCCATACCCACCTGCAGCTTGTTG
CCCTGCTGACACGCCTTTTTTGGGGGCAGATGAGAACCGGCAGCAGCTTGTTAATGCCGGCGCCATGCCCGTTCT
TGTTCAGCTGCTCGCGTCGCCCGACGTGGATGTCCAGTATTACTGCACTACAGCCCTCAGCAACATTGCTGTCGA
TGCCAGCAACCGCCGCAAGCTGGCCGCCACTGAGCCCAAGCTGGTGCAGGCCTTGGTCAATCTCATGGACTCTTC
ATCCCCCAAGGTTCAGTGTCAGGCAGCACTGGCCCTGAGGAACCTAGCGTCCGACGAAAAGTACCAGCTGGACAT
TGTGCGCTCTAATGGCCTTCATCCCTTGCTTCGTCTGCTTCAGTCGTCGTACCTGCCCCTCATCTTGTCGGCCGT
GGCGTGCATTCGCAACATTTCGATTCACCCCATGAACGAGTCCCCCATCATCGAAGCCAACTTTTTGAAGCCCCT
GGTTGACCTGCTGGGCTCAACAGACAATGAGGAGATTCAGTGCCATGCCATTTCCACCCTGCGAAATCTTGCCGC
CAGCTCGGACCGCAACAAGGCGCTTGTTCTTGACGCTGGCGCCGTGCAAAAGTGCAAGCAGCTGGTGCTTGAAGT
GCCAGTGACGGTGCAGTCGGAAATGACGGCCGCCATTGCAGTGCTGGCGCTCAGCGACGACCTCAAGACACATTT
GCTCAATTTGGGTGTCTGCGACGTGCTAATCCCTCTGACTTGCTCACCCAGTATTGAAGTCCAAGGCAACAGCGC
CGCCGCCCTGGGGAACCTGTCGTCCAAAGGTGGGCTCTCTTGCCAAAGTCGTTATCGTGGGCCAAGGGAGAGGAG
GGTAGACGGGGACAGACGAGCTGACTGGCGCAAACTAGTGGGCGACTACTCCATTTTTGTGCGAAACTGGAACGA
GCCCAATGGAGGCATCCACGGCTACCTCGGCCGCTTTTTACAGTCTGGAGATGCCACCTTTCAGCACATTGCTGT
GTGGACGCTTTTGCAGCTCTTCGAGTCGGAAGACCGAACCTTGATTGGCCTCATTGGCAAAGCCGACGACGTTGT
CGAGCAGGTGCGGGCCATTGCCAGCCGTTCTGTTGACGAGCCCAACGAGGAAGAAGACGAGGGCGAGGTTGTAAA
CCTGGCGCAGCGGTGTTTGGAGCTGGTCGGTCAGGATACGTCGAAGGCCCACATCGAGGGCTAGTCGCTGACACG
AGGTCAACAGCGTCAGTCACATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail