Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6850
Gene name
LocationContig_67:41249..42629
Strand-
Gene length (bp)1380
Transcript length (bp)1191
Coding sequence length (bp)1191
Protein length (aa) 397

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00571 CBS CBS domain 7.1E-06 194 245
PF00571 CBS CBS domain 2.8E-05 268 304
PF00571 CBS CBS domain 1.9E-09 341 389

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P12904|AAKG_YEAST 5'-AMP-activated protein kinase subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF4 PE=1 SV=1 84 390 1.0E-120
sp|Q9P869|SNF4_KLULA Nuclear protein SNF4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SNF4 PE=3 SV=2 74 390 3.0E-119
sp|Q10343|AAKG_SCHPO 5'-AMP-activated protein kinase subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cbs2 PE=1 SV=2 79 389 4.0E-114
sp|Q91WG5|AAKG2_MOUSE 5'-AMP-activated protein kinase subunit gamma-2 OS=Mus musculus GN=Prkag2 PE=1 SV=2 95 390 5.0E-54
sp|Q9UGJ0|AAKG2_HUMAN 5'-AMP-activated protein kinase subunit gamma-2 OS=Homo sapiens GN=PRKAG2 PE=1 SV=1 95 390 1.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P12904|AAKG_YEAST 5'-AMP-activated protein kinase subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF4 PE=1 SV=1 84 390 1.0E-120
sp|Q9P869|SNF4_KLULA Nuclear protein SNF4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SNF4 PE=3 SV=2 74 390 3.0E-119
sp|Q10343|AAKG_SCHPO 5'-AMP-activated protein kinase subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cbs2 PE=1 SV=2 79 389 4.0E-114
sp|Q91WG5|AAKG2_MOUSE 5'-AMP-activated protein kinase subunit gamma-2 OS=Mus musculus GN=Prkag2 PE=1 SV=2 95 390 5.0E-54
sp|Q9UGJ0|AAKG2_HUMAN 5'-AMP-activated protein kinase subunit gamma-2 OS=Homo sapiens GN=PRKAG2 PE=1 SV=1 95 390 1.0E-53
sp|Q8BGM7|AAKG3_MOUSE 5'-AMP-activated protein kinase subunit gamma-3 OS=Mus musculus GN=Prkag3 PE=1 SV=1 71 390 6.0E-53
sp|Q2LL38|AAKG3_BOVIN 5'-AMP-activated protein kinase subunit gamma-3 OS=Bos taurus GN=PRKAG3 PE=2 SV=2 71 390 7.0E-53
sp|Q5R4S0|AAKG2_PONAB 5'-AMP-activated protein kinase subunit gamma-2 OS=Pongo abelii GN=PRKAG2 PE=2 SV=1 95 390 1.0E-52
sp|P54619|AAKG1_HUMAN 5'-AMP-activated protein kinase subunit gamma-1 OS=Homo sapiens GN=PRKAG1 PE=1 SV=1 95 396 5.0E-52
sp|O54950|AAKG1_MOUSE 5'-AMP-activated protein kinase subunit gamma-1 OS=Mus musculus GN=Prkag1 PE=1 SV=2 95 396 5.0E-52
sp|P80385|AAKG1_RAT 5'-AMP-activated protein kinase subunit gamma-1 OS=Rattus norvegicus GN=Prkag1 PE=1 SV=3 95 396 6.0E-52
sp|Q09138|AAKG1_PIG 5'-AMP-activated protein kinase subunit gamma-1 OS=Sus scrofa GN=PRKAG1 PE=1 SV=2 95 392 8.0E-52
sp|P58108|AAKG1_BOVIN 5'-AMP-activated protein kinase subunit gamma-1 OS=Bos taurus GN=PRKAG1 PE=2 SV=2 95 392 8.0E-52
sp|Q9UGI9|AAKG3_HUMAN 5'-AMP-activated protein kinase subunit gamma-3 OS=Homo sapiens GN=PRKAG3 PE=1 SV=3 74 390 1.0E-50
sp|Q9MYP4|AAKG3_PIG 5'-AMP-activated protein kinase subunit gamma-3 OS=Sus scrofa GN=PRKAG3 PE=1 SV=2 82 390 1.0E-50
sp|Q8T277|PRKAG_DICDI 5'-AMP-activated protein kinase subunit gamma OS=Dictyostelium discoideum GN=prkag PE=3 SV=3 87 389 5.0E-42
sp|Q944A6|SNF4_ARATH Sucrose nonfermenting 4-like protein OS=Arabidopsis thaliana GN=SNF4 PE=1 SV=1 92 389 2.0E-25
sp|Q58622|Y1225_METJA Uncharacterized protein MJ1225 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1225 PE=1 SV=1 120 387 9.0E-07
sp|Q9ZL14|IMDH_HELPJ Inosine-5'-monophosphate dehydrogenase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=guaB PE=3 SV=1 274 388 4.0E-06
sp|P56088|IMDH_HELPY Inosine-5'-monophosphate dehydrogenase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=guaB PE=3 SV=1 274 388 4.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup904
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3082
Ophiocordyceps australis 1348a (Ghana) OphauG2|5250
Ophiocordyceps australis map64 (Brazil) OphauB2|6850 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01637
Ophiocordyceps camponoti-rufipedis Ophun1|2818
Ophiocordyceps kimflemingae Ophio5|1807
Ophiocordyceps subramaniannii Hirsu2|5928

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6850
MADSSSRVPPDSPAQANVDAVGPQAAQPGPALTPPSPACSSSPSSRHARLSRFVAPSSYLRYKTPPIMAAPVSSP
PPPSPLDKEQLHGLKCIREFLKVRTSYDVLPLSFRLIVLDTDLLIKKSLNILIQNTIVSAPLWDSASSRFAGILT
ATDYINVIQYYCQFPGEISKLEHFRLSSLRDIERAIGAIPIETVSVHPSRPLYEACRRMLKTRARRIPLVDLDDE
TGRETVISVITQYRILKFIAVNNEHNTVLLKKSVRDIGLGTYDNLATAHMNSSVLDAIHLMVERNISCIPVIDDG
GRLLNAFEAVDVIPVIKGGAYEDLDDTVGEALCRRPDDSPGIYTCGEGDRLDSIFDTIRKSRVHRLIVVDDDNRL
KGVISLADILKYVLLHGEDGR*
Coding >OphauB2|6850
ATGGCCGACAGCTCCTCCCGTGTGCCGCCCGATTCTCCCGCCCAGGCCAATGTCGATGCCGTCGGGCCCCAAGCG
GCACAGCCTGGCCCCGCGCTGACGCCGCCCTCGCCCGCCTGCTCCTCGTCGCCCTCTTCGCGCCACGCCCGTCTT
TCTCGCTTTGTTGCTCCCTCGTCGTATCTGCGCTACAAGACGCCGCCCATCATGGCCGCCCCGGTTTCCTCCCCG
CCGCCTCCCAGTCCTCTTGACAAGGAGCAGCTGCACGGCCTGAAATGCATCCGCGAGTTCCTCAAGGTCCGCACC
AGCTACGACGTCCTTCCCCTCTCCTTTCGCCTCATCGTCCTCGATACCGACTTGCTCATCAAAAAGAGCCTCAAT
ATCCTCATCCAAAACACCATTGTCTCGGCGCCGCTCTGGGACTCTGCTTCGTCGCGCTTTGCAGGCATCCTAACC
GCAACAGACTACATCAATGTCATACAGTACTATTGCCAGTTTCCAGGCGAGATTAGCAAGCTGGAGCACTTTCGC
CTCAGCAGCTTGCGAGACATTGAAAGAGCAATTGGCGCGATTCCAATCGAAACCGTTTCCGTCCATCCCTCCCGC
CCCCTCTACGAAGCCTGCCGCCGCATGCTCAAGACTCGTGCGCGCCGCATCCCCCTCGTCGACCTTGACGATGAG
ACTGGCCGCGAAACCGTCATTTCCGTAATCACCCAGTACCGCATCCTCAAGTTCATCGCCGTCAATAACGAACAC
AACACGGTCCTGCTCAAAAAGTCGGTCCGCGACATTGGCCTCGGCACCTATGACAACCTGGCCACGGCGCACATG
AACTCGTCGGTCCTAGACGCCATTCACCTCATGGTTGAGCGCAACATTAGCTGCATCCCCGTCATTGACGACGGA
GGCCGCCTGCTCAATGCCTTTGAGGCCGTCGACGTTATTCCCGTCATAAAGGGCGGCGCCTACGAGGATCTCGAT
GACACTGTCGGCGAGGCGCTTTGCCGTCGCCCCGACGACAGCCCAGGCATCTACACGTGCGGCGAGGGCGACAGG
CTCGACTCCATCTTTGACACGATTAGAAAAAGCCGTGTCCATCGCTTAATCGTGGTGGACGACGACAACCGGCTC
AAGGGCGTCATTTCCCTGGCGGATATTCTCAAATATGTGCTGCTGCACGGCGAGGACGGGCGGTGA
Transcript >OphauB2|6850
ATGGCCGACAGCTCCTCCCGTGTGCCGCCCGATTCTCCCGCCCAGGCCAATGTCGATGCCGTCGGGCCCCAAGCG
GCACAGCCTGGCCCCGCGCTGACGCCGCCCTCGCCCGCCTGCTCCTCGTCGCCCTCTTCGCGCCACGCCCGTCTT
TCTCGCTTTGTTGCTCCCTCGTCGTATCTGCGCTACAAGACGCCGCCCATCATGGCCGCCCCGGTTTCCTCCCCG
CCGCCTCCCAGTCCTCTTGACAAGGAGCAGCTGCACGGCCTGAAATGCATCCGCGAGTTCCTCAAGGTCCGCACC
AGCTACGACGTCCTTCCCCTCTCCTTTCGCCTCATCGTCCTCGATACCGACTTGCTCATCAAAAAGAGCCTCAAT
ATCCTCATCCAAAACACCATTGTCTCGGCGCCGCTCTGGGACTCTGCTTCGTCGCGCTTTGCAGGCATCCTAACC
GCAACAGACTACATCAATGTCATACAGTACTATTGCCAGTTTCCAGGCGAGATTAGCAAGCTGGAGCACTTTCGC
CTCAGCAGCTTGCGAGACATTGAAAGAGCAATTGGCGCGATTCCAATCGAAACCGTTTCCGTCCATCCCTCCCGC
CCCCTCTACGAAGCCTGCCGCCGCATGCTCAAGACTCGTGCGCGCCGCATCCCCCTCGTCGACCTTGACGATGAG
ACTGGCCGCGAAACCGTCATTTCCGTAATCACCCAGTACCGCATCCTCAAGTTCATCGCCGTCAATAACGAACAC
AACACGGTCCTGCTCAAAAAGTCGGTCCGCGACATTGGCCTCGGCACCTATGACAACCTGGCCACGGCGCACATG
AACTCGTCGGTCCTAGACGCCATTCACCTCATGGTTGAGCGCAACATTAGCTGCATCCCCGTCATTGACGACGGA
GGCCGCCTGCTCAATGCCTTTGAGGCCGTCGACGTTATTCCCGTCATAAAGGGCGGCGCCTACGAGGATCTCGAT
GACACTGTCGGCGAGGCGCTTTGCCGTCGCCCCGACGACAGCCCAGGCATCTACACGTGCGGCGAGGGCGACAGG
CTCGACTCCATCTTTGACACGATTAGAAAAAGCCGTGTCCATCGCTTAATCGTGGTGGACGACGACAACCGGCTC
AAGGGCGTCATTTCCCTGGCGGATATTCTCAAATATGTGCTGCTGCACGGCGAGGACGGGCGGTGA
Gene >OphauB2|6850
ATGGCCGACAGCTCCTCCCGTGTGCCGCCCGATTCTCCCGCCCAGGCCAATGTCGATGCCGTCGGGCCCCAAGCG
GCACAGCCTGGCCCCGCGCTGACGCCGCCCTCGCCCGCCTGCTCCTCGTCGCCCTCTTCGCGCCACGCCCGTCTT
TCTCGCTTTGTTGCTCCCTCGTCGTATCTGCGCTACAAGACGCCGCCCATCATGGCCGCCCCGGTTTCCTCCCCG
CCGCCTCCCAGTCCTCTTGACAAGGAGCAGCTGCACGGCCTGGTTGGTCCCTCTGGCACCCATTTTTTTCTTCCC
CCTAGTCTTGACGCTTCCAAAACTAACTACTGCAAGAAATGCATCCGCGAGTTCCTCAAGGTCCGCACCAGCTAC
GACGTCCTTCCCCTCTCCTTTCGCCTCATCGTCCTCGATACCGACTTGCTCATCAAAAAGAGCCTCAATATCCTC
ATCCAAAACAGTGCGCCCGTCGCCCCCCCAAAAAAGCCTGCGCTTACCCCCCTCCTTGCCACTAACCCTCTGCAG
CCATTGTCTCGGCGCCGCTCTGGGACTCTGCTTCGTCGCGCTTTGCAGGCATCCTAACCGCAACAGACTACATCA
ATGTCATACAGTACTATTGCCAGTTTCCAGGCGAGATTAGCAAGCTGGAGCACTTTCGCCTCAGCAGCTTGCGAG
GTAGCCTCGATTAATCTCTTGTCCCCCCCGCGCACTCGGACTGACTGGCCCCCAGACATTGAAAGAGCAATTGGC
GCGATTCCAATCGAAACCGTTTCCGTCCATCCCTCCCGCCCCCTCTACGAAGCCTGCCGCCGCATGCTCAAGACT
CGTGCGCGCCGCATCCCCCTCGTCGACCTTGACGATGAGACTGGCCGCGAAACCGTCATTTCCGTAATCACCCAG
TACCGCATCCTCAAGTTCATCGCCGTCAATAACGAACACAACACGGTCCTGCTCAAAAAGTCGGTCCGCGACATT
GGCCTCGGCACCTATGACAACCTGGCCACGGCGCACATGAACTCGTCGGTCCTAGACGCCATTCACCTCATGGTT
GAGCGCAACATTAGCTGCATCCCCGTCATTGACGACGGAGGCCGCCTGCTCAATGCCTTTGAGGCCGTCGACGTT
ATTCCCGTCATAAAGGGCGGCGCCTACGAGGATCTCGATGACACTGTCGGCGAGGCGCTTTGCCGTCGCCCCGAC
GACAGCCCAGGCATCTACACGTGCGGCGAGGGCGACAGGCTCGACTCCATCTTTGACACGATTAGAAAAAGCCGT
GTCCATCGCTTAATCGTGGTGGACGACGACAACCGGCTCAAGGGCGTCATTTCCCTGGCGGATATTCTCAAATAT
GTGCTGCTGCACGGCGAGGACGGGCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail