Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6843
Gene name
LocationContig_67:25228..26281
Strand-
Gene length (bp)1053
Transcript length (bp)972
Coding sequence length (bp)972
Protein length (aa) 324

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00573 Ribosomal_L4 Ribosomal protein L4/L1 family 1.5E-42 96 294

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P51998|RL4P_YEAST 54S ribosomal protein YmL6, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YML6 PE=1 SV=1 35 306 5.0E-32
sp|O74801|RL4P_SCHPO 54S ribosomal protein yml6, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yml6 PE=3 SV=1 73 248 3.0E-30
sp|Q6AP70|RL4_DESPS 50S ribosomal protein L4 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rplD PE=3 SV=1 113 221 2.0E-23
sp|A9BHA4|RL4_PETMO 50S ribosomal protein L4 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rplD PE=3 SV=1 101 243 2.0E-22
sp|Q3Z980|RL4_DEHM1 50S ribosomal protein L4 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rplD PE=3 SV=1 96 294 1.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P51998|RL4P_YEAST 54S ribosomal protein YmL6, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YML6 PE=1 SV=1 35 306 5.0E-32
sp|O74801|RL4P_SCHPO 54S ribosomal protein yml6, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yml6 PE=3 SV=1 73 248 3.0E-30
sp|Q6AP70|RL4_DESPS 50S ribosomal protein L4 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rplD PE=3 SV=1 113 221 2.0E-23
sp|A9BHA4|RL4_PETMO 50S ribosomal protein L4 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rplD PE=3 SV=1 101 243 2.0E-22
sp|Q3Z980|RL4_DEHM1 50S ribosomal protein L4 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rplD PE=3 SV=1 96 294 1.0E-21
sp|Q3ZZM3|RL4_DEHMC 50S ribosomal protein L4 OS=Dehalococcoides mccartyi (strain CBDB1) GN=rplD PE=3 SV=1 96 294 2.0E-21
sp|A5FRZ0|RL4_DEHMB 50S ribosomal protein L4 OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rplD PE=3 SV=1 96 294 2.0E-21
sp|A1WVC1|RL4_HALHL 50S ribosomal protein L4 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rplD PE=3 SV=1 90 294 2.0E-21
sp|P51313|RK4_PORPU 50S ribosomal protein L4, chloroplastic OS=Porphyra purpurea GN=rpl4 PE=3 SV=1 94 205 1.0E-20
sp|B9K887|RL4_THENN 50S ribosomal protein L4 OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rplD PE=3 SV=1 101 243 3.0E-20
sp|Q1XDH5|RK4_PYRYE 50S ribosomal protein L4, chloroplastic OS=Pyropia yezoensis GN=rpl4 PE=3 SV=1 102 219 3.0E-20
sp|Q3A6P6|RL4_PELCD 50S ribosomal protein L4 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rplD PE=3 SV=1 102 294 3.0E-20
sp|P61070|RL4_TREDE 50S ribosomal protein L4 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rplD PE=3 SV=1 96 198 4.0E-20
sp|B1I1I9|RL4_DESAP 50S ribosomal protein L4 OS=Desulforudis audaxviator (strain MP104C) GN=rplD PE=3 SV=1 97 291 6.0E-20
sp|B7K334|RL4_CYAP8 50S ribosomal protein L4 OS=Cyanothece sp. (strain PCC 8801) GN=rplD PE=3 SV=1 102 198 1.0E-19
sp|P73319|RL4_SYNY3 50S ribosomal protein L4 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rplD PE=3 SV=1 102 294 2.0E-19
sp|P61067|RL4_ONYPE 50S ribosomal protein L4 OS=Onion yellows phytoplasma (strain OY-M) GN=rplD PE=3 SV=1 100 198 3.0E-19
sp|B0C1D4|RL4_ACAM1 50S ribosomal protein L4 OS=Acaryochloris marina (strain MBIC 11017) GN=rplD PE=3 SV=1 102 209 5.0E-19
sp|A1BJ33|RL4_CHLPD 50S ribosomal protein L4 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rplD PE=3 SV=1 113 294 5.0E-19
sp|Q3A9R7|RL4_CARHZ 50S ribosomal protein L4 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rplD PE=3 SV=1 97 248 6.0E-19
sp|Q01W93|RL4_SOLUE 50S ribosomal protein L4 OS=Solibacter usitatus (strain Ellin6076) GN=rplD PE=3 SV=1 78 290 6.0E-19
sp|B3EUM2|RL4_AMOA5 50S ribosomal protein L4 OS=Amoebophilus asiaticus (strain 5a2) GN=rplD PE=3 SV=1 113 300 6.0E-19
sp|Q8DMN0|RL4_THEEB 50S ribosomal protein L4 OS=Thermosynechococcus elongatus (strain BP-1) GN=rplD PE=3 SV=1 102 213 7.0E-19
sp|C5BQ62|RL4_TERTT 50S ribosomal protein L4 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rplD PE=3 SV=1 98 294 8.0E-19
sp|B2ITQ4|RL4_NOSP7 50S ribosomal protein L4 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=rplD PE=3 SV=1 102 238 8.0E-19
sp|Q5X858|RL4_LEGPA 50S ribosomal protein L4 OS=Legionella pneumophila (strain Paris) GN=rplD PE=3 SV=1 102 299 1.0E-18
sp|Q8RIF6|RL4_FUSNN 50S ribosomal protein L4 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rplD PE=3 SV=1 102 201 1.0E-18
sp|Q5ZYP2|RL4_LEGPH 50S ribosomal protein L4 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rplD PE=3 SV=1 102 299 1.0E-18
sp|A5IHR3|RL4_LEGPC 50S ribosomal protein L4 OS=Legionella pneumophila (strain Corby) GN=rplD PE=3 SV=1 102 299 1.0E-18
sp|Q5WZL1|RL4_LEGPL 50S ribosomal protein L4 OS=Legionella pneumophila (strain Lens) GN=rplD PE=3 SV=1 102 299 1.0E-18
sp|Q3MFC0|RL4_ANAVT 50S ribosomal protein L4 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rplD PE=3 SV=1 102 187 1.0E-18
sp|B2S2D7|RL4_TREPS 50S ribosomal protein L4 OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rplD PE=3 SV=1 80 215 2.0E-18
sp|O83220|RL4_TREPA 50S ribosomal protein L4 OS=Treponema pallidum (strain Nichols) GN=rplD PE=3 SV=1 80 215 2.0E-18
sp|B8HMQ5|RL4_CYAP4 50S ribosomal protein L4 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=rplD PE=3 SV=1 102 205 2.0E-18
sp|Q9FA03|RL4_BRAPL 50S ribosomal protein L4 OS=Brachyspira pilosicoli GN=rplD PE=3 SV=1 98 218 3.0E-18
sp|C6C186|RL4_DESAD 50S ribosomal protein L4 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=rplD PE=3 SV=1 96 198 3.0E-18
sp|Q7MTL4|RL4_PORGI 50S ribosomal protein L4 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rplD PE=3 SV=1 113 205 3.0E-18
sp|C0QVZ7|RL4_BRAHW 50S ribosomal protein L4 OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=rplD PE=3 SV=1 98 218 3.0E-18
sp|Q2NIV5|RL4_AYWBP 50S ribosomal protein L4 OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=rplD PE=3 SV=1 99 198 3.0E-18
sp|A6GZ98|RL4_FLAPJ 50S ribosomal protein L4 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=rplD PE=3 SV=1 113 198 4.0E-18
sp|B1MW13|RL4_LEUCK 50S ribosomal protein L4 OS=Leuconostoc citreum (strain KM20) GN=rplD PE=3 SV=1 102 294 4.0E-18
sp|B1VAE7|RL4_PHYAS 50S ribosomal protein L4 OS=Phytoplasma australiense GN=rplD PE=3 SV=1 103 198 5.0E-18
sp|C0ZII1|RL4_BREBN 50S ribosomal protein L4 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rplD PE=3 SV=1 102 294 5.0E-18
sp|Q8YPI0|RL4_NOSS1 50S ribosomal protein L4 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rplD PE=3 SV=1 102 187 5.0E-18
sp|B3PK38|RL4_CELJU 50S ribosomal protein L4 OS=Cellvibrio japonicus (strain Ueda107) GN=rplD PE=3 SV=1 98 205 5.0E-18
sp|A8ZV58|RL4_DESOH 50S ribosomal protein L4 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=rplD PE=3 SV=1 115 292 5.0E-18
sp|O24690|RL4_SYNP6 50S ribosomal protein L4 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rplD PE=3 SV=1 102 201 5.0E-18
sp|Q31L08|RL4_SYNE7 50S ribosomal protein L4 OS=Synechococcus elongatus (strain PCC 7942) GN=rplD PE=3 SV=1 102 201 5.0E-18
sp|B7KHY8|RL4_CYAP7 50S ribosomal protein L4 OS=Cyanothece sp. (strain PCC 7424) GN=rplD PE=3 SV=1 102 187 5.0E-18
sp|Q1MPR2|RL4_LAWIP 50S ribosomal protein L4 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=rplD PE=3 SV=1 113 198 6.0E-18
sp|B2RLZ1|RL4_PORG3 50S ribosomal protein L4 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=rplD PE=3 SV=1 113 205 6.0E-18
sp|A6LEJ0|RL4_PARD8 50S ribosomal protein L4 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rplD PE=3 SV=1 113 198 6.0E-18
sp|A4SCR0|RL4_CHLPM 50S ribosomal protein L4 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=rplD PE=3 SV=1 113 294 6.0E-18
sp|B8FET4|RL4_DESAA 50S ribosomal protein L4 OS=Desulfatibacillum alkenivorans (strain AK-01) GN=rplD PE=3 SV=1 82 202 7.0E-18
sp|B6YQ84|RL4_AZOPC 50S ribosomal protein L4 OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=rplD PE=3 SV=1 113 205 8.0E-18
sp|B0JI02|RL4_MICAN 50S ribosomal protein L4 OS=Microcystis aeruginosa (strain NIES-843) GN=rplD PE=3 SV=1 100 184 8.0E-18
sp|C4KZP5|RL4_EXISA 50S ribosomal protein L4 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rplD PE=3 SV=1 102 294 9.0E-18
sp|C6DG73|RL4_PECCP 50S ribosomal protein L4 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rplD PE=3 SV=1 102 277 1.0E-17
sp|Q6CZX1|RL4_PECAS 50S ribosomal protein L4 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rplD PE=3 SV=1 102 277 1.0E-17
sp|B3EGY9|RL4_CHLL2 50S ribosomal protein L4 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=rplD PE=3 SV=1 113 294 1.0E-17
sp|C0Q9X2|RL4_DESAH 50S ribosomal protein L4 OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=rplD PE=3 SV=1 82 294 1.0E-17
sp|B6EPS6|RL4_ALISL 50S ribosomal protein L4 OS=Aliivibrio salmonicida (strain LFI1238) GN=rplD PE=3 SV=1 102 244 1.0E-17
sp|P44345|RL4_HAEIN 50S ribosomal protein L4 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rplD PE=3 SV=1 102 244 1.0E-17
sp|A5UHT1|RL4_HAEIG 50S ribosomal protein L4 OS=Haemophilus influenzae (strain PittGG) GN=rplD PE=3 SV=1 102 244 1.0E-17
sp|A5UDU6|RL4_HAEIE 50S ribosomal protein L4 OS=Haemophilus influenzae (strain PittEE) GN=rplD PE=3 SV=1 102 244 1.0E-17
sp|Q4QMC1|RL4_HAEI8 50S ribosomal protein L4 OS=Haemophilus influenzae (strain 86-028NP) GN=rplD PE=3 SV=1 102 244 1.0E-17
sp|A9BCP6|RL4_PROM4 50S ribosomal protein L4 OS=Prochlorococcus marinus (strain MIT 9211) GN=rplD PE=3 SV=1 101 205 1.0E-17
sp|Q034Y4|RL4_LACC3 50S ribosomal protein L4 OS=Lactobacillus casei (strain ATCC 334) GN=rplD PE=3 SV=1 101 294 1.0E-17
sp|Q110A8|RL4_TRIEI 50S ribosomal protein L4 OS=Trichodesmium erythraeum (strain IMS101) GN=rplD PE=3 SV=1 102 198 2.0E-17
sp|B1JIW2|RL4_YERPY 50S ribosomal protein L4 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rplD PE=3 SV=1 102 278 2.0E-17
sp|P60731|RL4_YERPS 50S ribosomal protein L4 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rplD PE=3 SV=1 102 278 2.0E-17
sp|A4TGZ3|RL4_YERPP 50S ribosomal protein L4 OS=Yersinia pestis (strain Pestoides F) GN=rplD PE=3 SV=1 102 278 2.0E-17
sp|Q1CCU5|RL4_YERPN 50S ribosomal protein L4 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rplD PE=3 SV=1 102 278 2.0E-17
sp|A9R8Z7|RL4_YERPG 50S ribosomal protein L4 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rplD PE=3 SV=1 102 278 2.0E-17
sp|P60730|RL4_YERPE 50S ribosomal protein L4 OS=Yersinia pestis GN=rplD PE=3 SV=1 102 278 2.0E-17
sp|B2K5M9|RL4_YERPB 50S ribosomal protein L4 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rplD PE=3 SV=1 102 278 2.0E-17
sp|Q1C2U8|RL4_YERPA 50S ribosomal protein L4 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rplD PE=3 SV=1 102 278 2.0E-17
sp|A7FNN4|RL4_YERP3 50S ribosomal protein L4 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rplD PE=3 SV=1 102 278 2.0E-17
sp|A1JS46|RL4_YERE8 50S ribosomal protein L4 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rplD PE=3 SV=1 102 278 2.0E-17
sp|Q67JU4|RL4_SYMTH 50S ribosomal protein L4 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rplD PE=3 SV=1 113 205 2.0E-17
sp|B3QZZ2|RL4_PHYMT 50S ribosomal protein L4 OS=Phytoplasma mali (strain AT) GN=rplD PE=3 SV=1 96 290 2.0E-17
sp|A8GKJ6|RL4_SERP5 50S ribosomal protein L4 OS=Serratia proteamaculans (strain 568) GN=rplD PE=3 SV=1 102 278 2.0E-17
sp|Q7NPG9|RL4_GLOVI 50S ribosomal protein L4 OS=Gloeobacter violaceus (strain PCC 7421) GN=rplD PE=3 SV=1 102 292 2.0E-17
sp|C6E4Q6|RL4_GEOSM 50S ribosomal protein L4 OS=Geobacter sp. (strain M21) GN=rplD PE=3 SV=1 98 197 2.0E-17
sp|B5EFQ1|RL4_GEOBB 50S ribosomal protein L4 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=rplD PE=3 SV=1 98 197 2.0E-17
sp|Q83PY4|RL4_SHIFL 50S ribosomal protein L4 OS=Shigella flexneri GN=rplD PE=3 SV=1 102 277 2.0E-17
sp|Q0SZY4|RL4_SHIF8 50S ribosomal protein L4 OS=Shigella flexneri serotype 5b (strain 8401) GN=rplD PE=3 SV=1 102 277 2.0E-17
sp|Q64NK9|RL4_BACFR 50S ribosomal protein L4 OS=Bacteroides fragilis (strain YCH46) GN=rplD PE=3 SV=1 113 220 2.0E-17
sp|Q5L8B0|RL4_BACFN 50S ribosomal protein L4 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=rplD PE=3 SV=1 113 220 2.0E-17
sp|Q11QB3|RL4_CYTH3 50S ribosomal protein L4 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=rplD PE=3 SV=1 114 296 3.0E-17
sp|A5FMY0|RL4_FLAJ1 50S ribosomal protein L4 OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=rplD PE=3 SV=1 113 211 3.0E-17
sp|C5BGM4|RL4_EDWI9 50S ribosomal protein L4 OS=Edwardsiella ictaluri (strain 93-146) GN=rplD PE=3 SV=1 102 244 3.0E-17
sp|A6VLI9|RL4_ACTSZ 50S ribosomal protein L4 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rplD PE=3 SV=1 102 244 3.0E-17
sp|Q4K534|RL4_PSEF5 50S ribosomal protein L4 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rplD PE=3 SV=1 102 198 4.0E-17
sp|Q8A477|RL4_BACTN 50S ribosomal protein L4 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rplD PE=3 SV=1 113 215 4.0E-17
sp|A0M597|RL4_GRAFK 50S ribosomal protein L4 OS=Gramella forsetii (strain KT0803) GN=rplD PE=3 SV=1 113 292 4.0E-17
sp|Q7MPI7|RL4_VIBVY 50S ribosomal protein L4 OS=Vibrio vulnificus (strain YJ016) GN=rplD PE=3 SV=1 102 244 4.0E-17
sp|Q8DE40|RL4_VIBVU 50S ribosomal protein L4 OS=Vibrio vulnificus (strain CMCP6) GN=rplD PE=3 SV=1 102 244 4.0E-17
sp|A5D5J1|RL4_PELTS 50S ribosomal protein L4 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rplD PE=3 SV=1 102 198 4.0E-17
sp|Q3YWU0|RL4_SHISS 50S ribosomal protein L4 OS=Shigella sonnei (strain Ss046) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|Q32B32|RL4_SHIDS 50S ribosomal protein L4 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|Q31VV7|RL4_SHIBS 50S ribosomal protein L4 OS=Shigella boydii serotype 4 (strain Sb227) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|B2U2T7|RL4_SHIB3 50S ribosomal protein L4 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|P60726|RL4_SALTY 50S ribosomal protein L4 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rplD PE=1 SV=1 102 277 4.0E-17
sp|P60727|RL4_SALTI 50S ribosomal protein L4 OS=Salmonella typhi GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|B4TXE1|RL4_SALSV 50S ribosomal protein L4 OS=Salmonella schwarzengrund (strain CVM19633) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|B5BGY5|RL4_SALPK 50S ribosomal protein L4 OS=Salmonella paratyphi A (strain AKU_12601) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|C0Q0B5|RL4_SALPC 50S ribosomal protein L4 OS=Salmonella paratyphi C (strain RKS4594) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|Q5PIV3|RL4_SALPA 50S ribosomal protein L4 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|B4SUT9|RL4_SALNS 50S ribosomal protein L4 OS=Salmonella newport (strain SL254) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|B4TKL4|RL4_SALHS 50S ribosomal protein L4 OS=Salmonella heidelberg (strain SL476) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|B5RH16|RL4_SALG2 50S ribosomal protein L4 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|B5R290|RL4_SALEP 50S ribosomal protein L4 OS=Salmonella enteritidis PT4 (strain P125109) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|B5FJL3|RL4_SALDC 50S ribosomal protein L4 OS=Salmonella dublin (strain CT_02021853) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|Q57J33|RL4_SALCH 50S ribosomal protein L4 OS=Salmonella choleraesuis (strain SC-B67) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|A9MN48|RL4_SALAR 50S ribosomal protein L4 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|B5F8F1|RL4_SALA4 50S ribosomal protein L4 OS=Salmonella agona (strain SL483) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|B7LRT5|RL4_ESCF3 50S ribosomal protein L4 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|Q1R604|RL4_ECOUT 50S ribosomal protein L4 OS=Escherichia coli (strain UTI89 / UPEC) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|B1LHD3|RL4_ECOSM 50S ribosomal protein L4 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|B6I233|RL4_ECOSE 50S ribosomal protein L4 OS=Escherichia coli (strain SE11) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|B7NDU0|RL4_ECOLU 50S ribosomal protein L4 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|P60723|RL4_ECOLI 50S ribosomal protein L4 OS=Escherichia coli (strain K12) GN=rplD PE=1 SV=1 102 277 4.0E-17
sp|B1IPY0|RL4_ECOLC 50S ribosomal protein L4 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|P60724|RL4_ECOL6 50S ribosomal protein L4 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|Q0TCE2|RL4_ECOL5 50S ribosomal protein L4 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|A1AGK6|RL4_ECOK1 50S ribosomal protein L4 OS=Escherichia coli O1:K1 / APEC GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|A8A5C4|RL4_ECOHS 50S ribosomal protein L4 OS=Escherichia coli O9:H4 (strain HS) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|B1X6H0|RL4_ECODH 50S ribosomal protein L4 OS=Escherichia coli (strain K12 / DH10B) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|C4ZUH4|RL4_ECOBW 50S ribosomal protein L4 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|B7M1N3|RL4_ECO8A 50S ribosomal protein L4 OS=Escherichia coli O8 (strain IAI1) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|B7N1A3|RL4_ECO81 50S ribosomal protein L4 OS=Escherichia coli O81 (strain ED1a) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|B7NLN8|RL4_ECO7I 50S ribosomal protein L4 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|B5YTP0|RL4_ECO5E 50S ribosomal protein L4 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|P60725|RL4_ECO57 50S ribosomal protein L4 OS=Escherichia coli O157:H7 GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|B7L4K8|RL4_ECO55 50S ribosomal protein L4 OS=Escherichia coli (strain 55989 / EAEC) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|B7MCT4|RL4_ECO45 50S ribosomal protein L4 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|B7UK43|RL4_ECO27 50S ribosomal protein L4 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|A7ZSK8|RL4_ECO24 50S ribosomal protein L4 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|A7MPH8|RL4_CROS8 50S ribosomal protein L4 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|A8AQL8|RL4_CITK8 50S ribosomal protein L4 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rplD PE=3 SV=1 102 277 4.0E-17
sp|Q2JIM6|RL4_SYNJB 50S ribosomal protein L4 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=rplD PE=3 SV=1 94 307 4.0E-17
sp|Q2NQM3|RL4_SODGM 50S ribosomal protein L4 OS=Sodalis glossinidius (strain morsitans) GN=rplD PE=3 SV=1 102 294 4.0E-17
sp|B4F1I5|RL4_PROMH 50S ribosomal protein L4 OS=Proteus mirabilis (strain HI4320) GN=rplD PE=3 SV=1 102 244 4.0E-17
sp|B0UX14|RL4_HISS2 50S ribosomal protein L4 OS=Histophilus somni (strain 2336) GN=rplD PE=3 SV=1 102 244 4.0E-17
sp|Q21M56|RL4_SACD2 50S ribosomal protein L4 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rplD PE=3 SV=1 98 213 5.0E-17
sp|Q0SN28|RL4_BORAP 50S ribosomal protein L4 OS=Borrelia afzelii (strain PKo) GN=rplD PE=3 SV=1 103 187 5.0E-17
sp|B3QY25|RL4_CHLT3 50S ribosomal protein L4 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=rplD PE=3 SV=1 113 294 5.0E-17
sp|B5FG10|RL4_VIBFM 50S ribosomal protein L4 OS=Vibrio fischeri (strain MJ11) GN=rplD PE=3 SV=1 102 244 6.0E-17
sp|Q5E8B4|RL4_VIBF1 50S ribosomal protein L4 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rplD PE=3 SV=1 102 244 6.0E-17
sp|B1YGV1|RL4_EXIS2 50S ribosomal protein L4 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rplD PE=3 SV=1 102 211 6.0E-17
sp|Q03ZP4|RL4_LEUMM 50S ribosomal protein L4 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rplD PE=3 SV=1 102 294 6.0E-17
sp|B7J244|RL4_BORBZ 50S ribosomal protein L4 OS=Borrelia burgdorferi (strain ZS7) GN=rplD PE=3 SV=1 103 187 7.0E-17
sp|A6TEX1|RL4_KLEP7 50S ribosomal protein L4 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rplD PE=3 SV=1 102 277 7.0E-17
sp|B5XN95|RL4_KLEP3 50S ribosomal protein L4 OS=Klebsiella pneumoniae (strain 342) GN=rplD PE=3 SV=1 102 277 7.0E-17
sp|P94268|RL4_BORBU 50S ribosomal protein L4 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rplD PE=3 SV=2 103 187 7.0E-17
sp|B1HMX9|RL4_LYSSC 50S ribosomal protein L4 OS=Lysinibacillus sphaericus (strain C3-41) GN=rplD PE=3 SV=1 102 294 7.0E-17
sp|Q65QV6|RL4_MANSM 50S ribosomal protein L4 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rplD PE=3 SV=1 102 244 7.0E-17
sp|O52333|RL4_MYCGA 50S ribosomal protein L4 OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=rplD PE=3 SV=1 94 295 8.0E-17
sp|A1TYJ8|RL4_MARHV 50S ribosomal protein L4 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rplD PE=3 SV=1 102 205 8.0E-17
sp|B2VK63|RL4_ERWT9 50S ribosomal protein L4 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rplD PE=3 SV=1 102 277 8.0E-17
sp|Q661E2|RL4_BORBP 50S ribosomal protein L4 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rplD PE=3 SV=1 103 187 9.0E-17
sp|Q87T12|RL4_VIBPA 50S ribosomal protein L4 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rplD PE=3 SV=1 102 244 9.0E-17
sp|B3QR77|RL4_CHLP8 50S ribosomal protein L4 OS=Chlorobaculum parvum (strain NCIB 8327) GN=rplD PE=3 SV=1 113 198 9.0E-17
sp|B2A4E0|RL4_NATTJ 50S ribosomal protein L4 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rplD PE=3 SV=1 98 291 1.0E-16
sp|B7VLF6|RL4_VIBTL 50S ribosomal protein L4 OS=Vibrio tasmaniensis (strain LGP32) GN=rplD PE=3 SV=1 102 244 1.0E-16
sp|Q3K5Y9|RL4_PSEPF 50S ribosomal protein L4 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rplD PE=3 SV=1 102 198 1.0E-16
sp|C3K2X5|RL4_PSEFS 50S ribosomal protein L4 OS=Pseudomonas fluorescens (strain SBW25) GN=rplD PE=3 SV=1 102 198 1.0E-16
sp|Q7UN19|RL4_RHOBA 50S ribosomal protein L4 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=rplD PE=3 SV=1 100 256 1.0E-16
sp|A7HM51|RL4_FERNB 50S ribosomal protein L4 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rplD PE=3 SV=1 101 198 1.0E-16
sp|Q2LQA0|RL4_SYNAS 50S ribosomal protein L4 OS=Syntrophus aciditrophicus (strain SB) GN=rplD PE=3 SV=1 102 224 1.0E-16
sp|B8IYH3|RL4_DESDA 50S ribosomal protein L4 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=rplD PE=3 SV=1 101 196 1.0E-16
sp|B1JDW3|RL4_PSEPW 50S ribosomal protein L4 OS=Pseudomonas putida (strain W619) GN=rplD PE=3 SV=1 102 198 1.0E-16
sp|Q88QN4|RL4_PSEPK 50S ribosomal protein L4 OS=Pseudomonas putida (strain KT2440) GN=rplD PE=3 SV=1 102 198 1.0E-16
sp|B0KK68|RL4_PSEPG 50S ribosomal protein L4 OS=Pseudomonas putida (strain GB-1) GN=rplD PE=3 SV=1 102 198 1.0E-16
sp|A5VXP8|RL4_PSEP1 50S ribosomal protein L4 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rplD PE=3 SV=1 102 198 1.0E-16
sp|Q6LVB5|RL4_PHOPR 50S ribosomal protein L4 OS=Photobacterium profundum GN=rplD PE=3 SV=1 102 277 1.0E-16
sp|B4S092|RL4_ALTMD 50S ribosomal protein L4 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=rplD1 PE=3 SV=1 102 201 1.0E-16
sp|C4Z2T1|RL4_EUBE2 50S ribosomal protein L4 OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=rplD PE=3 SV=1 96 294 1.0E-16
sp|B0BST2|RL4_ACTPJ 50S ribosomal protein L4 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rplD PE=3 SV=1 102 244 1.0E-16
sp|B3GZ12|RL4_ACTP7 50S ribosomal protein L4 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rplD PE=3 SV=1 102 244 1.0E-16
sp|A3N359|RL4_ACTP2 50S ribosomal protein L4 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rplD PE=3 SV=1 102 244 1.0E-16
sp|Q1IFW5|RL4_PSEE4 50S ribosomal protein L4 OS=Pseudomonas entomophila (strain L48) GN=rplD PE=3 SV=1 102 198 1.0E-16
sp|A9NED4|RL4_ACHLI 50S ribosomal protein L4 OS=Acholeplasma laidlawii (strain PG-8A) GN=rplD PE=3 SV=1 100 292 1.0E-16
sp|Q6KI54|RL4_MYCMO 50S ribosomal protein L4 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=rplD PE=3 SV=1 103 222 1.0E-16
sp|B2G8X7|RL4_LACRJ 50S ribosomal protein L4 OS=Lactobacillus reuteri (strain JCM 1112) GN=rplD PE=3 SV=1 101 294 1.0E-16
sp|A5VLK4|RL4_LACRD 50S ribosomal protein L4 OS=Lactobacillus reuteri (strain DSM 20016) GN=rplD PE=3 SV=1 101 294 1.0E-16
sp|A9KD30|RL4_COXBN 50S ribosomal protein L4 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rplD PE=3 SV=1 115 205 1.0E-16
sp|Q30Z43|RL4_DESAG 50S ribosomal protein L4 OS=Desulfovibrio alaskensis (strain G20) GN=rplD PE=3 SV=1 101 197 1.0E-16
sp|Q15YN8|RL4_PSEA6 50S ribosomal protein L4 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rplD PE=3 SV=1 102 197 1.0E-16
sp|Q0I162|RL4_HAES1 50S ribosomal protein L4 OS=Haemophilus somnus (strain 129Pt) GN=rplD PE=3 SV=1 102 244 2.0E-16
sp|A1VEB5|RL4_DESVV 50S ribosomal protein L4 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rplD PE=3 SV=1 98 222 2.0E-16
sp|Q72CH9|RL4_DESVH 50S ribosomal protein L4 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rplD PE=3 SV=1 98 222 2.0E-16
sp|Q3B6G0|RL4_CHLL7 50S ribosomal protein L4 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rplD PE=3 SV=1 113 294 2.0E-16
sp|A4WFC7|RL4_ENT38 50S ribosomal protein L4 OS=Enterobacter sp. (strain 638) GN=rplD PE=3 SV=1 102 277 2.0E-16
sp|A6KYJ4|RL4_BACV8 50S ribosomal protein L4 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rplD PE=3 SV=1 113 211 2.0E-16
sp|Q2JV82|RL4_SYNJA 50S ribosomal protein L4 OS=Synechococcus sp. (strain JA-3-3Ab) GN=rplD PE=3 SV=1 94 296 2.0E-16
sp|B8F756|RL4_HAEPS 50S ribosomal protein L4 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rplD PE=3 SV=1 102 244 2.0E-16
sp|B5RPI3|RL4_BORRA 50S ribosomal protein L4 OS=Borrelia recurrentis (strain A1) GN=rplD PE=3 SV=1 103 185 2.0E-16
sp|B5RM37|RL4_BORDL 50S ribosomal protein L4 OS=Borrelia duttonii (strain Ly) GN=rplD PE=3 SV=1 103 185 2.0E-16
sp|B6IRQ7|RL4_RHOCS 50S ribosomal protein L4 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rplD PE=3 SV=1 96 297 2.0E-16
sp|A4J112|RL4_DESRM 50S ribosomal protein L4 OS=Desulfotomaculum reducens (strain MI-1) GN=rplD PE=3 SV=1 102 211 2.0E-16
sp|B7V645|RL4_PSEA8 50S ribosomal protein L4 OS=Pseudomonas aeruginosa (strain LESB58) GN=rplD PE=3 SV=1 102 198 2.0E-16
sp|B3WAL6|RL4_LACCB 50S ribosomal protein L4 OS=Lactobacillus casei (strain BL23) GN=rplD PE=3 SV=1 101 294 2.0E-16
sp|Q1BDA6|RL4_MYCSS 50S ribosomal protein L4 OS=Mycobacterium sp. (strain MCS) GN=rplD PE=3 SV=1 102 205 2.0E-16
sp|A1UBN7|RL4_MYCSK 50S ribosomal protein L4 OS=Mycobacterium sp. (strain KMS) GN=rplD PE=3 SV=1 102 205 2.0E-16
sp|A3PVC2|RL4_MYCSJ 50S ribosomal protein L4 OS=Mycobacterium sp. (strain JLS) GN=rplD PE=3 SV=1 102 205 2.0E-16
sp|Q7MYF2|RL4_PHOLL 50S ribosomal protein L4 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rplD PE=3 SV=1 102 197 2.0E-16
sp|Q9HWD6|RL4_PSEAE 50S ribosomal protein L4 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rplD PE=3 SV=1 102 198 2.0E-16
sp|Q02T79|RL4_PSEAB 50S ribosomal protein L4 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rplD PE=3 SV=1 102 198 2.0E-16
sp|A6UZI9|RL4_PSEA7 50S ribosomal protein L4 OS=Pseudomonas aeruginosa (strain PA7) GN=rplD PE=3 SV=1 102 198 2.0E-16
sp|Q48D37|RL4_PSE14 50S ribosomal protein L4 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rplD PE=3 SV=1 102 198 2.0E-16
sp|Q4ZMP5|RL4_PSEU2 50S ribosomal protein L4 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rplD PE=3 SV=1 102 198 2.0E-16
sp|Q889X0|RL4_PSESM 50S ribosomal protein L4 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rplD PE=3 SV=1 102 198 2.0E-16
sp|Q89A69|RL4_BUCBP 50S ribosomal protein L4 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rplD PE=3 SV=1 102 244 2.0E-16
sp|A6W391|RL4_MARMS 50S ribosomal protein L4 OS=Marinomonas sp. (strain MWYL1) GN=rplD PE=3 SV=1 102 198 3.0E-16
sp|B3EP60|RL4_CHLPB 50S ribosomal protein L4 OS=Chlorobium phaeobacteroides (strain BS1) GN=rplD PE=3 SV=1 113 294 3.0E-16
sp|Q1AU30|RL4_RUBXD 50S ribosomal protein L4 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rplD PE=3 SV=1 102 300 3.0E-16
sp|P55836|RL4_AGGAC 50S ribosomal protein L4 OS=Aggregatibacter actinomycetemcomitans GN=rplD PE=3 SV=1 102 244 3.0E-16
sp|Q9CL33|RL4_PASMU 50S ribosomal protein L4 OS=Pasteurella multocida (strain Pm70) GN=rplD PE=3 SV=1 102 244 3.0E-16
sp|A0LIJ1|RL4_SYNFM 50S ribosomal protein L4 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rplD PE=3 SV=1 96 197 3.0E-16
sp|Q7UZU8|RL4_PROMP 50S ribosomal protein L4 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=rplD PE=3 SV=1 101 217 3.0E-16
sp|Q0AUI1|RL4_SYNWW 50S ribosomal protein L4 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rplD PE=3 SV=1 113 294 3.0E-16
sp|A8MLE1|RL4_ALKOO 50S ribosomal protein L4 OS=Alkaliphilus oremlandii (strain OhILAs) GN=rplD PE=3 SV=1 103 198 4.0E-16
sp|B8D0C5|RL4_HALOH 50S ribosomal protein L4 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=rplD PE=3 SV=1 102 291 4.0E-16
sp|C3LRQ7|RL4_VIBCM 50S ribosomal protein L4 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rplD PE=3 SV=1 102 198 4.0E-16
sp|Q9KNY5|RL4_VIBCH 50S ribosomal protein L4 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rplD PE=3 SV=1 102 198 4.0E-16
sp|A5F548|RL4_VIBC3 50S ribosomal protein L4 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rplD PE=3 SV=1 102 198 4.0E-16
sp|Q2S913|RL4_HAHCH 50S ribosomal protein L4 OS=Hahella chejuensis (strain KCTC 2396) GN=rplD PE=3 SV=1 102 198 4.0E-16
sp|Q2S3R3|RL4_SALRD 50S ribosomal protein L4 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rplD PE=3 SV=1 114 209 4.0E-16
sp|P49226|RL4_MORMO 50S ribosomal protein L4 OS=Morganella morganii GN=rplD PE=3 SV=1 102 197 4.0E-16
sp|Q2GED8|RL4_NEOSM 50S ribosomal protein L4 OS=Neorickettsia sennetsu (strain Miyayama) GN=rplD PE=3 SV=1 97 295 5.0E-16
sp|Q1R0H4|RL4_CHRSD 50S ribosomal protein L4 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rplD PE=3 SV=1 102 243 5.0E-16
sp|Q1QDI5|RL4_PSYCK 50S ribosomal protein L4 OS=Psychrobacter cryohalolentis (strain K5) GN=rplD PE=3 SV=1 102 286 5.0E-16
sp|Q7VKD3|RL4_HAEDU 50S ribosomal protein L4 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rplD PE=3 SV=1 102 244 5.0E-16
sp|Q65PA6|RL4_BACLD 50S ribosomal protein L4 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rplD PE=3 SV=1 102 243 5.0E-16
sp|P9WH85|RL4_MYCTU 50S ribosomal protein L4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rplD PE=1 SV=1 93 205 5.0E-16
sp|P9WH84|RL4_MYCTO 50S ribosomal protein L4 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rplD PE=3 SV=1 93 205 5.0E-16
sp|A5U088|RL4_MYCTA 50S ribosomal protein L4 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=rplD PE=3 SV=1 93 205 5.0E-16
sp|C1AL36|RL4_MYCBT 50S ribosomal protein L4 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=rplD PE=3 SV=1 93 205 5.0E-16
sp|A1KGI3|RL4_MYCBP 50S ribosomal protein L4 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=rplD PE=3 SV=1 93 205 5.0E-16
sp|P60728|RL4_MYCBO 50S ribosomal protein L4 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=rplD PE=3 SV=1 93 205 5.0E-16
sp|A9KJJ3|RL4_CLOPH 50S ribosomal protein L4 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rplD PE=3 SV=1 96 211 5.0E-16
sp|B5YG46|RL4_THEYD 50S ribosomal protein L4 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=rplD PE=3 SV=1 102 198 6.0E-16
sp|Q1LTD7|RL4_BAUCH 50S ribosomal protein L4 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rplD PE=3 SV=1 102 196 6.0E-16
sp|B8GV57|RL4_THISH 50S ribosomal protein L4 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=rplD PE=3 SV=1 90 197 6.0E-16
sp|P49665|RL4_THETH 50S ribosomal protein L4 OS=Thermus thermophilus GN=rplD PE=3 SV=2 102 197 7.0E-16
sp|Q0ID06|RL4_SYNS3 50S ribosomal protein L4 OS=Synechococcus sp. (strain CC9311) GN=rplD PE=3 SV=1 101 198 7.0E-16
sp|Q83ES3|RL4_COXBU 50S ribosomal protein L4 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rplD PE=3 SV=1 115 205 7.0E-16
sp|A9NAM5|RL4_COXBR 50S ribosomal protein L4 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rplD PE=3 SV=1 115 205 7.0E-16
sp|Q2RFP8|RL4_MOOTA 50S ribosomal protein L4 OS=Moorella thermoacetica (strain ATCC 39073) GN=rplD PE=3 SV=1 102 198 7.0E-16
sp|A6TWI1|RL4_ALKMQ 50S ribosomal protein L4 OS=Alkaliphilus metalliredigens (strain QYMF) GN=rplD PE=3 SV=1 92 211 7.0E-16
sp|B7IHU7|RL4_THEAB 50S ribosomal protein L4 OS=Thermosipho africanus (strain TCF52B) GN=rplD PE=3 SV=1 80 209 8.0E-16
sp|Q5SHN9|RL4_THET8 50S ribosomal protein L4 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rplD PE=1 SV=1 102 197 8.0E-16
sp|B8D848|RL4_BUCAT 50S ribosomal protein L4 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=rplD PE=3 SV=1 102 244 8.0E-16
sp|P57590|RL4_BUCAI 50S ribosomal protein L4 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rplD PE=3 SV=1 102 244 8.0E-16
sp|A4ST05|RL4_AERS4 50S ribosomal protein L4 OS=Aeromonas salmonicida (strain A449) GN=rplD PE=3 SV=1 102 244 9.0E-16
sp|A0KF22|RL4_AERHH 50S ribosomal protein L4 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rplD PE=3 SV=1 102 244 9.0E-16
sp|A7Z0N9|RL4_BACMF 50S ribosomal protein L4 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rplD PE=3 SV=1 102 239 9.0E-16
sp|Q0VSK2|RL4_ALCBS 50S ribosomal protein L4 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rplD PE=3 SV=1 102 277 9.0E-16
sp|Q72I05|RL4_THET2 50S ribosomal protein L4 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rplD PE=1 SV=1 102 197 9.0E-16
sp|Q493K7|RL4_BLOPB 50S ribosomal protein L4 OS=Blochmannia pennsylvanicus (strain BPEN) GN=rplD PE=3 SV=1 97 200 1.0E-15
sp|C4K7B7|RL4_HAMD5 50S ribosomal protein L4 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rplD PE=3 SV=1 102 197 1.0E-15
sp|Q7V541|RL4_PROMM 50S ribosomal protein L4 OS=Prochlorococcus marinus (strain MIT 9313) GN=rplD PE=3 SV=1 101 205 1.0E-15
sp|A2BYT5|RL4_PROM5 50S ribosomal protein L4 OS=Prochlorococcus marinus (strain MIT 9515) GN=rplD PE=3 SV=1 101 187 1.0E-15
sp|Q7V9W3|RL4_PROMA 50S ribosomal protein L4 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rplD PE=3 SV=1 101 205 1.0E-15
sp|Q5QXZ1|RL4_IDILO 50S ribosomal protein L4 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rplD PE=3 SV=1 102 278 1.0E-15
sp|Q4FUF5|RL4_PSYA2 50S ribosomal protein L4 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rplD PE=3 SV=1 102 294 1.0E-15
sp|O46895|RK4_GUITH 50S ribosomal protein L4, chloroplastic OS=Guillardia theta GN=rpl4 PE=3 SV=1 71 174 1.0E-15
sp|A7MWI4|RL4_VIBCB 50S ribosomal protein L4 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rplD PE=3 SV=1 102 244 1.0E-15
sp|A1REB5|RL4_SHESW 50S ribosomal protein L4 OS=Shewanella sp. (strain W3-18-1) GN=rplD PE=3 SV=1 102 244 1.0E-15
sp|A4YBY2|RL4_SHEPC 50S ribosomal protein L4 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rplD PE=3 SV=1 102 244 1.0E-15
sp|Q12SV8|RL4_SHEDO 50S ribosomal protein L4 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rplD PE=3 SV=1 102 244 1.0E-15
sp|A9KWA3|RL4_SHEB9 50S ribosomal protein L4 OS=Shewanella baltica (strain OS195) GN=rplD PE=3 SV=1 102 244 1.0E-15
sp|A6WHS9|RL4_SHEB8 50S ribosomal protein L4 OS=Shewanella baltica (strain OS185) GN=rplD PE=3 SV=1 102 244 1.0E-15
sp|A3DA71|RL4_SHEB5 50S ribosomal protein L4 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rplD PE=3 SV=1 102 244 1.0E-15
sp|B8EBK4|RL4_SHEB2 50S ribosomal protein L4 OS=Shewanella baltica (strain OS223) GN=rplD PE=3 SV=1 102 244 1.0E-15
sp|Q2RQW1|RL4_RHORT 50S ribosomal protein L4 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rplD PE=3 SV=1 96 200 2.0E-15
sp|C4L7T1|RL4_TOLAT 50S ribosomal protein L4 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rplD PE=3 SV=1 102 201 2.0E-15
sp|Q8KAH3|RL4_CHLTE 50S ribosomal protein L4 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=rplD PE=3 SV=1 113 207 2.0E-15
sp|Q3APH4|RL4_CHLCH 50S ribosomal protein L4 OS=Chlorobium chlorochromatii (strain CaD3) GN=rplD PE=3 SV=1 113 294 2.0E-15
sp|P10135|RL4_MYCCT 50S ribosomal protein L4 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=rplD PE=3 SV=2 103 205 2.0E-15
sp|A4IJJ0|RL4_GEOTN 50S ribosomal protein L4 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rplD PE=3 SV=1 100 205 2.0E-15
sp|B4S5M6|RL4_PROA2 50S ribosomal protein L4 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=rplD PE=3 SV=1 113 294 2.0E-15
sp|Q8R7V5|RL4_CALS4 50S ribosomal protein L4 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rplD PE=3 SV=1 96 220 2.0E-15
sp|C1DKL4|RL4_AZOVD 50S ribosomal protein L4 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rplD PE=3 SV=1 102 198 2.0E-15
sp|Q318I5|RL4_PROM9 50S ribosomal protein L4 OS=Prochlorococcus marinus (strain MIT 9312) GN=rplD PE=3 SV=1 101 187 2.0E-15
sp|A0PM64|RL4_MYCUA 50S ribosomal protein L4 OS=Mycobacterium ulcerans (strain Agy99) GN=rplD PE=3 SV=1 93 193 2.0E-15
sp|B2HSN2|RL4_MYCMM 50S ribosomal protein L4 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=rplD PE=3 SV=1 93 193 2.0E-15
sp|A2BTD6|RL4_PROMS 50S ribosomal protein L4 OS=Prochlorococcus marinus (strain AS9601) GN=rplD PE=3 SV=1 101 211 2.0E-15
sp|A4FPM4|RL4_SACEN 50S ribosomal protein L4 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=rplD PE=3 SV=1 102 197 2.0E-15
sp|A8G761|RL4_PROM2 50S ribosomal protein L4 OS=Prochlorococcus marinus (strain MIT 9215) GN=rplD PE=3 SV=1 101 187 2.0E-15
sp|A3PF46|RL4_PROM0 50S ribosomal protein L4 OS=Prochlorococcus marinus (strain MIT 9301) GN=rplD PE=3 SV=1 101 211 2.0E-15
sp|Q6F7R3|RL4_ACIAD 50S ribosomal protein L4 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rplD PE=3 SV=1 102 294 2.0E-15
sp|Q0I0A4|RL4_SHESR 50S ribosomal protein L4 OS=Shewanella sp. (strain MR-7) GN=rplD PE=3 SV=1 102 244 3.0E-15
sp|Q0HNT6|RL4_SHESM 50S ribosomal protein L4 OS=Shewanella sp. (strain MR-4) GN=rplD PE=3 SV=1 102 244 3.0E-15
sp|A2CC28|RL4_PROM3 50S ribosomal protein L4 OS=Prochlorococcus marinus (strain MIT 9303) GN=rplD PE=3 SV=1 101 205 3.0E-15
sp|B1LBN9|RL4_THESQ 50S ribosomal protein L4 OS=Thermotoga sp. (strain RQ2) GN=rplD PE=3 SV=1 101 198 3.0E-15
sp|A5IM84|RL4_THEP1 50S ribosomal protein L4 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rplD PE=3 SV=1 101 198 3.0E-15
sp|B0TC57|RL4_HELMI 50S ribosomal protein L4 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rplD PE=3 SV=1 102 205 3.0E-15
sp|B8D9U6|RL4_BUCA5 50S ribosomal protein L4 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=rplD PE=3 SV=1 102 244 3.0E-15
sp|A3Q983|RL4_SHELP 50S ribosomal protein L4 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rplD PE=3 SV=1 102 244 3.0E-15
sp|Q890P0|RL4_CLOTE 50S ribosomal protein L4 OS=Clostridium tetani (strain Massachusetts / E88) GN=rplD PE=3 SV=1 96 294 3.0E-15
sp|Q8D211|RL4_WIGBR 50S ribosomal protein L4 OS=Wigglesworthia glossinidia brevipalpis GN=rplD PE=3 SV=1 102 198 4.0E-15
sp|B7GJ68|RL4_ANOFW 50S ribosomal protein L4 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rplD PE=3 SV=1 100 205 4.0E-15
sp|C4ZBD5|RL4_EUBR3 50S ribosomal protein L4 OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=rplD PE=3 SV=1 96 198 4.0E-15
sp|A4VHN1|RL4_PSEU5 50S ribosomal protein L4 OS=Pseudomonas stutzeri (strain A1501) GN=rplD PE=3 SV=1 102 198 4.0E-15
sp|Q5WLR1|RL4_BACSK 50S ribosomal protein L4 OS=Bacillus clausii (strain KSM-K16) GN=rplD PE=3 SV=1 102 198 4.0E-15
sp|B0SSH6|RL4_LEPBP 50S ribosomal protein L4 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=rplD PE=3 SV=1 103 298 4.0E-15
sp|B0SAF3|RL4_LEPBA 50S ribosomal protein L4 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=rplD PE=3 SV=1 103 298 4.0E-15
sp|A8F986|RL4_BACP2 50S ribosomal protein L4 OS=Bacillus pumilus (strain SAFR-032) GN=rplD PE=3 SV=1 102 198 4.0E-15
sp|Q4A5C2|RL4_MYCS5 50S ribosomal protein L4 OS=Mycoplasma synoviae (strain 53) GN=rplD PE=3 SV=2 103 201 4.0E-15
sp|C4XLX4|RL4_DESMR 50S ribosomal protein L4 OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=rplD PE=3 SV=1 101 259 4.0E-15
sp|Q3AUW2|RL4_SYNS9 50S ribosomal protein L4 OS=Synechococcus sp. (strain CC9902) GN=rplD PE=3 SV=1 101 205 4.0E-15
sp|B9JVN8|RL4_AGRVS 50S ribosomal protein L4 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rplD PE=3 SV=1 99 197 4.0E-15
sp|P49546|RK4_ODOSI 50S ribosomal protein L4, chloroplastic OS=Odontella sinensis GN=rpl4 PE=3 SV=1 102 205 5.0E-15
sp|P28601|RL4_GEOSE 50S ribosomal protein L4 OS=Geobacillus stearothermophilus GN=rplD PE=1 SV=1 100 205 5.0E-15
sp|A0QL17|RL4_MYCA1 50S ribosomal protein L4 OS=Mycobacterium avium (strain 104) GN=rplD PE=3 SV=1 97 205 5.0E-15
sp|Q5L3Z6|RL4_GEOKA 50S ribosomal protein L4 OS=Geobacillus kaustophilus (strain HTA426) GN=rplD PE=3 SV=1 100 205 5.0E-15
sp|A7GK21|RL4_BACCN 50S ribosomal protein L4 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rplD PE=3 SV=1 102 243 5.0E-15
sp|P61066|RL4_MYCPA 50S ribosomal protein L4 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=rplD PE=3 SV=1 97 205 5.0E-15
sp|B0K5P4|RL4_THEPX 50S ribosomal protein L4 OS=Thermoanaerobacter sp. (strain X514) GN=rplD PE=3 SV=1 96 220 5.0E-15
sp|B0KCK1|RL4_THEP3 50S ribosomal protein L4 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rplD PE=3 SV=1 96 220 5.0E-15
sp|Q089Q3|RL4_SHEFN 50S ribosomal protein L4 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rplD PE=3 SV=1 102 244 5.0E-15
sp|B8DN97|RL4_DESVM 50S ribosomal protein L4 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rplD PE=3 SV=1 115 202 5.0E-15
sp|A0KRM5|RL4_SHESA 50S ribosomal protein L4 OS=Shewanella sp. (strain ANA-3) GN=rplD PE=3 SV=1 102 196 5.0E-15
sp|Q8EK67|RL4_SHEON 50S ribosomal protein L4 OS=Shewanella oneidensis (strain MR-1) GN=rplD PE=3 SV=1 102 196 5.0E-15
sp|Q46IR0|RL4_PROMT 50S ribosomal protein L4 OS=Prochlorococcus marinus (strain NATL2A) GN=rplD PE=3 SV=1 101 187 5.0E-15
sp|A2RNQ4|RL4_LACLM 50S ribosomal protein L4 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rplD PE=3 SV=1 102 205 5.0E-15
sp|O80361|RK4_TOBAC 50S ribosomal protein L4, chloroplastic OS=Nicotiana tabacum GN=RPL4 PE=2 SV=1 69 185 5.0E-15
sp|A0QSD2|RL4_MYCS2 50S ribosomal protein L4 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rplD PE=1 SV=1 102 205 6.0E-15
sp|C5D3R8|RL4_GEOSW 50S ribosomal protein L4 OS=Geobacillus sp. (strain WCH70) GN=rplD PE=3 SV=1 100 205 6.0E-15
sp|Q6F1Z3|RL4_MESFL 50S ribosomal protein L4 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rplD PE=3 SV=1 100 211 6.0E-15
sp|Q02W25|RL4_LACLS 50S ribosomal protein L4 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rplD PE=3 SV=1 102 205 6.0E-15
sp|Q9CDW3|RL4_LACLA 50S ribosomal protein L4 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rplD PE=3 SV=1 102 205 6.0E-15
sp|B0V6W9|RL4_ACIBY 50S ribosomal protein L4 OS=Acinetobacter baumannii (strain AYE) GN=rplD PE=3 SV=1 102 294 6.0E-15
sp|A3M982|RL4_ACIBT 50S ribosomal protein L4 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rplD PE=3 SV=1 102 294 6.0E-15
sp|B0VQR9|RL4_ACIBS 50S ribosomal protein L4 OS=Acinetobacter baumannii (strain SDF) GN=rplD PE=3 SV=1 102 294 6.0E-15
sp|B2HZM1|RL4_ACIBC 50S ribosomal protein L4 OS=Acinetobacter baumannii (strain ACICU) GN=rplD PE=3 SV=1 102 294 6.0E-15
sp|B7IA38|RL4_ACIB5 50S ribosomal protein L4 OS=Acinetobacter baumannii (strain AB0057) GN=rplD PE=3 SV=1 102 294 6.0E-15
sp|B7GW03|RL4_ACIB3 50S ribosomal protein L4 OS=Acinetobacter baumannii (strain AB307-0294) GN=rplD PE=3 SV=1 102 294 6.0E-15
sp|B1KMY2|RL4_SHEWM 50S ribosomal protein L4 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rplD PE=3 SV=1 102 196 7.0E-15
sp|A1T0E1|RL4_PSYIN 50S ribosomal protein L4 OS=Psychromonas ingrahamii (strain 37) GN=rplD PE=3 SV=1 102 244 7.0E-15
sp|Q3IF24|RL4_PSEHT 50S ribosomal protein L4 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rplD PE=3 SV=1 102 244 7.0E-15
sp|B0TM11|RL4_SHEHH 50S ribosomal protein L4 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rplD PE=3 SV=1 102 201 7.0E-15
sp|P61065|RL4_MYCMS 50S ribosomal protein L4 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=rplD PE=3 SV=1 103 205 7.0E-15
sp|Q6HPQ7|RL4_BACHK 50S ribosomal protein L4 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rplD PE=3 SV=1 102 198 7.0E-15
sp|Q63H89|RL4_BACCZ 50S ribosomal protein L4 OS=Bacillus cereus (strain ZK / E33L) GN=rplD PE=3 SV=1 102 198 7.0E-15
sp|Q81J41|RL4_BACCR 50S ribosomal protein L4 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rplD PE=3 SV=1 102 198 7.0E-15
sp|B9IZJ5|RL4_BACCQ 50S ribosomal protein L4 OS=Bacillus cereus (strain Q1) GN=rplD PE=3 SV=1 102 198 7.0E-15
sp|B7HQU5|RL4_BACC7 50S ribosomal protein L4 OS=Bacillus cereus (strain AH187) GN=rplD PE=3 SV=1 102 198 7.0E-15
sp|B7HJ49|RL4_BACC4 50S ribosomal protein L4 OS=Bacillus cereus (strain B4264) GN=rplD PE=3 SV=1 102 198 7.0E-15
sp|C1ET40|RL4_BACC3 50S ribosomal protein L4 OS=Bacillus cereus (strain 03BB102) GN=rplD PE=3 SV=1 102 198 7.0E-15
sp|B7IT20|RL4_BACC2 50S ribosomal protein L4 OS=Bacillus cereus (strain G9842) GN=rplD PE=3 SV=1 102 198 7.0E-15
sp|Q73F95|RL4_BACC1 50S ribosomal protein L4 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rplD PE=3 SV=1 102 198 7.0E-15
sp|B7JKC0|RL4_BACC0 50S ribosomal protein L4 OS=Bacillus cereus (strain AH820) GN=rplD PE=3 SV=1 102 198 7.0E-15
sp|Q81VS9|RL4_BACAN 50S ribosomal protein L4 OS=Bacillus anthracis GN=rplD PE=3 SV=1 102 198 7.0E-15
sp|A0R8I1|RL4_BACAH 50S ribosomal protein L4 OS=Bacillus thuringiensis (strain Al Hakam) GN=rplD PE=3 SV=1 102 198 7.0E-15
sp|C3LJ83|RL4_BACAC 50S ribosomal protein L4 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rplD PE=3 SV=1 102 198 7.0E-15
sp|C3P9Q6|RL4_BACAA 50S ribosomal protein L4 OS=Bacillus anthracis (strain A0248) GN=rplD PE=3 SV=1 102 198 7.0E-15
sp|A9VP78|RL4_BACWK 50S ribosomal protein L4 OS=Bacillus weihenstephanensis (strain KBAB4) GN=rplD PE=3 SV=1 102 198 8.0E-15
sp|Q47LJ4|RL4_THEFY 50S ribosomal protein L4 OS=Thermobifida fusca (strain YX) GN=rplD PE=3 SV=1 102 198 8.0E-15
sp|A8G1E7|RL4_SHESH 50S ribosomal protein L4 OS=Shewanella sediminis (strain HAW-EB3) GN=rplD PE=3 SV=1 102 196 8.0E-15
sp|Q6GEI4|RL4_STAAR 50S ribosomal protein L4 OS=Staphylococcus aureus (strain MRSA252) GN=rplD PE=3 SV=1 102 205 8.0E-15
sp|A5GIU4|RL4_SYNPW 50S ribosomal protein L4 OS=Synechococcus sp. (strain WH7803) GN=rplD PE=3 SV=1 101 187 8.0E-15
sp|Q9Z9L3|RL4_BACHD 50S ribosomal protein L4 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rplD PE=3 SV=1 101 196 9.0E-15
sp|B9DM18|RL4_STACT 50S ribosomal protein L4 OS=Staphylococcus carnosus (strain TM300) GN=rplD PE=3 SV=1 100 197 9.0E-15
sp|A8GYX7|RL4_SHEPA 50S ribosomal protein L4 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rplD PE=3 SV=1 102 196 9.0E-15
sp|Q8K951|RL4_BUCAP 50S ribosomal protein L4 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rplD PE=3 SV=1 73 244 9.0E-15
sp|A6LLL4|RL4_THEM4 50S ribosomal protein L4 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rplD PE=3 SV=1 100 209 1.0E-14
sp|B8CND4|RL4_SHEPW 50S ribosomal protein L4 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rplD PE=3 SV=1 102 196 1.0E-14
sp|A0L5X4|RL4_MAGMM 50S ribosomal protein L4 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rplD PE=3 SV=1 98 197 1.0E-14
sp|C5CGR3|RL4_KOSOT 50S ribosomal protein L4 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rplD PE=3 SV=1 101 198 1.0E-14
sp|P61060|RL4_STAAW 50S ribosomal protein L4 OS=Staphylococcus aureus (strain MW2) GN=rplD PE=3 SV=1 102 205 1.0E-14
sp|Q6G772|RL4_STAAS 50S ribosomal protein L4 OS=Staphylococcus aureus (strain MSSA476) GN=rplD PE=3 SV=1 102 205 1.0E-14
sp|P61059|RL4_STAAN 50S ribosomal protein L4 OS=Staphylococcus aureus (strain N315) GN=rplD PE=1 SV=1 102 205 1.0E-14
sp|P61058|RL4_STAAM 50S ribosomal protein L4 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rplD PE=3 SV=1 102 205 1.0E-14
sp|A6QJ91|RL4_STAAE 50S ribosomal protein L4 OS=Staphylococcus aureus (strain Newman) GN=rplD PE=3 SV=1 102 205 1.0E-14
sp|Q5HDV9|RL4_STAAC 50S ribosomal protein L4 OS=Staphylococcus aureus (strain COL) GN=rplD PE=3 SV=1 102 205 1.0E-14
sp|Q2YYP7|RL4_STAAB 50S ribosomal protein L4 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rplD PE=3 SV=1 102 205 1.0E-14
sp|A5IV33|RL4_STAA9 50S ribosomal protein L4 OS=Staphylococcus aureus (strain JH9) GN=rplD PE=3 SV=1 102 205 1.0E-14
sp|Q2FW07|RL4_STAA8 50S ribosomal protein L4 OS=Staphylococcus aureus (strain NCTC 8325) GN=rplD PE=1 SV=1 102 205 1.0E-14
sp|Q2FEP0|RL4_STAA3 50S ribosomal protein L4 OS=Staphylococcus aureus (strain USA300) GN=rplD PE=3 SV=1 102 205 1.0E-14
sp|A6U3X4|RL4_STAA2 50S ribosomal protein L4 OS=Staphylococcus aureus (strain JH1) GN=rplD PE=3 SV=1 102 205 1.0E-14
sp|A7X5G2|RL4_STAA1 50S ribosomal protein L4 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rplD PE=3 SV=1 102 205 1.0E-14
sp|A0T0H9|RK4_PHATC 50S ribosomal protein L4, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=rpl4 PE=3 SV=1 73 197 1.0E-14
sp|Q7U4J9|RL4_SYNPX 50S ribosomal protein L4 OS=Synechococcus sp. (strain WH8102) GN=rplD PE=3 SV=1 101 205 1.0E-14
sp|Q3AMN1|RL4_SYNSC 50S ribosomal protein L4 OS=Synechococcus sp. (strain CC9605) GN=rplD PE=3 SV=1 101 187 1.0E-14
sp|Q9L0D9|RL4_STRCO 50S ribosomal protein L4 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=rplD PE=3 SV=1 87 205 1.0E-14
sp|A0T0X3|RK4_THAPS 50S ribosomal protein L4, chloroplastic OS=Thalassiosira pseudonana GN=rpl4 PE=3 SV=1 102 203 1.0E-14
sp|C4LL51|RL4_CORK4 50S ribosomal protein L4 OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=rplD PE=3 SV=1 102 198 1.0E-14
sp|P42921|RL4_BACSU 50S ribosomal protein L4 OS=Bacillus subtilis (strain 168) GN=rplD PE=1 SV=1 102 198 2.0E-14
sp|A5WCJ1|RL4_PSYWF 50S ribosomal protein L4 OS=Psychrobacter sp. (strain PRwf-1) GN=rplD PE=3 SV=1 102 294 2.0E-14
sp|Q38UR3|RL4_LACSS 50S ribosomal protein L4 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rplD PE=3 SV=1 89 205 2.0E-14
sp|O06114|RL4_MYCSM 50S ribosomal protein L4 OS=Mycobacterium smegmatis GN=rplD PE=3 SV=1 102 205 2.0E-14
sp|A4IZT3|RL4_FRATW 50S ribosomal protein L4 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rplD PE=3 SV=1 102 198 2.0E-14
sp|Q5NHW7|RL4_FRATT 50S ribosomal protein L4 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rplD PE=3 SV=1 102 198 2.0E-14
sp|Q0BNS6|RL4_FRATO 50S ribosomal protein L4 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rplD PE=3 SV=1 102 198 2.0E-14
sp|A0Q4I4|RL4_FRATN 50S ribosomal protein L4 OS=Francisella tularensis subsp. novicida (strain U112) GN=rplD PE=3 SV=1 102 198 2.0E-14
sp|Q2A5G9|RL4_FRATH 50S ribosomal protein L4 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rplD PE=3 SV=1 102 198 2.0E-14
sp|A7N9S7|RL4_FRATF 50S ribosomal protein L4 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rplD PE=3 SV=1 102 198 2.0E-14
sp|Q14JB9|RL4_FRAT1 50S ribosomal protein L4 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rplD PE=3 SV=1 102 198 2.0E-14
sp|Q7VQE7|RL4_BLOFL 50S ribosomal protein L4 OS=Blochmannia floridanus GN=rplD PE=3 SV=1 97 198 2.0E-14
sp|B7GND9|RL4_BIFLS 50S ribosomal protein L4 OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=rplD PE=3 SV=1 102 200 2.0E-14
sp|Q8G416|RL4_BIFLO 50S ribosomal protein L4 OS=Bifidobacterium longum (strain NCC 2705) GN=rplD PE=3 SV=1 102 200 2.0E-14
sp|B3DQ14|RL4_BIFLD 50S ribosomal protein L4 OS=Bifidobacterium longum (strain DJO10A) GN=rplD PE=3 SV=1 102 200 2.0E-14
sp|Q487Z4|RL4_COLP3 50S ribosomal protein L4 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rplD PE=3 SV=1 102 294 2.0E-14
sp|Q839G3|RL4_ENTFA 50S ribosomal protein L4 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rplD PE=3 SV=1 102 205 3.0E-14
sp|A1S219|RL4_SHEAM 50S ribosomal protein L4 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rplD PE=3 SV=1 102 244 3.0E-14
sp|B2GDW8|RL4_LACF3 50S ribosomal protein L4 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rplD PE=3 SV=1 104 294 3.0E-14
sp|O49937|RK4_SPIOL 50S ribosomal protein L4, chloroplastic OS=Spinacia oleracea GN=RPL4 PE=1 SV=1 68 185 3.0E-14
sp|B2SDY4|RL4_FRATM 50S ribosomal protein L4 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rplD PE=3 SV=1 102 198 3.0E-14
sp|P47398|RL4_MYCGE 50S ribosomal protein L4 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rplD PE=3 SV=1 103 294 3.0E-14
sp|C1F641|RL4_ACIC5 50S ribosomal protein L4 OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=rplD PE=3 SV=1 93 196 4.0E-14
sp|Q2JFH5|RL4_FRASC 50S ribosomal protein L4 OS=Frankia sp. (strain CcI3) GN=rplD PE=3 SV=1 96 221 4.0E-14
sp|B0RZU1|RL4_FINM2 50S ribosomal protein L4 OS=Finegoldia magna (strain ATCC 29328) GN=rplD PE=3 SV=1 102 197 4.0E-14
sp|A5EX81|RL4_DICNV 50S ribosomal protein L4 OS=Dichelobacter nodosus (strain VCS1703A) GN=rplD PE=3 SV=1 102 294 4.0E-14
sp|B5ELY0|RL4_ACIF5 50S ribosomal protein L4 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rplD PE=3 SV=1 96 290 4.0E-14
sp|B7J468|RL4_ACIF2 50S ribosomal protein L4 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rplD PE=3 SV=1 96 290 4.0E-14
sp|Q6B8V4|RK4_GRATL 50S ribosomal protein L4, chloroplastic OS=Gracilaria tenuistipitata var. liui GN=rpl4 PE=3 SV=1 102 189 4.0E-14
sp|Q8ETY1|RL4_OCEIH 50S ribosomal protein L4 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rplD PE=3 SV=1 102 198 4.0E-14
sp|C1CXG5|RL4_DEIDV 50S ribosomal protein L4 OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=rplD PE=3 SV=1 102 202 4.0E-14
sp|B9MKI0|RL4_CALBD 50S ribosomal protein L4 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rplD PE=3 SV=1 96 294 5.0E-14
sp|Q5Z1W2|RL4_NOCFA 50S ribosomal protein L4 OS=Nocardia farcinica (strain IFM 10152) GN=rplD PE=3 SV=1 102 198 5.0E-14
sp|Q2W2J2|RL4_MAGSA 50S ribosomal protein L4 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rplD PE=3 SV=1 84 197 5.0E-14
sp|O50061|RK4_ARATH 50S ribosomal protein L4, chloroplastic OS=Arabidopsis thaliana GN=RPL4 PE=2 SV=2 72 174 6.0E-14
sp|C3MAY1|RL4_RHISN 50S ribosomal protein L4 OS=Rhizobium sp. (strain NGR234) GN=rplD PE=3 SV=1 99 198 6.0E-14
sp|A4XLS9|RL4_CALS8 50S ribosomal protein L4 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rplD PE=3 SV=1 96 294 6.0E-14
sp|Q49ZG7|RL4_STAS1 50S ribosomal protein L4 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rplD PE=3 SV=1 101 238 7.0E-14
sp|Q11HQ3|RL4_CHESB 50S ribosomal protein L4 OS=Chelativorans sp. (strain BNC1) GN=rplD PE=3 SV=1 99 198 8.0E-14
sp|B4U745|RL4_HYDS0 50S ribosomal protein L4 OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=rplD PE=3 SV=1 99 294 8.0E-14
sp|Q03PV8|RL4_LACBA 50S ribosomal protein L4 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rplD PE=3 SV=1 99 205 8.0E-14
sp|Q3J8R5|RL4_NITOC 50S ribosomal protein L4 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rplD PE=3 SV=1 92 200 8.0E-14
sp|A0ALW7|RL4_LISW6 50S ribosomal protein L4 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rplD PE=3 SV=1 102 205 9.0E-14
sp|A8ESU4|RL4_ARCB4 50S ribosomal protein L4 OS=Arcobacter butzleri (strain RM4018) GN=rplD PE=3 SV=1 83 197 9.0E-14
sp|B9E9J2|RL4_MACCJ 50S ribosomal protein L4 OS=Macrococcus caseolyticus (strain JCSC5402) GN=rplD PE=3 SV=1 102 294 1.0E-13
sp|A4XZ89|RL4_PSEMY 50S ribosomal protein L4 OS=Pseudomonas mendocina (strain ymp) GN=rplD PE=3 SV=1 102 198 1.0E-13
sp|P61055|RL4_LISMO 50S ribosomal protein L4 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rplD PE=3 SV=1 102 205 1.0E-13
sp|B8DB09|RL4_LISMH 50S ribosomal protein L4 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rplD PE=3 SV=1 102 205 1.0E-13
sp|Q71WE7|RL4_LISMF 50S ribosomal protein L4 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rplD PE=3 SV=1 102 205 1.0E-13
sp|C1KZH9|RL4_LISMC 50S ribosomal protein L4 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rplD PE=3 SV=1 102 205 1.0E-13
sp|P61054|RL4_LISIN 50S ribosomal protein L4 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rplD PE=3 SV=1 102 205 1.0E-13
sp|Q89J85|RL4_BRADU 50S ribosomal protein L4 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rplD PE=3 SV=2 99 197 1.0E-13
sp|Q92QG9|RL4_RHIME 50S ribosomal protein L4 OS=Rhizobium meliloti (strain 1021) GN=rplD PE=3 SV=1 99 198 1.0E-13
sp|B3E7T6|RL4_GEOLS 50S ribosomal protein L4 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rplD PE=3 SV=1 98 291 1.0E-13
sp|Q1WS91|RL4_LACS1 50S ribosomal protein L4 OS=Lactobacillus salivarius (strain UCC118) GN=rplD PE=3 SV=1 99 205 1.0E-13
sp|Q03EB7|RL4_PEDPA 50S ribosomal protein L4 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rplD PE=3 SV=1 101 204 1.0E-13
sp|Q1IX73|RL4_DEIGD 50S ribosomal protein L4 OS=Deinococcus geothermalis (strain DSM 11300) GN=rplD PE=3 SV=1 102 234 1.0E-13
sp|B2IK63|RL4_BEII9 50S ribosomal protein L4 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rplD PE=3 SV=1 99 198 1.0E-13
sp|A5GAW6|RL4_GEOUR 50S ribosomal protein L4 OS=Geobacter uraniireducens (strain Rf4) GN=rplD PE=3 SV=1 102 198 1.0E-13
sp|A8F4R2|RL4_PSELT 50S ribosomal protein L4 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rplD PE=3 SV=1 101 201 2.0E-13
sp|A6U860|RL4_SINMW 50S ribosomal protein L4 OS=Sinorhizobium medicae (strain WSM419) GN=rplD PE=3 SV=1 99 198 2.0E-13
sp|Q9TLT3|RK4_CYACA 50S ribosomal protein L4, chloroplastic OS=Cyanidium caldarium GN=rpl4 PE=3 SV=1 102 185 2.0E-13
sp|Q4L8B3|RL4_STAHJ 50S ribosomal protein L4 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rplD PE=3 SV=1 102 205 2.0E-13
sp|Q8UE19|RL4_AGRFC 50S ribosomal protein L4 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rplD PE=3 SV=1 99 197 2.0E-13
sp|Q250N1|RL4_DESHY 50S ribosomal protein L4 OS=Desulfitobacterium hafniense (strain Y51) GN=rplD PE=3 SV=1 102 198 2.0E-13
sp|Q82DP4|RL4_STRAW 50S ribosomal protein L4 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=rplD PE=3 SV=1 87 205 2.0E-13
sp|Q21RV9|RL4_RHOFT 50S ribosomal protein L4 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rplD PE=3 SV=1 101 205 2.0E-13
sp|Q6FZC3|RL4_BARQU 50S ribosomal protein L4 OS=Bartonella quintana (strain Toulouse) GN=rplD PE=3 SV=1 99 198 2.0E-13
sp|B0U0Y8|RL4_FRAP2 50S ribosomal protein L4 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rplD PE=3 SV=1 102 196 2.0E-13
sp|B8G1W7|RL4_DESHD 50S ribosomal protein L4 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rplD PE=3 SV=1 102 198 3.0E-13
sp|O32982|RL4_MYCLE 50S ribosomal protein L4 OS=Mycobacterium leprae (strain TN) GN=rplD PE=3 SV=1 97 205 3.0E-13
sp|B8ZSB8|RL4_MYCLB 50S ribosomal protein L4 OS=Mycobacterium leprae (strain Br4923) GN=rplD PE=3 SV=1 97 205 3.0E-13
sp|Q31IY1|RL4_THICR 50S ribosomal protein L4 OS=Thiomicrospira crunogena (strain XCL-2) GN=rplD PE=3 SV=1 115 294 3.0E-13
sp|A1A070|RL4_BIFAA 50S ribosomal protein L4 OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=rplD PE=3 SV=1 99 200 3.0E-13
sp|Q1GK36|RL4_RUEST 50S ribosomal protein L4 OS=Ruegeria sp. (strain TM1040) GN=rplD PE=3 SV=1 92 297 3.0E-13
sp|Q134T0|RL4_RHOPS 50S ribosomal protein L4 OS=Rhodopseudomonas palustris (strain BisB5) GN=rplD PE=3 SV=1 99 299 3.0E-13
sp|Q4JT48|RL4_CORJK 50S ribosomal protein L4 OS=Corynebacterium jeikeium (strain K411) GN=rplD PE=3 SV=1 102 198 3.0E-13
sp|A1ALU2|RL4_PELPD 50S ribosomal protein L4 OS=Pelobacter propionicus (strain DSM 2379) GN=rplD PE=3 SV=1 98 294 4.0E-13
sp|Q8CRG1|RL4_STAES 50S ribosomal protein L4 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rplD PE=3 SV=1 102 205 4.0E-13
sp|Q5HM00|RL4_STAEQ 50S ribosomal protein L4 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rplD PE=3 SV=1 102 205 4.0E-13
sp|B8ELG2|RL4_METSB 50S ribosomal protein L4 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rplD PE=3 SV=1 99 198 4.0E-13
sp|P61061|RL4_BDEBA 50S ribosomal protein L4 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rplD PE=3 SV=1 97 197 5.0E-13
sp|B1XSQ2|RL4_POLNS 50S ribosomal protein L4 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=rplD PE=3 SV=1 102 219 6.0E-13
sp|A4YSJ3|RL4_BRASO 50S ribosomal protein L4 OS=Bradyrhizobium sp. (strain ORS278) GN=rplD PE=3 SV=1 99 198 6.0E-13
sp|Q1GPA0|RL4_SPHAL 50S ribosomal protein L4 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rplD PE=3 SV=1 96 297 7.0E-13
sp|Q85FW2|RK4_CYAME 50S ribosomal protein L4, chloroplastic OS=Cyanidioschyzon merolae GN=rpl4 PE=3 SV=2 100 220 7.0E-13
sp|Q2IXQ9|RL4_RHOP2 50S ribosomal protein L4 OS=Rhodopseudomonas palustris (strain HaA2) GN=rplD PE=3 SV=1 99 197 7.0E-13
sp|B9M6U4|RL4_GEODF 50S ribosomal protein L4 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=rplD PE=3 SV=1 98 197 7.0E-13
sp|Q1ISC1|RL4_KORVE 50S ribosomal protein L4 OS=Koribacter versatilis (strain Ellin345) GN=rplD PE=3 SV=1 94 205 7.0E-13
sp|Q2GH55|RL4_EHRCR 50S ribosomal protein L4 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rplD PE=3 SV=1 99 204 7.0E-13
sp|P38516|RL4_THEMA 50S ribosomal protein L4 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rplD PE=1 SV=2 101 189 8.0E-13
sp|B1ZLK5|RL4_METPB 50S ribosomal protein L4 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rplD PE=3 SV=1 99 198 8.0E-13
sp|A9W4Q2|RL4_METEP 50S ribosomal protein L4 OS=Methylobacterium extorquens (strain PA1) GN=rplD PE=3 SV=1 99 198 8.0E-13
sp|B7L0R2|RL4_METC4 50S ribosomal protein L4 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rplD PE=3 SV=1 99 198 8.0E-13
sp|Q6ACZ6|RL4_LEIXX 50S ribosomal protein L4 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=rplD PE=3 SV=1 102 189 8.0E-13
sp|Q0ABH4|RL4_ALKEH 50S ribosomal protein L4 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rplD PE=3 SV=1 98 201 8.0E-13
sp|A5ELM6|RL4_BRASB 50S ribosomal protein L4 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rplD PE=3 SV=1 99 198 9.0E-13
sp|A9BPR9|RL4_DELAS 50S ribosomal protein L4 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rplD PE=3 SV=1 98 205 1.0E-12
sp|B6JET4|RL4_OLICO 50S ribosomal protein L4 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rplD PE=3 SV=1 99 299 1.0E-12
sp|B1IGF3|RL4_CLOBK 50S ribosomal protein L4 OS=Clostridium botulinum (strain Okra / Type B1) GN=rplD PE=3 SV=1 113 294 1.0E-12
sp|Q8NT08|RL4_CORGL 50S ribosomal protein L4 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=rplD PE=3 SV=1 102 198 1.0E-12
sp|A4QBI0|RL4_CORGB 50S ribosomal protein L4 OS=Corynebacterium glutamicum (strain R) GN=rplD PE=3 SV=1 102 198 1.0E-12
sp|C5CP52|RL4_VARPS 50S ribosomal protein L4 OS=Variovorax paradoxus (strain S110) GN=rplD PE=3 SV=1 101 197 1.0E-12
sp|A0PXU7|RL4_CLONN 50S ribosomal protein L4 OS=Clostridium novyi (strain NT) GN=rplD PE=3 SV=1 96 196 1.0E-12
sp|Q0AIJ4|RL4_NITEC 50S ribosomal protein L4 OS=Nitrosomonas eutropha (strain C91) GN=rplD PE=3 SV=1 102 294 1.0E-12
sp|Q2G8X9|RL4_NOVAD 50S ribosomal protein L4 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rplD PE=3 SV=1 99 215 1.0E-12
sp|A4SUW2|RL4_POLSQ 50S ribosomal protein L4 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=rplD PE=3 SV=1 102 219 2.0E-12
sp|Q04PT9|RL4_LEPBJ 50S ribosomal protein L4 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=rplD PE=3 SV=1 103 298 2.0E-12
sp|Q9RXK1|RL4_DEIRA 50S ribosomal protein L4 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rplD PE=1 SV=3 102 202 2.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0043228 non-membrane-bounded organelle No
GO:0110165 cellular anatomical entity No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043226 organelle No
GO:1901576 organic substance biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0003674 molecular_function No
GO:0009059 macromolecule biosynthetic process No
GO:0005198 structural molecule activity No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006518 peptide metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0009058 biosynthetic process No
GO:0043043 peptide biosynthetic process No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043229 intracellular organelle No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3256
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3906
Ophiocordyceps australis map64 (Brazil) OphauB2|6843 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01628
Ophiocordyceps camponoti-rufipedis Ophun1|2901
Ophiocordyceps kimflemingae Ophio5|1754
Ophiocordyceps subramaniannii Hirsu2|5916

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6843
MSSRGIGFLCEAFQTLRVSRPRALSVCASAGAGQQTRMGVRTMATAAPTPTTALSPTAQSLLESWYPSSTVPLTI
HSFPSLEPISLEHWSIQHLFLPLRRDLVYRAICYEGDSHRQGSANSKTRYQVAGSHAKMHPQKGTGRARVGSRQS
PLLRGGGKTFGPHPRDFSTRLNKKIYDKAWRTALSYRYRRGELLVCNDGMDFKFPFVLDHIPQSEIMAEVRDAYM
RKYTARMLAEMQLAGRTLFVTRGGRRGNLYEGMLRAPRLGRVLDLAEVDVKDLLETRTVVMERSALHEMVAQHQS
DLVKNVVVYGAAHKGPPLGVKIF*
Coding >OphauB2|6843
ATGTCGTCGCGAGGGATTGGCTTCCTCTGCGAGGCGTTTCAGACGCTCAGAGTGTCGAGACCAAGGGCCTTGAGT
GTTTGCGCGTCTGCTGGAGCTGGCCAACAGACGCGAATGGGTGTGCGCACAATGGCCACGGCAGCACCGACTCCA
ACCACGGCGCTCTCTCCCACTGCTCAATCTCTATTAGAGTCGTGGTATCCCTCATCAACCGTCCCCCTCACCATC
CACAGCTTCCCCTCCCTCGAGCCCATATCCCTCGAACACTGGTCCATCCAACACCTCTTCCTCCCCCTCCGCCGC
GACCTCGTCTACCGCGCCATTTGCTACGAAGGCGACTCCCACCGCCAAGGCTCCGCCAACTCGAAAACCCGCTAC
CAAGTCGCCGGCTCCCACGCAAAAATGCATCCCCAAAAGGGCACCGGCCGCGCCCGCGTCGGCTCCCGCCAATCC
CCTCTTCTCCGCGGCGGCGGCAAAACATTTGGGCCCCATCCCCGCGACTTTTCTACCCGTCTAAATAAAAAGATT
TACGACAAGGCTTGGCGCACCGCCCTGAGCTATCGCTATCGCCGCGGAGAGCTGCTCGTTTGCAACGACGGCATG
GATTTCAAGTTTCCCTTTGTCTTGGACCATATTCCCCAATCGGAAATCATGGCAGAGGTGCGTGATGCCTATATG
CGCAAATACACAGCCCGCATGCTGGCTGAGATGCAGCTTGCCGGTCGCACCTTGTTTGTTACCCGAGGGGGGCGC
CGCGGCAACTTGTACGAGGGCATGCTGCGCGCGCCGAGGCTGGGCCGCGTGCTCGACTTGGCAGAGGTGGATGTC
AAGGATTTGCTCGAGACGCGCACAGTGGTGATGGAGCGGAGCGCCCTGCATGAAATGGTTGCGCAGCACCAGTCA
GACTTGGTCAAAAACGTTGTCGTTTACGGCGCGGCGCACAAGGGGCCGCCGTTGGGCGTCAAGATATTCTAG
Transcript >OphauB2|6843
ATGTCGTCGCGAGGGATTGGCTTCCTCTGCGAGGCGTTTCAGACGCTCAGAGTGTCGAGACCAAGGGCCTTGAGT
GTTTGCGCGTCTGCTGGAGCTGGCCAACAGACGCGAATGGGTGTGCGCACAATGGCCACGGCAGCACCGACTCCA
ACCACGGCGCTCTCTCCCACTGCTCAATCTCTATTAGAGTCGTGGTATCCCTCATCAACCGTCCCCCTCACCATC
CACAGCTTCCCCTCCCTCGAGCCCATATCCCTCGAACACTGGTCCATCCAACACCTCTTCCTCCCCCTCCGCCGC
GACCTCGTCTACCGCGCCATTTGCTACGAAGGCGACTCCCACCGCCAAGGCTCCGCCAACTCGAAAACCCGCTAC
CAAGTCGCCGGCTCCCACGCAAAAATGCATCCCCAAAAGGGCACCGGCCGCGCCCGCGTCGGCTCCCGCCAATCC
CCTCTTCTCCGCGGCGGCGGCAAAACATTTGGGCCCCATCCCCGCGACTTTTCTACCCGTCTAAATAAAAAGATT
TACGACAAGGCTTGGCGCACCGCCCTGAGCTATCGCTATCGCCGCGGAGAGCTGCTCGTTTGCAACGACGGCATG
GATTTCAAGTTTCCCTTTGTCTTGGACCATATTCCCCAATCGGAAATCATGGCAGAGGTGCGTGATGCCTATATG
CGCAAATACACAGCCCGCATGCTGGCTGAGATGCAGCTTGCCGGTCGCACCTTGTTTGTTACCCGAGGGGGGCGC
CGCGGCAACTTGTACGAGGGCATGCTGCGCGCGCCGAGGCTGGGCCGCGTGCTCGACTTGGCAGAGGTGGATGTC
AAGGATTTGCTCGAGACGCGCACAGTGGTGATGGAGCGGAGCGCCCTGCATGAAATGGTTGCGCAGCACCAGTCA
GACTTGGTCAAAAACGTTGTCGTTTACGGCGCGGCGCACAAGGGGCCGCCGTTGGGCGTCAAGATATTCTAG
Gene >OphauB2|6843
ATGTCGTCGCGAGGGATTGGCTTCCTCTGCGAGGCGTTTCAGACGCTCAGAGTGTCGAGACCAAGGGCCTTGAGT
GTTTGCGCGTCTGCTGGAGCTGGCCAACAGACGCGAATGGGTGTGCGCACAATGGCCACGGCAGCACCGACTCCA
ACCACGGCGCTCTCTCCCACTGCTCAATCTCTATTAGAGTCGTGGTATCCCTGTAAGGAAACCCCATTCCATCAC
CAACCTCGCCTCTAACCCCCAATATCCCCAAACCACGACCACGACTAACCTCACCCAGCATCAACCGTCCCCCTC
ACCATCCACAGCTTCCCCTCCCTCGAGCCCATATCCCTCGAACACTGGTCCATCCAACACCTCTTCCTCCCCCTC
CGCCGCGACCTCGTCTACCGCGCCATTTGCTACGAAGGCGACTCCCACCGCCAAGGCTCCGCCAACTCGAAAACC
CGCTACCAAGTCGCCGGCTCCCACGCAAAAATGCATCCCCAAAAGGGCACCGGCCGCGCCCGCGTCGGCTCCCGC
CAATCCCCTCTTCTCCGCGGCGGCGGCAAAACATTTGGGCCCCATCCCCGCGACTTTTCTACCCGTCTAAATAAA
AAGATTTACGACAAGGCTTGGCGCACCGCCCTGAGCTATCGCTATCGCCGCGGAGAGCTGCTCGTTTGCAACGAC
GGCATGGATTTCAAGTTTCCCTTTGTCTTGGACCATATTCCCCAATCGGAAATCATGGCAGAGGTGCGTGATGCC
TATATGCGCAAATACACAGCCCGCATGCTGGCTGAGATGCAGCTTGCCGGTCGCACCTTGTTTGTTACCCGAGGG
GGGCGCCGCGGCAACTTGTACGAGGGCATGCTGCGCGCGCCGAGGCTGGGCCGCGTGCTCGACTTGGCAGAGGTG
GATGTCAAGGATTTGCTCGAGACGCGCACAGTGGTGATGGAGCGGAGCGCCCTGCATGAAATGGTTGCGCAGCAC
CAGTCAGACTTGGTCAAAAACGTTGTCGTTTACGGCGCGGCGCACAAGGGGCCGCCGTTGGGCGTCAAGATATTC
TAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail